Citrus Sinensis ID: 016388


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390
MIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP
cccccccccccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccHHccccccHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccHHHHHHHHHcccEEEEcccEEEEEEcccccEEEEEEcccEEEEccEEEEccccHHHHHcccccccccHHHHHHcccccccEEEEEEEcccccccccccEEcccccccccccccccccccccccccEEEEEEECcccccccccHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEcccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
MIFAM**KPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARG***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phytoene dehydrogenase, chloroplastic/chromoplastic This enzyme converts phytoene into zeta-carotene via the intermediary of phytofluene by the symmetrical introduction of two double bonds at the C-11 and C-11' positions of phytoene.probableQ0DUI8
15-cis-phytoene desaturase, chloroplastic/chromoplastic This enzyme converts phytoene into zeta-carotene via the intermediary of phytofluene by the symmetrical introduction of two double bonds at the C-11 and C-11' positions of phytoene. The zeta-carotene produced has a central C15-C15' double bond in the cis configuration and it requires isomerization before being recognized as substrate by ZDS, the next enzyme in the lycopene biosynthesis pathway.probableQ07356
15-cis-phytoene desaturase This enzyme converts phytoene into zeta-carotene via the intermediary of phytofluene by the symmetrical introduction of two double bonds at the C-11 and C-11' positions of phytoene. Also active with phytofluene and 1,2-epoxyphytoene as substrates.probableP26294

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KA7, chain A
Confidence level:very confident
Coverage over the Query: 37-361
View the alignment between query and template
View the model in PyMOL
Template: 1SEZ, chain A
Confidence level:confident
Coverage over the Query: 21-374
View the alignment between query and template
View the model in PyMOL