Citrus Sinensis ID: 016429


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390
MMVHRKKKPALVIVAVLTLLCIAPTLAVNAKQERKLRFRQNGEFKILQVADMHFANGKTTPCLDVLPSQVAGCSDLNTTAFINRMISAEKPDLIVFTGDNIFGFDATDAAKSLNAAFAPAIASNIPWVAVLGNHDQESTLSREGVMKHIVTLKNTLSQVNPSDAHIIDGFGNYNLEIGGVKGSGFENKSVLNLYFLDSGDYSTVPSVPGYGWIKPSQQFWFEQTSARLQRAYMSKPAAQKAPAPGLVYFHIPLPEFAYFDQSNFTGVRQEGISSASVNSGFFTTMVAAGDVKAVFTGHDHVNDFCGRLTGIQLCYGGGFGYHAYGKAGWERRARVVVASLEKTEKRGWGDVKSIKTWKRLDDEHLTGVDGHVLWSKTSSGMRRRKHTNGA
cccccccHHHHHHHHHHHHHHHHcccccccccccccEEcccccEEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHccccccccccccccccccccccEEEEcccccccccccCEEEEEEECcccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEcccHHccccccccccccccccccccccccHHHHHHHHcccEEEEEEccccccccccccccEEEEECccccccccccccccccEEEEEEEccccccccccccccEEEEEEccccccccCCcEEEEEccccccccccccccc
*********ALVIVAVLTLLCIAPTLAVNAKQERKLRFRQNGEFKILQVADMHFANGKTTPCLDVLPSQVAGCSDLNTTAFINRMISAEKPDLIVFTGDNIFGFDATDAAKSLNAAFAPAIASNIPWVAVLGNHDQESTLSREGVMKHIVTLKNTLSQVNPSDAHIIDGFGNYNLEIGGVKGSGFENKSVLNLYFLDSGDYSTVPSVPGYGWIKPSQQFWFEQTSARLQRA********KAPAPGLVYFHIPLPEFAYFDQSNFTGVRQEGISSASVNSGFFTTMVAAGDVKAVFTGHDHVNDFCGRLTGIQLCYGGGFGYHAYGKAGWERRARVVVASLEKTEKRGWGDVKSIKTWKRLDDEHLTGVDGHVLW****************
xxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMVHRKKKPALVIVAVLTLLCIAPTLAVNAKQERKLRFRQNGEFKILQVADMHFANGKTTPCLDVLPSQVAGCSDLNTTAFINRMISAEKPDLIVFTGDNIFGFDATDAAKSLNAAFAPAIASNIPWVAVLGNHDQESTLSREGVMKHIVTLKNTLSQVNPSDAHIIDGFGNYNLEIGGVKGSGFENKSVLNLYFLDSGDYSTVPSVPGYGWIKPSQQFWFEQTSARLQRAYMSKPAAQKAPAPGLVYFHIPLPEFAYFDQSNFTGVRQEGISSASVNSGFFTTMVAAGDVKAVFTGHDHVNDFCGRLTGIQLCYGGGFGYHAYGKAGWERRARVVVASLEKTEKRGWGDVKSIKTWKRLDDEHLTGVDGHVLWSKTSSGMRRRKHTNGA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable inactive purple acid phosphatase 29 confidentQ9FMK9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UTE, chain A
Confidence level:confident
Coverage over the Query: 41-62,73-228,241-341,353-377
View the alignment between query and template
View the model in PyMOL
Template: 2NXF, chain A
Confidence level:confident
Coverage over the Query: 41-179,191-230,241-342,354-362
View the alignment between query and template
View the model in PyMOL