Citrus Sinensis ID: 016433


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39
MGDSLLLNQSLARLKLLPKIPPPASQFLHIKPPQPHGKLHSTASFAIQNQQQTQYGTTDQNDDESYGEVSKIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYESPWWTAAKKADDAALKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLNHRDSGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTPKGNPMQFARRLGLEAVIRNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAEDLVTDYEAGLEYAVAEGVLGKRMGDDGKREFLVKWTDIDEATWEPEENVDPDLIKEFEDSQSDGAVLLNENHIGDAVGARAQLSEGDAAPESARV
ccHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHccccccccccHHHHHHcccHHHHHHHHHHccccccHHHHHHHHcccccccccccccccHHHccccccHHHHHHHHccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccccccccHHHHHHHccHHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHccccccccccHHcccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHcccccccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHccccccccccccc
***SLLLNQSLA**************FL*IKPPQPHGKLHSTASFAIQNQQQTQYGTTDQNDDESYGEVSKIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYESPWWTAAKKADDAALKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLNHRDSGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTPKGNPMQFARRLGLEAVIRNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAEDLVTDYEAGLEYAVAEGVLGKRMGDDGKREFLVKWTDIDEATWEPEENVDPDLIKEFEDSQSDGAVLLNENHIGDAVGARA**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDSLLLNQSLARLKLLPKIPPPASQFLHIKPPQPHGKLHSTASFAIQNQQQTQYGTTDQNDDESYGEVSKIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYESPWWTAAKKADDAALKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLNHRDSGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTPKGNPMQFARRLGLEAVIRNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAEDLVTDYEAGLEYAVAEGVLGKRMGDDGKREFLVKWTDIDEATWEPEENVDPDLIKEFEDSQSDGAVLLNENHIGDAVGARAQLSEGDAAPESARV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal recognition particle 43 kDa protein, chloroplastic Component of the chloroplast signal recognition particle pathway. Required for post-translational targeting of proteins into the tylakoid membrane but seems to be dispensable for co-translational targeting with a translating ribosome present. May be able to function independently of cpFTSY and FFC/cpSRP54 in targeting LHCPs to the thylakoids. Acts as a highly specific chaperone for LHCPs, preventing aggregation and being able to dissolve aggregates.probableO22265
Probable signal recognition particle 43 kDa protein, chloroplastic Component of the chloroplast signal recognition particle parthway. Targets proteins into the tylakoid membrane.probableQ8LSQ2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 66-92,104-279
View the alignment between query and template
View the model in PyMOL
Template: 3UI2, chain A
Confidence level:very confident
Coverage over the Query: 81-305
View the alignment between query and template
View the model in PyMOL
Template: 3UI2, chain A
Confidence level:very confident
Coverage over the Query: 111-223,240-282,307-356
View the alignment between query and template
View the model in PyMOL