Citrus Sinensis ID: 016433

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39
MGDSLLLNQSLARLKLLPKIPPPASQFLHIKPPQPHGKLHSTASFAIQNQQQTQYGTTDQNDDESYGEVSKIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYESPWWTAAKKADDAALKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLNHRDSGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTPKGNPMQFARRLGLEAVIRNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAEDLVTDYEAGLEYAVAEGVLGKRMGDDGKREFLVKWTDIDEATWEPEENVDPDLIKEFEDSQSDGAVLLNENHIGDAVGARAQLSEGDAAPESARV
ccHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHcccccccccHHHHHHHHccHHHHHHHHHHccccccHHHHHHHHHccccccccccccccHHHccccccHHHHHHHHccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccccccccHHHHHHHccHHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHcccccccccHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHcccccccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHccccccccccccc
cccEEEEcccHHccccccccccccccccccccccccccHHHHHccccccEEEccccccccccccccccccHHHHHHHccccHHHHHHHHccccccccccccccHHHHHHcccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHccccHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccEEEEEEEcccccccHccHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccEEEEEEEcccccccccHHcccHHHHHHHHHccccccEEEEccccccHHcHHHHccccccccccccc
MGDSLLLNQSLARLkllpkipppasqflhikppqphgklhstaSFAIQnqqqtqygttdqnddesyGEVSKIIGsraledatGMEYLIEwkdghapswvpqdyiAKDVVaeyespwwtaAKKADDAALKEIIEagdgrdvdavdndGRTALLFVSGLGSEACVRVLAEAgtdlnhrdsggglTALHMAAGYVKPGVAKLLLELgadadveddrgltPLALAKEIlrvtpkgnpmQFARRLGLEAVIRNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWrdggdnewvKVGFIAEDLVTDYEAGLEYAVAEGVlgkrmgddgkrEFLVKWtdideatwepeenvdpdliKEFEDSQSDGAVLLnenhigdavgaraqlsegdaapesarv
MGDSLLLNQSLARLKLLPKIPPPASQFLHIKPPQPHGKLHSTASFAIQNQQQTQYGTTDQNDDESYGEVSKIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYESPWWTAAKKADDAALKEIIEagdgrdvdavdNDGRTALLFVSGLGSEACVRVLAEAGTDLNHRDSGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKeilrvtpkgnpmQFARRLGLEAVIRNLEEAVFEYAEVQEIlekrgkgdqLEYLVKwrdggdneWVKVGFIAEDLVTDYEAGLEYAVAEgvlgkrmgddgkREFLVKWtdideatwepeenvdPDLIKEFEDSQSDGAVLLNENHIGDAVGARaqlsegdaapesarv
MGDSLLLNQSLARLKLLPKIPPPASQFLHIKPPQPHGKLHSTASFAIQNQQQTQYGTTDQNDDESYGEVSKIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYESPWWTaakkaddaaLKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLNHRDSGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTPKGNPMQFARRLGLEAVIRNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAEDLVTDYEAGLEYAVAEGVLGKRMGDDGKREFLVKWTDIDEATWEPEENVDPDLIKEFEDSQSDGAVLLNENHIGDAVGARAQLSEGDAAPESARV
**********************************************************************KIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYESPWWTAAKKADDAALKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLNHRDSGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTPKGNPMQFARRLGLEAVIRNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAEDLVTDYEAGLEYAVAEGVLGKRMGDDGKREFLVKWTDIDEATWE***************************************************
***SLLLNQSLA**************FL*IKPPQPHGKLHSTASFAIQNQQQTQYGTTDQNDDESYGEVSKIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYESPWWTAAKKADDAALKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLNHRDSGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTPKGNPMQFARRLGLEAVIRNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAEDLVTDYEAGLEYAVAEGVLGKRMGDDGKREFLVKWTDIDEATWEPEENVDPDLIKEFEDSQSDGAVLLNENHIGDAVGARA**************
MGDSLLLNQSLARLKLLPKIPPPASQFLHIKPPQPHGKLHSTASFAIQNQQ****************EVSKIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYESPWWTAAKKADDAALKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLNHRDSGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTPKGNPMQFARRLGLEAVIRNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAEDLVTDYEAGLEYAVAEGVLGKRMGDDGKREFLVKWTDIDEATWEPEENVDPDLIKEFEDSQSDGAVLLNENHIGDAVGARA**************
**D**L**QSLARLKLLPKIPPPASQFLHIKPPQPHGKLHSTASFAIQNQQQTQYGTTDQNDDESYGEVSKIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYESPWWTAAKKADDAALKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLNHRDSGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTPKGNPMQFARRLGLEAVIRNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAEDLVTDYEAGLEYAVAEGVLGKRMGDDGKREFLVKWTDIDEATWEPEENVDPDLIKEFEDSQSDGAVLLNENHIGDAVGAR***************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDSLLLNQSLARLKLLPKIPPPASQFLHIKPPQPHGKLHSTASFAIQNQQQTQYGTTDQNDDESYGEVSKIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYESPWWTAAKKADDAALKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLNHRDSGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTPKGNPMQFARRLGLEAVIRNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAEDLVTDYEAGLEYAVAEGVLGKRMGDDGKREFLVKWTDIDEATWEPEENVDPDLIKEFEDSQSDGAVLLNENHIGDAVGARAQLSEGDAAPESARV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query389 2.2.26 [Sep-21-2011]
O22265373 Signal recognition partic yes no 0.894 0.932 0.593 1e-113
Q8LSQ2388 Probable signal recogniti yes no 0.902 0.904 0.497 3e-94
Q6NXT1300 Ankyrin repeat domain-con yes no 0.370 0.48 0.367 6e-11
Q1LZC5299 Ankyrin repeat domain-con yes no 0.370 0.481 0.360 8e-11
Q91WK7299 Ankyrin repeat domain-con yes no 0.370 0.481 0.360 4e-10
Q566C8299 Ankyrin repeat domain-con yes no 0.370 0.481 0.360 4e-10
Q69ZR2 2618 E3 ubiquitin-protein liga no no 0.262 0.038 0.371 7e-10
Q6DGX3315 Ankyrin repeat domain-con yes no 0.365 0.450 0.327 3e-09
Q9ULT8 2610 E3 ubiquitin-protein liga no no 0.259 0.038 0.371 1e-08
Q9SAR5342 Ankyrin repeat domain-con no no 0.236 0.269 0.389 9e-08
>sp|O22265|SR43C_ARATH Signal recognition particle 43 kDa protein, chloroplastic OS=Arabidopsis thaliana GN=CAO PE=1 SV=2 Back     alignment and function desciption
 Score =  408 bits (1048), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 215/362 (59%), Positives = 266/362 (73%), Gaps = 14/362 (3%)

Query: 4   SLLLNQSLARLKLLPKIPPPASQFLHIKPPQPHGKLHSTASFAIQNQQQTQYGTTDQNDD 63
           +L+++QSL+R+KL P     +S         P  ++      AI    Q  Y  T  + +
Sbjct: 12  ALVIHQSLSRIKLSPPKSSSSSSSAFSPESLPIRRIELCFRGAICAAVQRNYEETTSSVE 71

Query: 64  ES---------YGEVSKIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYES 114
           E+         YGEV+KIIGSR   +   MEYLIEWKDGH+PSWVP  YIA DVV+EYE+
Sbjct: 72  EAEEDDESSSSYGEVNKIIGSRTAGEG-AMEYLIEWKDGHSPSWVPSSYIAADVVSEYET 130

Query: 115 PWWTAAKKADDAALKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLN 174
           PWWTAA+KAD+ AL +++E    RDVDAVD +GRTALLFV+GLGS+ CVR+LAEAG DL+
Sbjct: 131 PWWTAARKADEQALSQLLE---DRDVDAVDENGRTALLFVAGLGSDKCVRLLAEAGADLD 187

Query: 175 HRDSGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTPKGNPM 234
           HRD  GGLTALHMAAGYV+P V + L+ELGAD +VED+RGLT L LA+EIL+ TPKGNPM
Sbjct: 188 HRDMRGGLTALHMAAGYVRPEVVEALVELGADIEVEDERGLTALELAREILKTTPKGNPM 247

Query: 235 QFARRLGLEAVIRNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAE 294
           QF RR+GLE VI  LE  VFEYAEV EI+EKRGKG  +EYLV+W+DGGD EWVK   +AE
Sbjct: 248 QFGRRIGLEKVINVLEGQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAE 307

Query: 295 DLVTDYEAGLEYAVAEGVLGKRMGDDGKR-EFLVKWTDIDEATWEPEENVDPDLIKEFED 353
           D+  DYE GLEYAVAE V+GKR+GDDGK  E+LVKWTD+ +ATWEP++NVD  L+  ++ 
Sbjct: 308 DVAKDYEDGLEYAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQ 367

Query: 354 SQ 355
            Q
Sbjct: 368 QQ 369
Component of the chloroplast signal recognition particle pathway. Required for post-translational targeting of proteins into the tylakoid membrane but seems to be dispensable for co-translational targeting with a translating ribosome present. May be able to function independently of cpFTSY and FFC/cpSRP54 in targeting LHCPs to the thylakoids. Acts as a highly specific chaperone for LHCPs, preventing aggregation and being able to dissolve aggregates.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8LSQ2|SR43C_ORYSJ Probable signal recognition particle 43 kDa protein, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0131900 PE=2 SV=1 Back     alignment and function description
>sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 Back     alignment and function description
>sp|Q1LZC5|ANR54_BOVIN Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 Back     alignment and function description
>sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 Back     alignment and function description
>sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 Back     alignment and function description
>sp|Q69ZR2|HECD1_MOUSE E3 ubiquitin-protein ligase HECTD1 OS=Mus musculus GN=Hectd1 PE=1 SV=2 Back     alignment and function description
>sp|Q6DGX3|ANR54_DANRE Ankyrin repeat domain-containing protein 54 OS=Danio rerio GN=ankrd54 PE=2 SV=1 Back     alignment and function description
>sp|Q9ULT8|HECD1_HUMAN E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens GN=HECTD1 PE=1 SV=3 Back     alignment and function description
>sp|Q9SAR5|AKR2_ARATH Ankyrin repeat domain-containing protein 2 OS=Arabidopsis thaliana GN=AKR2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query389
224105097380 predicted protein [Populus trichocarpa] 0.910 0.931 0.732 1e-147
255542650396 ankyrin repeat domain protein, putative 0.894 0.878 0.722 1e-141
449525253358 PREDICTED: signal recognition particle 4 0.897 0.974 0.673 1e-134
449454372355 PREDICTED: signal recognition particle 4 0.892 0.977 0.674 1e-134
356538524382 PREDICTED: signal recognition particle 4 0.894 0.910 0.681 1e-133
147834020373 hypothetical protein VITISV_027983 [Viti 0.894 0.932 0.699 1e-131
225428245373 PREDICTED: signal recognition particle 4 0.894 0.932 0.696 1e-131
224078446265 predicted protein [Populus trichocarpa] 0.676 0.992 0.777 1e-116
18407359373 signal recognition particle 43 kDa prote 0.894 0.932 0.593 1e-111
297824841366 hypothetical protein ARALYDRAFT_904220 [ 0.871 0.926 0.600 1e-111
>gi|224105097|ref|XP_002313685.1| predicted protein [Populus trichocarpa] gi|222850093|gb|EEE87640.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  529 bits (1362), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 271/370 (73%), Positives = 308/370 (83%), Gaps = 16/370 (4%)

Query: 3   DSLLLNQSLARLKLLPKIPPPASQF-----LHIKPPQPHGK--LHSTASFAIQNQQQTQ- 54
           DSL +NQ+L+RLKL PK+  P S F     LH+K  Q HG+   +S   FAIQ+QQ+TQ 
Sbjct: 2   DSLFVNQALSRLKLSPKLTIP-SYFSYQSPLHLK--QNHGRKPYNSFTLFAIQDQQETQN 58

Query: 55  -YGTTDQN--DDESYGEVSKIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAE 111
               T QN  DDESYGEVSKIIGSRA+E   GMEY IEWKDGH PSWVP D+IAKDVVAE
Sbjct: 59  PLQETTQNIEDDESYGEVSKIIGSRAVEGGKGMEYFIEWKDGHTPSWVPSDFIAKDVVAE 118

Query: 112 YESPWWTAAKKADDAALKEIIEAGDG--RDVDAVDNDGRTALLFVSGLGSEACVRVLAEA 169
           YE+PWWTAAKKAD +AL +I+   +   RDV+AVD+DGRTALLFVSGLGSE CV++LAEA
Sbjct: 119 YETPWWTAAKKADSSALSQILSENEDERRDVNAVDSDGRTALLFVSGLGSEPCVKLLAEA 178

Query: 170 GTDLNHRDSGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTP 229
           G +L+HRD+ GGLTALHMAAGYVKPGV KLL++LGAD +V+DDRGLTPL LAKEILRVTP
Sbjct: 179 GAELDHRDNSGGLTALHMAAGYVKPGVVKLLVDLGADPEVKDDRGLTPLDLAKEILRVTP 238

Query: 230 KGNPMQFARRLGLEAVIRNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKV 289
           KGNPMQF RRLGLE+VIRNLEE +FEYAEVQEILEKRGKG  LEYLVKW+DG DNEWVK 
Sbjct: 239 KGNPMQFGRRLGLESVIRNLEEGIFEYAEVQEILEKRGKGKDLEYLVKWKDGSDNEWVKA 298

Query: 290 GFIAEDLVTDYEAGLEYAVAEGVLGKRMGDDGKREFLVKWTDIDEATWEPEENVDPDLIK 349
            FI EDLV D+EAGLEYAVA+GV+GKR+GDDGK E+LVKWTDIDEATWEPEENVD DLIK
Sbjct: 299 KFIGEDLVMDFEAGLEYAVAKGVVGKRLGDDGKNEYLVKWTDIDEATWEPEENVDLDLIK 358

Query: 350 EFEDSQSDGA 359
           EFE+ Q +G 
Sbjct: 359 EFEEGQINGV 368

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255542650|ref|XP_002512388.1| ankyrin repeat domain protein, putative [Ricinus communis] gi|223548349|gb|EEF49840.1| ankyrin repeat domain protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449525253|ref|XP_004169632.1| PREDICTED: signal recognition particle 43 kDa protein, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449454372|ref|XP_004144929.1| PREDICTED: signal recognition particle 43 kDa protein, chloroplastic-like [Cucumis sativus] gi|449472373|ref|XP_004153574.1| PREDICTED: signal recognition particle 43 kDa protein, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356538524|ref|XP_003537753.1| PREDICTED: signal recognition particle 43 kDa protein, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|147834020|emb|CAN73168.1| hypothetical protein VITISV_027983 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225428245|ref|XP_002282206.1| PREDICTED: signal recognition particle 43 kDa protein, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224078446|ref|XP_002305542.1| predicted protein [Populus trichocarpa] gi|222848506|gb|EEE86053.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18407359|ref|NP_566101.1| signal recognition particle 43 kDa protein [Arabidopsis thaliana] gi|75219098|sp|O22265.2|SR43C_ARATH RecName: Full=Signal recognition particle 43 kDa protein, chloroplastic; AltName: Full=Chromo protein SRP43; Short=CpSRP43; Flags: Precursor gi|15215825|gb|AAK91457.1| At2g47450/T30B22.25 [Arabidopsis thaliana] gi|15982850|gb|AAL09772.1| At2g47450/T30B22.25 [Arabidopsis thaliana] gi|20196959|gb|AAC62865.2| expressed protein [Arabidopsis thaliana] gi|22137050|gb|AAM91370.1| At2g47450/T30B22.25 [Arabidopsis thaliana] gi|330255748|gb|AEC10842.1| signal recognition particle 43 kDa protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297824841|ref|XP_002880303.1| hypothetical protein ARALYDRAFT_904220 [Arabidopsis lyrata subsp. lyrata] gi|297326142|gb|EFH56562.1| hypothetical protein ARALYDRAFT_904220 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query389
TAIR|locus:2062046373 CAO "CHAOS" [Arabidopsis thali 0.894 0.932 0.582 1.9e-106
UNIPROTKB|F1NBL4245 LOC100858286 "Uncharacterized 0.311 0.493 0.4 1.2e-10
UNIPROTKB|Q6NXT1300 ANKRD54 "Ankyrin repeat domain 0.349 0.453 0.371 1.7e-10
UNIPROTKB|Q1LZC5299 ANKRD54 "Ankyrin repeat domain 0.349 0.454 0.364 2.8e-10
UNIPROTKB|F1SKL6299 ANKRD54 "Uncharacterized prote 0.349 0.454 0.371 2.8e-10
MGI|MGI:2444209299 Ankrd54 "ankyrin repeat domain 0.349 0.454 0.364 3.8e-10
RGD|1309552299 Ankrd54 "ankyrin repeat domain 0.349 0.454 0.364 3.8e-10
UNIPROTKB|Q566C8299 Ankrd54 "Ankyrin repeat domain 0.349 0.454 0.364 3.8e-10
ZFIN|ZDB-GENE-040718-318315 ankrd54 "ankyrin repeat domain 0.344 0.425 0.364 1.1e-08
ASPGD|ASPL0000056619321 AN0214 [Emericella nidulans (t 0.236 0.286 0.432 7.6e-08
TAIR|locus:2062046 CAO "CHAOS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1053 (375.7 bits), Expect = 1.9e-106, P = 1.9e-106
 Identities = 211/362 (58%), Positives = 262/362 (72%)

Query:     4 SLLLNQSLARLKLLPKIPPPASQFLHIKPPQPHGKLH----STASFAIQ-NQQQTQYGTT 58
             +L+++QSL+R+KL P     +S         P  ++          A+Q N ++T     
Sbjct:    12 ALVIHQSLSRIKLSPPKSSSSSSSAFSPESLPIRRIELCFRGAICAAVQRNYEETTSSVE 71

Query:    59 D-QNDDES---YGEVSKIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYES 114
             + + DDES   YGEV+KIIGSR   +   MEYLIEWKDGH+PSWVP  YIA DVV+EYE+
Sbjct:    72 EAEEDDESSSSYGEVNKIIGSRTAGEGA-MEYLIEWKDGHSPSWVPSSYIAADVVSEYET 130

Query:   115 PWWTXXXXXXXXXLKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLN 174
             PWWT         L +++E    RDVDAVD +GRTALLFV+GLGS+ CVR+LAEAG DL+
Sbjct:   131 PWWTAARKADEQALSQLLE---DRDVDAVDENGRTALLFVAGLGSDKCVRLLAEAGADLD 187

Query:   175 HRDSGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTPKGNPM 234
             HRD  GGLTALHMAAGYV+P V + L+ELGAD +VED+RGLT L LA+EIL+ TPKGNPM
Sbjct:   188 HRDMRGGLTALHMAAGYVRPEVVEALVELGADIEVEDERGLTALELAREILKTTPKGNPM 247

Query:   235 QFARRLGLEAVIRNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAE 294
             QF RR+GLE VI  LE  VFEYAEV EI+EKRGKG  +EYLV+W+DGGD EWVK   +AE
Sbjct:   248 QFGRRIGLEKVINVLEGQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAE 307

Query:   295 DLVTDYEAGLEYAVAEGVLGKRMGDDGKR-EFLVKWTDIDEATWEPEENVDPDLIKEFED 353
             D+  DYE GLEYAVAE V+GKR+GDDGK  E+LVKWTD+ +ATWEP++NVD  L+  ++ 
Sbjct:   308 DVAKDYEDGLEYAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQ 367

Query:   354 SQ 355
              Q
Sbjct:   368 QQ 369
GO:0005634 "nucleus" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0042802 "identical protein binding" evidence=IPI
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009644 "response to high light intensity" evidence=IEP;RCA
GO:0080085 "signal recognition particle, chloroplast targeting" evidence=IMP
GO:0009637 "response to blue light" evidence=RCA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0010114 "response to red light" evidence=RCA
GO:0010155 "regulation of proton transport" evidence=RCA
GO:0010218 "response to far red light" evidence=RCA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
GO:0046777 "protein autophosphorylation" evidence=RCA
GO:0045038 "protein import into chloroplast thylakoid membrane" evidence=TAS
UNIPROTKB|F1NBL4 LOC100858286 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NXT1 ANKRD54 "Ankyrin repeat domain-containing protein 54" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q1LZC5 ANKRD54 "Ankyrin repeat domain-containing protein 54" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKL6 ANKRD54 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2444209 Ankrd54 "ankyrin repeat domain 54" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309552 Ankrd54 "ankyrin repeat domain 54" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q566C8 Ankrd54 "Ankyrin repeat domain-containing protein 54" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-318 ankrd54 "ankyrin repeat domain 54" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ASPGD|ASPL0000056619 AN0214 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LSQ2SR43C_ORYSJNo assigned EC number0.49730.90230.9046yesno
O22265SR43C_ARATHNo assigned EC number0.59390.89460.9329yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query389
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-19
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-13
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-12
pfam0038552 pfam00385, Chromo, Chromo (CHRromatin Organisation 8e-11
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-09
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-09
smart0029855 smart00298, CHROMO, Chromatin organization modifie 1e-09
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 5e-09
cd0002455 cd00024, CHROMO, Chromatin organization modifier ( 1e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 7e-08
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-07
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-07
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-06
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 8e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 8e-05
smart0029855 smart00298, CHROMO, Chromatin organization modifie 4e-04
cd0002455 cd00024, CHROMO, Chromatin organization modifier ( 6e-04
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 6e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 9e-04
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 9e-04
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.001
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.001
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 0.002
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.002
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.003
cd0002455 cd00024, CHROMO, Chromatin organization modifier ( 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 83.6 bits (207), Expect = 1e-19
 Identities = 45/103 (43%), Positives = 56/103 (54%), Gaps = 3/103 (2%)

Query: 119 AAKKADDAALKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLNHRDS 178
           AA       +K ++E G   DV+A DNDGRT L   +  G    V++L E G D+N RD 
Sbjct: 14  AASNGHLEVVKLLLENGA--DVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVNARDK 71

Query: 179 GGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALA 221
            G  T LH+AA      V KLLL+ GAD +  D  G TPL LA
Sbjct: 72  DG-NTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLA 113

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|215889 pfam00385, Chromo, Chromo (CHRromatin Organisation MOdifier) domain Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|214605 smart00298, CHROMO, Chromatin organization modifier domain Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|237991 cd00024, CHROMO, Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|214605 smart00298, CHROMO, Chromatin organization modifier domain Back     alignment and domain information
>gnl|CDD|237991 cd00024, CHROMO, Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|237991 cd00024, CHROMO, Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 389
PHA02791284 ankyrin-like protein; Provisional 99.97
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.97
PHA02791284 ankyrin-like protein; Provisional 99.97
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.97
PHA02946446 ankyin-like protein; Provisional 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02875413 ankyrin repeat protein; Provisional 99.96
PHA02874434 ankyrin repeat protein; Provisional 99.96
PHA02946446 ankyin-like protein; Provisional 99.96
PHA03100480 ankyrin repeat protein; Provisional 99.95
PHA02798489 ankyrin-like protein; Provisional 99.95
PHA03095471 ankyrin-like protein; Provisional 99.95
KOG0508 615 consensus Ankyrin repeat protein [General function 99.95
PHA03100480 ankyrin repeat protein; Provisional 99.95
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.95
PHA02874434 ankyrin repeat protein; Provisional 99.95
PHA02878477 ankyrin repeat protein; Provisional 99.94
PHA03095 471 ankyrin-like protein; Provisional 99.94
PHA02989494 ankyrin repeat protein; Provisional 99.94
KOG0510 929 consensus Ankyrin repeat protein [General function 99.94
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.94
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.94
PHA02878477 ankyrin repeat protein; Provisional 99.94
KOG0510 929 consensus Ankyrin repeat protein [General function 99.94
PHA02875413 ankyrin repeat protein; Provisional 99.93
PHA02876 682 ankyrin repeat protein; Provisional 99.93
PHA02876682 ankyrin repeat protein; Provisional 99.93
PHA02859209 ankyrin repeat protein; Provisional 99.92
PHA02989 494 ankyrin repeat protein; Provisional 99.92
PHA02798489 ankyrin-like protein; Provisional 99.91
PHA02795437 ankyrin-like protein; Provisional 99.9
KOG0514452 consensus Ankyrin repeat protein [General function 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.9
PHA02859209 ankyrin repeat protein; Provisional 99.9
PHA02741169 hypothetical protein; Provisional 99.9
PHA02917 661 ankyrin-like protein; Provisional 99.89
KOG0508 615 consensus Ankyrin repeat protein [General function 99.89
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.88
PHA02917 661 ankyrin-like protein; Provisional 99.88
PHA02884300 ankyrin repeat protein; Provisional 99.88
PLN03192823 Voltage-dependent potassium channel; Provisional 99.88
PHA02736154 Viral ankyrin protein; Provisional 99.88
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.87
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.86
PLN03192823 Voltage-dependent potassium channel; Provisional 99.86
PHA02795437 ankyrin-like protein; Provisional 99.86
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.85
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.85
KOG0514452 consensus Ankyrin repeat protein [General function 99.85
PHA02730672 ankyrin-like protein; Provisional 99.85
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.84
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.84
PHA02730672 ankyrin-like protein; Provisional 99.83
PHA02743166 Viral ankyrin protein; Provisional 99.82
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.82
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.82
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.81
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.81
PHA02792631 ankyrin-like protein; Provisional 99.81
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.81
PHA02736154 Viral ankyrin protein; Provisional 99.79
PHA02741169 hypothetical protein; Provisional 99.79
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.78
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.76
PHA02792631 ankyrin-like protein; Provisional 99.75
PHA02884300 ankyrin repeat protein; Provisional 99.74
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.73
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.72
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.71
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.71
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.66
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.66
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.65
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.64
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.6
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.59
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.59
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.59
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.59
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.56
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.55
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.52
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.51
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.49
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.46
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.4
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.39
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.3
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.19
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 99.06
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.99
KOG0522 560 consensus Ankyrin repeat protein [General function 98.88
PF1360630 Ank_3: Ankyrin repeat 98.88
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.86
PF1360630 Ank_3: Ankyrin repeat 98.85
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.82
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.82
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.82
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.8
KOG0522 560 consensus Ankyrin repeat protein [General function 98.78
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.78
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.78
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.71
KOG2748 369 consensus Uncharacterized conserved protein, conta 98.65
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.64
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.62
KOG2384223 consensus Major histocompatibility complex protein 98.53
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.49
KOG0511 516 consensus Ankyrin repeat protein [General function 98.41
KOG0511 516 consensus Ankyrin repeat protein [General function 98.39
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.39
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.35
KOG2384223 consensus Major histocompatibility complex protein 98.27
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.0
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.9
PF0038555 Chromo: Chromo (CHRromatin Organisation MOdifier) 97.69
KOG1911 270 consensus Heterochromatin-associated protein HP1 a 97.4
cd0002455 CHROMO Chromatin organization modifier (chromo) do 97.17
KOG2505591 consensus Ankyrin repeat protein [General function 97.13
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.05
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.97
KOG2505591 consensus Ankyrin repeat protein [General function 96.81
smart0029855 CHROMO Chromatin organization modifier domain. 96.02
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.08
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 94.46
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.09
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 87.6
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 84.11
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information 
Probab=99.97  E-value=9.1e-31  Score=238.12  Aligned_cols=183  Identities=15%  Similarity=0.062  Sum_probs=160.2

Q ss_pred             CChHHHHHHHcCCCCCCccccCcccccccccCCChHHHHHHHcCCHHHHHHHHHhCCCCCccccCCCCCcHHHHHHHcCC
Q 016433           80 DATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYESPWWTAAKKADDAALKEIIEAGDGRDVDAVDNDGRTALLFVSGLGS  159 (389)
Q Consensus        80 ~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~d~~g~t~Lh~A~~~g~  159 (389)
                      ..+++++|++.+.             ...+.+|.||||+|+..|+.++++.|++.|  ++++..+  |.||||+|+..|+
T Consensus        11 ~~~~~~~Lis~~a-------------~~~D~~G~TpLh~Aa~~g~~eiv~~Ll~~g--a~~n~~d--~~TpLh~Aa~~g~   73 (284)
T PHA02791         11 SKQLKSFLSSKDA-------------FKADVHGHSALYYAIADNNVRLVCTLLNAG--ALKNLLE--NEFPLHQAATLED   73 (284)
T ss_pred             HHHHHHHHHhCCC-------------CCCCCCCCcHHHHHHHcCCHHHHHHHHHCc--CCCcCCC--CCCHHHHHHHCCC
Confidence            4667788887542             124678999999999999999999999999  8888764  7899999999999


Q ss_pred             HHHHHHHHhcCCCcccccCCCCccHHHHHHhcCCHHHHHHHHHcCCCCCCCCCCCC-cHHHHHHH---------Hhcc--
Q 016433          160 EACVRVLAEAGTDLNHRDSGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGL-TPLALAKE---------ILRV--  227 (389)
Q Consensus       160 ~~~v~~Ll~~ga~~~~~d~~~g~tpLh~A~~~g~~~~v~~Ll~~ga~~~~~d~~g~-tpL~~A~~---------~~~~--  227 (389)
                      .++|++|++.|++++.+|.. |+||||+|+..|+.+++++|+++|++++.++..|+ ||||+|+.         ++..  
T Consensus        74 ~eiV~lLL~~Gadvn~~d~~-G~TpLh~Aa~~g~~eivk~Ll~~gadin~~~~~g~~TpL~~Aa~~g~~eivk~LL~~~~  152 (284)
T PHA02791         74 TKIVKILLFSGMDDSQFDDK-GNTALYYAVDSGNMQTVKLFVKKNWRLMFYGKTGWKTSFYHAVMLNDVSIVSYFLSEIP  152 (284)
T ss_pred             HHHHHHHHHCCCCCCCCCCC-CCCHHHHHHHcCCHHHHHHHHHCCCCcCccCCCCCcHHHHHHHHcCCHHHHHHHHhcCC
Confidence            99999999999999999999 99999999999999999999999999999999885 89999985         2221  


Q ss_pred             -----CCCCCHHHHHHHhCcHHHHHHHHHcccCh-------H-HHHHHHHHcCChhHHHHHHhccC
Q 016433          228 -----TPKGNPMQFARRLGLEAVIRNLEEAVFEY-------A-EVQEILEKRGKGDQLEYLVKWRD  280 (389)
Q Consensus       228 -----~~g~t~l~~A~~~g~~~~v~~Ll~~g~~~-------~-~~~~~a~~~g~~~~~~~L~~~~~  280 (389)
                           ..|.||||+|+..|+.++|++|+++|++.       . .+.+.|+..|+.+++++|+++..
T Consensus       153 ~~~d~~~g~TpLh~Aa~~g~~eiv~lLL~~gAd~n~~d~~g~t~~L~~Aa~~~~~e~v~lLl~~Ga  218 (284)
T PHA02791        153 STFDLAILLSCIHITIKNGHVDMMILLLDYMTSTNTNNSLLFIPDIKLAIDNKDLEMLQALFKYDI  218 (284)
T ss_pred             cccccccCccHHHHHHHcCCHHHHHHHHHCCCCCCcccCCCCChHHHHHHHcCCHHHHHHHHHCCC
Confidence                 23689999999999999999999999862       2 34899999999999999997643

>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2748 consensus Uncharacterized conserved protein, contains chromo domain [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF00385 Chromo: Chromo (CHRromatin Organisation MOdifier) domain; InterPro: IPR023780 The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation Back     alignment and domain information
>KOG1911 consensus Heterochromatin-associated protein HP1 and related CHROMO domain proteins [Chromatin structure and dynamics] Back     alignment and domain information
>cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00298 CHROMO Chromatin organization modifier domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query389
3ui2_A244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 6e-92
3deo_A183 Structural Basis For Specific Substrate Recognition 1e-66
3deo_A183 Structural Basis For Specific Substrate Recognition 4e-04
1x3q_A57 3d Solution Structure Of The Chromo-2 Domain Of Cps 2e-14
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 5e-12
1x32_A47 Three Dimensional Solution Structure Of The Chromo1 1e-11
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-11
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-11
1x3p_A54 3d Solution Structure Of The Chromo-3 Domain Of Cps 5e-11
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-10
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-10
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-08
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 4e-08
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-08
2xeh_A157 Structural Determinants For Improved Thermal Stabil 8e-08
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-07
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-07
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-07
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-07
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-07
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-07
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-07
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 6e-07
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-06
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 5e-04
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 3e-06
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 3e-06
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 5e-06
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 5e-06
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-04
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 7e-06
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 8e-06
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 8e-06
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 9e-06
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 1e-05
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 1e-05
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 1e-05
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-05
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 3e-05
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 4e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 4e-05
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 6e-05
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 6e-05
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 7e-05
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-04
3f2u_A55 Crystal Structure Of Human Chromobox Homolog 1 (Cbx 2e-04
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-04
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-04
3dm1_A58 Crystal Structure Of The Complex Of Human Chromobox 2e-04
3tzd_A58 Crystal Structure Of The Complex Of Human Chromobox 4e-04
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-04
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 5e-04
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 5e-04
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 5e-04
2l11_A54 Solution Nmr Structure Of The Cbx3 In Complex With 5e-04
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 6e-04
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 7e-04
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 7e-04
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure 
Iteration: 1

 Score =  334 bits (856), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 168/248 (67%), Positives = 196/248 (79%), Gaps = 4/248 (1%)
Query: 67  GEVSKIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYESPWWTXXXXXXXX 126
           GEV+KIIGSR   +   MEYLIEWKDGH+PSWVP  YIA DVV+EYE+PWWT        
Sbjct: 1   GEVNKIIGSRTAGEGA-MEYLIEWKDGHSPSWVPSSYIAADVVSEYETPWWTAARKADEQ 59
Query: 127 XLKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLNHRDSGGGLTALH 186
            L +++E    RDVDAVD +GRTALLFV+GLGS+ CVR+LAEAG DL+HRD  GGLTALH
Sbjct: 60  ALSQLLE---DRDVDAVDENGRTALLFVAGLGSDKCVRLLAEAGADLDHRDMRGGLTALH 116
Query: 187 MAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTPKGNPMQFARRLGLEAVI 246
           MAAGYV+P V + L+ELGAD +VED+RGLT L LA+EIL+ TPKGNPMQF RR+GLE VI
Sbjct: 117 MAAGYVRPEVVEALVELGADIEVEDERGLTALELAREILKTTPKGNPMQFGRRIGLEKVI 176
Query: 247 RNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAEDLVTDYEAGLEY 306
             LE  VFEYAEV EI+EKRGKG  +EYLV+W+DGGD EWVK   +AED+  DYE GLEY
Sbjct: 177 NVLEGQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEY 236
Query: 307 AVAEGVLG 314
           AVAE V+G
Sbjct: 237 AVAESVIG 244
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure
>pdb|1X3Q|A Chain A, 3d Solution Structure Of The Chromo-2 Domain Of Cpsrp43 Length = 57 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|1X32|A Chain A, Three Dimensional Solution Structure Of The Chromo1 Domain Of Cpsrp43 Length = 47 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1X3P|A Chain A, 3d Solution Structure Of The Chromo-3 Domain Of Cpsrp43 Length = 54 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|3F2U|A Chain A, Crystal Structure Of Human Chromobox Homolog 1 (Cbx1) Length = 55 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|3DM1|A Chain A, Crystal Structure Of The Complex Of Human Chromobox Homolog 3 (cbx3) With Peptide Length = 58 Back     alignment and structure
>pdb|3TZD|A Chain A, Crystal Structure Of The Complex Of Human Chromobox Homolog 3 (cbx3) Length = 58 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|2L11|A Chain A, Solution Nmr Structure Of The Cbx3 In Complex With H3k9me3 Peptide Length = 54 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query389
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-70
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-47
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-15
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-18
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-12
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-06
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-05
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-14
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-18
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-15
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-07
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-13
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-18
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-16
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-09
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-04
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-18
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-14
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-17
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-17
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-15
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-15
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-17
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-14
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-12
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-17
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-14
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-12
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-17
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-16
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-09
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-17
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-17
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-16
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-17
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-13
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-08
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-17
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-16
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-17
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-15
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-15
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-12
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-08
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-10
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-14
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-16
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-15
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-09
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-07
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-11
1x3p_A54 Cpsrp43; chromo-2 domain, chloroplasts, LHCP, prot 5e-16
1x3p_A54 Cpsrp43; chromo-2 domain, chloroplasts, LHCP, prot 2e-08
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-14
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-15
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-14
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-13
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-15
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-15
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-15
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-14
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-14
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-08
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-12
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-13
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-13
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-14
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-09
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-14
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-14
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-13
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-11
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-13
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-12
1pdq_A72 Polycomb protein; methyllysine, chromodomain, poly 2e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-08
2pnn_A273 Transient receptor potential cation channel subfa 5e-13
2pnn_A273 Transient receptor potential cation channel subfa 8e-11
2pnn_A273 Transient receptor potential cation channel subfa 3e-09
2pnn_A273 Transient receptor potential cation channel subfa 4e-04
2etb_A256 Transient receptor potential cation channel subfam 8e-13
2etb_A256 Transient receptor potential cation channel subfam 1e-10
2etb_A256 Transient receptor potential cation channel subfam 2e-08
2etb_A256 Transient receptor potential cation channel subfam 7e-08
3g7l_A61 Chromo domain-containing protein 1; chromodomain, 8e-13
3f2u_A55 Chromobox protein homolog 1; human chromobox homol 9e-13
2dnv_A64 Chromobox protein homolog 8; chromo domain, histon 1e-12
3h91_A54 Chromobox protein homolog 2; human chromobox homol 2e-12
3fdt_A59 Chromobox protein homolog 5; chromobox homolog5, C 3e-12
2k1b_A73 Chromobox protein homolog 7; alpha/beta protein, c 3e-12
2rfa_A232 Transient receptor potential cation channel subfa 5e-12
2rfa_A232 Transient receptor potential cation channel subfa 2e-10
2rfa_A232 Transient receptor potential cation channel subfa 4e-09
1pfb_A55 Polycomb protein; chromatin, histone methylation, 6e-12
2dnt_A78 Chromodomain protein, Y chromosome-like, isoform B 7e-12
1q3l_A69 Heterochromatin protein 1; chromodomain, HP1, chro 7e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-11
3i91_A54 Chromobox protein homolog 8; chromobox homolog 8, 1e-11
1ap0_A73 Modifier protein 1; chromatin-binding, protein int 1e-11
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-11
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-11
3lwe_A62 M-phase phosphoprotein 8; MPP8, structural genomic 5e-11
1g6z_A70 CLR4 protein; transferase; NMR {Schizosaccharomyce 2e-10
2kvm_A74 Chromobox protein homolog 7; histone modification, 2e-10
2d9u_A74 Chromobox protein homolog 2 (isoform 2); chromobox 2e-10
3mts_A64 Histone-lysine N-methyltransferase SUV39H1; histon 6e-10
3mts_A64 Histone-lysine N-methyltransferase SUV39H1; histon 7e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-08
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-09
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-05
2epb_A68 Chromodomain-helicase-DNA-binding protein 6; struc 1e-08
2h1e_A177 Chromo domain protein 1; CHD1, tandem chromodomain 2e-07
2ee1_A64 Chromodomain helicase-DNA-binding protein 4; EC 3. 9e-07
2b2y_A187 CHD-1, chromodomain-helicase-DNA-binding protein 1 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
 Score =  219 bits (560), Expect = 5e-70
 Identities = 174/248 (70%), Positives = 204/248 (82%), Gaps = 4/248 (1%)

Query: 67  GEVSKIIGSRALEDATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYESPWWTAAKKADDA 126
           GEV+KIIGSR   +   MEYLIEWKDGH+PSWVP  YIA DVV+EYE+PWWTAA+KAD+ 
Sbjct: 1   GEVNKIIGSRTAGE-GAMEYLIEWKDGHSPSWVPSSYIAADVVSEYETPWWTAARKADEQ 59

Query: 127 ALKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLNHRDSGGGLTALH 186
           AL +++E    RDVDAVD +GRTALLFV+GLGS+ CVR+LAEAG DL+HRD  GGLTALH
Sbjct: 60  ALSQLLE---DRDVDAVDENGRTALLFVAGLGSDKCVRLLAEAGADLDHRDMRGGLTALH 116

Query: 187 MAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTPKGNPMQFARRLGLEAVI 246
           MAAGYV+P V + L+ELGAD +VED+RGLT L LA+EIL+ TPKGNPMQF RR+GLE VI
Sbjct: 117 MAAGYVRPEVVEALVELGADIEVEDERGLTALELAREILKTTPKGNPMQFGRRIGLEKVI 176

Query: 247 RNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAEDLVTDYEAGLEY 306
             LE  VFEYAEV EI+EKRGKG  +EYLV+W+DGGD EWVK   +AED+  DYE GLEY
Sbjct: 177 NVLEGQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEY 236

Query: 307 AVAEGVLG 314
           AVAE V+G
Sbjct: 237 AVAESVIG 244
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1x3p_A Cpsrp43; chromo-2 domain, chloroplasts, LHCP, protein translocation, unknown function; NMR {Arabidopsis thaliana} SCOP: b.34.13.2 Length = 54 Back     alignment and structure
>1x3p_A Cpsrp43; chromo-2 domain, chloroplasts, LHCP, protein translocation, unknown function; NMR {Arabidopsis thaliana} SCOP: b.34.13.2 Length = 54 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 Length = 72 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3g7l_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, silencing, cell cycle, chromosome partition, DNA-binding, nucleus; HET: M3L; 2.20A {Schizosaccharomyces pombe} Length = 61 Back     alignment and structure
>3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* Length = 55 Back     alignment and structure
>2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 Length = 64 Back     alignment and structure
>3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} PDB: 2k28_A 3i8z_A Length = 54 Back     alignment and structure
>3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} Length = 59 Back     alignment and structure
>2k1b_A Chromobox protein homolog 7; alpha/beta protein, chromatin regulator, nucleus, repressor, transcription, transcription regulation; NMR {Homo sapiens} PDB: 2l12_A* 2l1b_A* Length = 73 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 Length = 55 Back     alignment and structure
>2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 Length = 78 Back     alignment and structure
>1q3l_A Heterochromatin protein 1; chromodomain, HP1, chromatin, methyllysine, monomethyllysine, structural protein; HET: MLZ; 1.64A {Drosophila melanogaster} SCOP: b.34.13.2 PDB: 1kne_A* 1kna_A* Length = 69 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} PDB: 3gv6_A* 3i90_A* Length = 54 Back     alignment and structure
>1ap0_A Modifier protein 1; chromatin-binding, protein interaction motif, alpha+beta; NMR {Mus musculus} SCOP: b.34.13.2 PDB: 1guw_A* Length = 73 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} PDB: 3r93_A* 3svm_A* 3qo2_A* Length = 62 Back     alignment and structure
>1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 Length = 70 Back     alignment and structure
>2kvm_A Chromobox protein homolog 7; histone modification, lysine methylation, chromobox, polycom chromatin-binding; HET: MLY; NMR {Mus musculus} Length = 74 Back     alignment and structure
>2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} Length = 64 Back     alignment and structure
>3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} Length = 64 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2h1e_A Chromo domain protein 1; CHD1, tandem chromodomains, three-stranded ANT B-sheet, hydrolase; 2.20A {Saccharomyces cerevisiae} PDB: 2dy7_A 2dy8_A Length = 177 Back     alignment and structure
>2ee1_A Chromodomain helicase-DNA-binding protein 4; EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, MI-2 autoantigen 218 kDa protein, MI2-beta; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2b2y_A CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 b.34.13.2 PDB: 2b2u_A* 2b2v_A* 2b2w_A 2b2t_A* Length = 187 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query389
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.97
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.97
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.97
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.97
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.97
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.97
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.97
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.97
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.97
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.97
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.97
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.97
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.97
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.97
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.97
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.97
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.97
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.97
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.97
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.97
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.97
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.97
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.97
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.97
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.97
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.97
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.96
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.96
3hra_A201 Ankyrin repeat family protein; structural protein; 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.96
3hra_A201 Ankyrin repeat family protein; structural protein; 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.96
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.96
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.96
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.95
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.95
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.92
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.92
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.91
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.9
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.9
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.9
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.9
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.89
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.87
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.87
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.87
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.86
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.86
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.83
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.83
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.82
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.82
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.82
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.81
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.8
1x3p_A54 Cpsrp43; chromo-2 domain, chloroplasts, LHCP, prot 98.78
3f2u_A55 Chromobox protein homolog 1; human chromobox homol 98.52
2k1b_A73 Chromobox protein homolog 7; alpha/beta protein, c 98.5
2dnv_A64 Chromobox protein homolog 8; chromo domain, histon 98.5
3fdt_A59 Chromobox protein homolog 5; chromobox homolog5, C 98.47
2rsn_A75 Chromo domain-containing protein 1; chromodomain, 98.46
1q3l_A69 Heterochromatin protein 1; chromodomain, HP1, chro 98.43
3mts_A64 Histone-lysine N-methyltransferase SUV39H1; histon 98.41
3i91_A54 Chromobox protein homolog 8; chromobox homolog 8, 98.38
1pdq_A72 Polycomb protein; methyllysine, chromodomain, poly 98.38
1g6z_A70 CLR4 protein; transferase; NMR {Schizosaccharomyce 98.37
1pfb_A55 Polycomb protein; chromatin, histone methylation, 98.35
2rso_A92 Chromatin-associated protein SWI6; chromodomain, s 98.33
3h91_A54 Chromobox protein homolog 2; human chromobox homol 98.31
2dnt_A78 Chromodomain protein, Y chromosome-like, isoform B 98.28
2d9u_A74 Chromobox protein homolog 2 (isoform 2); chromobox 98.28
1ap0_A73 Modifier protein 1; chromatin-binding, protein int 98.22
3g7l_A61 Chromo domain-containing protein 1; chromodomain, 98.22
3lwe_A62 M-phase phosphoprotein 8; MPP8, structural genomic 98.21
2kvm_A74 Chromobox protein homolog 7; histone modification, 98.2
4hae_A81 CDY-like 2, chromodomain Y-like protein 2; protein 98.18
2epb_A68 Chromodomain-helicase-DNA-binding protein 6; struc 98.14
2ee1_A64 Chromodomain helicase-DNA-binding protein 4; EC 3. 97.75
2b2y_C115 CHD-1, chromodomain-helicase-DNA-binding protein 1 97.48
2h1e_A177 Chromo domain protein 1; CHD1, tandem chromodomain 95.91
2b2y_A187 CHD-1, chromodomain-helicase-DNA-binding protein 1 95.87
2b2y_A187 CHD-1, chromodomain-helicase-DNA-binding protein 1 94.55
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 91.93
3kup_A65 Chromobox protein homolog 3; chromo shadow domain, 90.56
2h1e_A177 Chromo domain protein 1; CHD1, tandem chromodomain 90.12
2fmm_A74 Chromobox protein homolog 1; ENT domain, chromo sh 89.02
3i3c_A75 Chromobox protein homolog 5; CBX5, chromo shadow d 86.22
3q6s_A78 Chromobox protein homolog 1; incenp, heterochromat 84.11
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
Probab=100.00  E-value=3.6e-38  Score=283.21  Aligned_cols=229  Identities=72%  Similarity=1.220  Sum_probs=202.4

Q ss_pred             ChHHHHHHHcCCCCCCccccCcccccccccCCChHHHHHHHcCCHHHHHHHHHhCCCCCccccCCCCCcHHHHHHHcCCH
Q 016433           81 ATGMEYLIEWKDGHAPSWVPQDYIAKDVVAEYESPWWTAAKKADDAALKEIIEAGDGRDVDAVDNDGRTALLFVSGLGSE  160 (389)
Q Consensus        81 ~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~d~~g~t~Lh~A~~~g~~  160 (389)
                      ...+.+++.+.++..+.|........+++.+|.||||+||..|+.++++.|++ |  +++|.+|..|+||||+||..|+.
T Consensus        14 ~~~~~~l~~~~~g~~~~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~-~--~~~~~~d~~g~t~L~~A~~~g~~   90 (244)
T 3ui2_A           14 EGAMEYLIEWKDGHSPSWVPSSYIAADVVSEYETPWWTAARKADEQALSQLLE-D--RDVDAVDENGRTALLFVAGLGSD   90 (244)
T ss_dssp             TTEEEEEEEESSCCCCEEEEGGGSCHHHHHHHHHHHHHHHTTTCHHHHHHTTT-T--CCTTCBCTTSCBHHHHHHHHTCH
T ss_pred             CCccHHHHHHHcCCCcccccccccccccccCCCCHHHHHHHcCCHHHHHHHHc-C--CCCCCcCCCCCCHHHHHHHCCCH
Confidence            45566677777888888877777778888899999999999999999999999 7  99999999999999999999999


Q ss_pred             HHHHHHHhcCCCccccc-CCCCccHHHHHHhcCCHHHHHHHHHcCCCCCCCCCCCCcHHHHHHHHhccCCCCCHHHHHHH
Q 016433          161 ACVRVLAEAGTDLNHRD-SGGGLTALHMAAGYVKPGVAKLLLELGADADVEDDRGLTPLALAKEILRVTPKGNPMQFARR  239 (389)
Q Consensus       161 ~~v~~Ll~~ga~~~~~d-~~~g~tpLh~A~~~g~~~~v~~Ll~~ga~~~~~d~~g~tpL~~A~~~~~~~~g~t~l~~A~~  239 (389)
                      ++|++|+++|+++|.++ .. |+||||+|+..|+.+++++|+++|++++.+|..|+||||+|+.+.....+.|||++|+.
T Consensus        91 ~~v~~Ll~~ga~~~~~~~~~-g~t~L~~A~~~g~~~~v~~Ll~~ga~~~~~d~~g~t~l~~A~~~~~~~~~~~~l~~a~~  169 (244)
T 3ui2_A           91 KCVRLLAEAGADLDHRDMRG-GLTALHMAAGYVRPEVVEALVELGADIEVEDERGLTALELAREILKTTPKGNPMQFGRR  169 (244)
T ss_dssp             HHHHHHHHTTCCTTCCCSSS-CCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHHHHTTCCCSSHHHHHHH
T ss_pred             HHHHHHHHcCCCCCcCCCCC-CCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHHHhccCCCCHHHHHHH
Confidence            99999999999999999 66 99999999999999999999999999999999999999999999999999999999999


Q ss_pred             hCcHHHHHHHHHcccChHHHHHHHHHcCChhHHHHHHhccCCCCCcchhcccccchhhhhhhhhhHHHHHHhhh
Q 016433          240 LGLEAVIRNLEEAVFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAEDLVTDYEAGLEYAVAEGVL  313 (389)
Q Consensus       240 ~g~~~~v~~Ll~~g~~~~~~~~~a~~~g~~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~v~e~il  313 (389)
                      .|+.+++++|++.+.+......+....+.....+||.+|.+.....|.+...+.++++.+++.+.+++..+.++
T Consensus       170 ~g~~~iv~~L~~~~~~~~~~~~~~~~~~~~~~~e~l~~~~~~~~~~w~~~~~i~~~li~~y~~~~~~~~~~~v~  243 (244)
T 3ui2_A          170 IGLEKVINVLEGQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEYAVAESVI  243 (244)
T ss_dssp             HHHHHHHHHHHHHHEEEEEEEEEEEEESCTTSCEEEEEESSSSCEEEEESTTBCHHHHHHHHHHHC--------
T ss_pred             cChHHHHHHHHHhccccccHHHHHHHhccCcchhhhhhhcCCCCCCcCcchhcCHHHHHHHHHHHHHHHHHHhc
Confidence            99999999999987766555555556677778899999999999999999998899999999999988766665
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1x3p_A Cpsrp43; chromo-2 domain, chloroplasts, LHCP, protein translocation, unknown function; NMR {Arabidopsis thaliana} SCOP: b.34.13.2 Back     alignment and structure
>3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* Back     alignment and structure
>2k1b_A Chromobox protein homolog 7; alpha/beta protein, chromatin regulator, nucleus, repressor, transcription, transcription regulation; NMR {Homo sapiens} PDB: 2l12_A* 2l1b_A* Back     alignment and structure
>2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 Back     alignment and structure
>3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} Back     alignment and structure
>2rsn_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, RNA-mediated gene SIL chromosomal protein, methylation; HET: M3L; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1q3l_A Heterochromatin protein 1; chromodomain, HP1, chromatin, methyllysine, monomethyllysine, structural protein; HET: MLZ; 1.64A {Drosophila melanogaster} SCOP: b.34.13.2 PDB: 1kne_A* 1kna_A* Back     alignment and structure
>3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} Back     alignment and structure
>3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} SCOP: b.34.13.2 PDB: 3gv6_A* 3i90_A* Back     alignment and structure
>1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 Back     alignment and structure
>1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>2rso_A Chromatin-associated protein SWI6; chromodomain, silencing, chromosomal protein, Met transcription; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} SCOP: b.34.13.2 PDB: 2k28_A 3i8z_A Back     alignment and structure
>2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ap0_A Modifier protein 1; chromatin-binding, protein interaction motif, alpha+beta; NMR {Mus musculus} SCOP: b.34.13.2 PDB: 1guw_A* Back     alignment and structure
>3g7l_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, silencing, cell cycle, chromosome partition, DNA-binding, nucleus; HET: M3L; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} SCOP: b.34.13.0 PDB: 3r93_A* 3svm_A* 3qo2_A* Back     alignment and structure
>2kvm_A Chromobox protein homolog 7; histone modification, lysine methylation, chromobox, polycom chromatin-binding; HET: MLY; NMR {Mus musculus} Back     alignment and structure
>4hae_A CDY-like 2, chromodomain Y-like protein 2; protein binding, structural genomics consortiu; 2.00A {Homo sapiens} Back     alignment and structure
>2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee1_A Chromodomain helicase-DNA-binding protein 4; EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, MI-2 autoantigen 218 kDa protein, MI2-beta; NMR {Homo sapiens} Back     alignment and structure
>2b2y_C CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 PDB: 2b2u_C* 2b2v_C* 2b2t_C* 2b2w_C Back     alignment and structure
>2h1e_A Chromo domain protein 1; CHD1, tandem chromodomains, three-stranded ANT B-sheet, hydrolase; 2.20A {Saccharomyces cerevisiae} PDB: 2dy7_A 2dy8_A Back     alignment and structure
>2b2y_A CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 b.34.13.2 PDB: 2b2u_A* 2b2v_A* 2b2w_A 2b2t_A* Back     alignment and structure
>2b2y_A CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 b.34.13.2 PDB: 2b2u_A* 2b2v_A* 2b2w_A 2b2t_A* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3kup_A Chromobox protein homolog 3; chromo shadow domain, structural genomics consortium, SGC, acetylation, chromatin regulator, nucleus, phosphoprotein; 1.77A {Homo sapiens} SCOP: b.34.13.2 PDB: 1dz1_A Back     alignment and structure
>2h1e_A Chromo domain protein 1; CHD1, tandem chromodomains, three-stranded ANT B-sheet, hydrolase; 2.20A {Saccharomyces cerevisiae} PDB: 2dy7_A 2dy8_A Back     alignment and structure
>2fmm_A Chromobox protein homolog 1; ENT domain, chromo shadow domain, EMSY protein, heterochroma protein 1, transcription; 1.80A {Homo sapiens} SCOP: b.34.13.2 PDB: 1s4z_A Back     alignment and structure
>3i3c_A Chromobox protein homolog 5; CBX5, chromo shadow domain, structural genomics, structural consortium, SGC, centromere, nucleus, phosphoprotein; 2.48A {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>3q6s_A Chromobox protein homolog 1; incenp, heterochromatin, centromere, cell cycle; 1.93A {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 389
d2huga155 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidops 5e-22
d2huga155 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidops 7e-17
d2huga155 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidops 7e-08
d3deoa144 b.34.13.2 (A:85-128) CpSRP43 {Thale cress (Arabido 1e-18
d3deoa144 b.34.13.2 (A:85-128) CpSRP43 {Thale cress (Arabido 2e-05
d3deoa144 b.34.13.2 (A:85-128) CpSRP43 {Thale cress (Arabido 4e-05
d1x3pa154 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidops 1e-15
d1x3pa154 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidops 3e-09
d1x3pa154 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidops 7e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-05
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-13
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-12
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-12
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-08
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.002
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-12
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 9e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.003
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-12
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-12
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-09
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-04
d1q3la_52 b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fru 9e-12
d2dnta166 b.34.13.2 (A:8-73) Chromodomain protein, Y-like is 3e-11
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 8e-11
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-04
d1guwa_73 b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mou 1e-10
d2dnva152 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mo 2e-10
d1g6za_70 b.34.13.2 (A:) Histone methyltransferase clr4, chr 3e-10
d1g6za_70 b.34.13.2 (A:) Histone methyltransferase clr4, chr 2e-04
d2dy8a169 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 4e-10
d2b2ya180 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 6e-10
d1pfba_55 b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Dr 2e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.001
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-04
d2dy7a181 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 0.002
d2b2ya295 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 ( 0.002
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.003
>d2huga1 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 55 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Chromo domain-like
family: Chromo domain
domain: CpSRP43
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 86.0 bits (213), Expect = 5e-22
 Identities = 38/54 (70%), Positives = 44/54 (81%)

Query: 253 VFEYAEVQEILEKRGKGDQLEYLVKWRDGGDNEWVKVGFIAEDLVTDYEAGLEY 306
           VFEYAEV EI+EKRGKG  +EYLV+W+DGGD EWVK   +AED+  DYE GLEY
Sbjct: 2   VFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEY 55
>d2huga1 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 55 Back     information, alignment and structure
>d2huga1 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 55 Back     information, alignment and structure
>d3deoa1 b.34.13.2 (A:85-128) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 44 Back     information, alignment and structure
>d3deoa1 b.34.13.2 (A:85-128) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 44 Back     information, alignment and structure
>d3deoa1 b.34.13.2 (A:85-128) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 44 Back     information, alignment and structure
>d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 54 Back     information, alignment and structure
>d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 54 Back     information, alignment and structure
>d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 54 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 52 Back     information, alignment and structure
>d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Length = 73 Back     information, alignment and structure
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 70 Back     information, alignment and structure
>d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 70 Back     information, alignment and structure
>d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 69 Back     information, alignment and structure
>d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 55 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query389
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.97
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.95
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.95
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.94
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.94
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.93
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.91
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.91
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.91
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.91
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.9
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.9
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.9
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.89
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.88
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.87
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.87
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.85
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.85
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.85
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.82
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.82
d1x3pa154 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 98.92
d1pfba_55 Polycomb protein, Pc {Fruit fly (Drosophila melano 98.43
d2dnva152 Chromobox protein homolog 8 {Mouse (Mus musculus) 98.42
d1q3la_52 Heterochromatin protein 1, HP1 {Fruit fly (Drosoph 98.39
d2dnta166 Chromodomain protein, Y-like isoform {Human (Homo 98.37
d1guwa_73 Heterochromatin protein 1, HP1 {Mouse (Mus musculu 98.26
d1g6za_70 Histone methyltransferase clr4, chromo domain {Fis 98.15
d2huga155 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 97.99
d3deoa144 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 97.45
d2dy8a169 ATP-dependent helicase CHD1 (Chromo domain protein 97.37
d2b2ya180 ATP-dependent helicase CHD1 (Chromo domain protein 97.35
d2b2ya295 ATP-dependent helicase CHD1 (Chromo domain protein 94.99
d2huga155 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 94.87
d2dy7a181 ATP-dependent helicase CHD1 (Chromo domain protein 93.97
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.97  E-value=7.8e-31  Score=234.03  Aligned_cols=170  Identities=22%  Similarity=0.195  Sum_probs=149.0

Q ss_pred             cccCCChHHHHHHHcCCHHHHHHHHHhCCCCC---ccccCCCCCcHHHHHHHcCCHHHHHHHHhcCCCcccccCCCCccH
Q 016433          108 VVAEYESPWWTAAKKADDAALKEIIEAGDGRD---VDAVDNDGRTALLFVSGLGSEACVRVLAEAGTDLNHRDSGGGLTA  184 (389)
Q Consensus       108 ~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~---~~~~d~~g~t~Lh~A~~~g~~~~v~~Ll~~ga~~~~~d~~~g~tp  184 (389)
                      ++++|.||||+||..|+.+++++|+++|  ++   ++.+|..|.||||+||..|+.+++++|+++|++++.+|.. |.||
T Consensus         5 i~~~G~t~Lh~A~~~~~~~~v~~Ll~~~--a~~~~i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga~i~~~d~~-g~tp   81 (255)
T d1oy3d_           5 VTEDGDTALHLAVIHQHEPFLDFLLGFS--AGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERG-GHTA   81 (255)
T ss_dssp             CCTTCCCHHHHHHHTTCHHHHHHHHHHH--TTSGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCSSCCCTT-SCCH
T ss_pred             CCcCCCCHHHHHHHcCCHHHHHHHHHcC--CCcccccCcCCCCCCccchHHhhcccccccccccccccccccccc-cchh
Confidence            5689999999999999999999999998  66   7788899999999999999999999999999999999999 9999


Q ss_pred             HHHHHhcCCHHHHHHHHHcC-----------------------------------------------CCCCCCCCCCCcH
Q 016433          185 LHMAAGYVKPGVAKLLLELG-----------------------------------------------ADADVEDDRGLTP  217 (389)
Q Consensus       185 Lh~A~~~g~~~~v~~Ll~~g-----------------------------------------------a~~~~~d~~g~tp  217 (389)
                      ||+|+..++.+++++|++.+                                               .+++.+|.+|.||
T Consensus        82 L~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~Tp  161 (255)
T d1oy3d_          82 LHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTP  161 (255)
T ss_dssp             HHHHTTTTCHHHHHHHSSSCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSCCH
T ss_pred             hhhhhccCchHHHHHHHhhccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccccCccc
Confidence            99999999999999987532                                               2345678889999


Q ss_pred             HHHHHH---------Hh---------ccCCCCCHHHHHHHhCcHHHHHHHHHcccC-------hHHHHHHHHHcCChhHH
Q 016433          218 LALAKE---------IL---------RVTPKGNPMQFARRLGLEAVIRNLEEAVFE-------YAEVQEILEKRGKGDQL  272 (389)
Q Consensus       218 L~~A~~---------~~---------~~~~g~t~l~~A~~~g~~~~v~~Ll~~g~~-------~~~~~~~a~~~g~~~~~  272 (389)
                      ||+|+.         ++         ....|.||||+|++.|+.++|++|+++|++       +.++.++|...|+.+++
T Consensus       162 Lh~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL~~A~~~~~~~~v~~Ll~~gadin~~d~~g~t~L~~A~~~~~~~i~  241 (255)
T d1oy3d_         162 LHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILA  241 (255)
T ss_dssp             HHHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHTSSCHHHH
T ss_pred             ccccccccccccccchhcccccccccccccccccccccccccHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHH
Confidence            999985         11         124678999999999999999999999874       45788999999999999


Q ss_pred             HHHHhccC
Q 016433          273 EYLVKWRD  280 (389)
Q Consensus       273 ~~L~~~~~  280 (389)
                      ++|+++..
T Consensus       242 ~~Ll~~Ga  249 (255)
T d1oy3d_         242 RLLRAHGA  249 (255)
T ss_dssp             HHHHHTTC
T ss_pred             HHHHHcCC
Confidence            99997644
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Back     information, alignment and structure
>d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2huga1 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3deoa1 b.34.13.2 (A:85-128) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2huga1 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure