Citrus Sinensis ID: 016468


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39
MSGKEMLQFGRVDEVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYFPIDEHVDSYGRSKSVAEQLVLKSNGRPFKKNNRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRARK
ccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccEEEEEEEccccccccccccHHHHHHHHHcccccEEEcccccccccccHHHHHHHHHHHHHccccccccccccccccccEEEEEccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccEEccHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHc
ccccccccHHHHEEEcccHHHHHHHHHHHccccEEEEEccccEEccccEEEccccccccccccccccccHHHHHHHHHHHHHHccccccccccccEEEEEEccccccccccccHHHHHHHHHHcccEEEEEcccccccccEEHHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccEEEcHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
msgkemlqfgrvdevningTCHVIEACLEFGIQRLVYVSTYNVvfggkeivngneslpyfpidehvdsygrsKSVAEQLVLksngrpfkknnrkclytcavrpaaiygpgeerhlpRIVSLAklglvpfkigepsvktdwiYVDNLVLALILASMgllddipgqkgrpiasgqpyfvsdgfpintfefIGPLlktldydlpkswlavphalFLGKVFSFFYSVLYpwlnrwwlpqplilpaevyKVGVTHYFSLLKakdelcyvpivspregmAATISYWQDrkrksldgptIYAWLFCLIGlpalfataylpdigpvpiLRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLakkvdpanakgWFWQTLALGVFSLRLLLKRARK
msgkemlqfgrvdevniNGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYFPIDEHVDSYGRSKSVAEQLvlksngrpfkknnrkclytCAVRPAAIygpgeerhLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRARK
MSGKEMLQFGRVDEVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYFPIDEHVDSYGRSKSVAEQLVLKSNGRPFKKNNRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRARK
*******QFGRVDEVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYFPIDEHVDSYGR***VAEQLVLKSNGRPFKKNNRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLL*****
******LQFGRVDEVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYFPIDEHVDSYGRSKSVAEQLVLKSNGRPFKKNNRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISY****************WLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRA**
MSGKEMLQFGRVDEVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYFPIDEHVDSYGRSKSVAEQLVLKSNGRPFKKNNRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRARK
*****MLQFGRVDEVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYFPIDEHVDSYGRSKSVAEQLVLKSNGRPFKKNNRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRAR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGKEMLQFGRVDEVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYFPIDEHVDSYGRSKSVAEQLVLKSNGRPFKKNNRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCLIGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKVDPANAKGWFWQTLALGVFSLRLLLKRARK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query389 2.2.26 [Sep-21-2011]
Q4R7R1393 Short-chain dehydrogenase N/A no 0.650 0.643 0.509 4e-65
Q9D665394 Short-chain dehydrogenase yes no 0.655 0.647 0.498 9e-65
Q8WUS8393 Short-chain dehydrogenase yes no 0.650 0.643 0.501 2e-64
Q32L94393 Short-chain dehydrogenase yes no 0.650 0.643 0.490 3e-63
A8DZE7387 Short-chain dehydrogenase yes no 0.655 0.658 0.467 1e-62
Q0IH73386 Short-chain dehydrogenase N/A no 0.642 0.647 0.449 2e-58
A6NKP2422 Putative short-chain dehy no no 0.647 0.597 0.421 8e-52
Q9FX01439 3beta-hydroxysteroid-dehy no no 0.660 0.585 0.357 7e-40
Q67ZE1564 3beta-hydroxysteroid-dehy no no 0.676 0.466 0.342 3e-37
O53454370 3 beta-hydroxysteroid deh yes no 0.616 0.648 0.327 4e-33
>sp|Q4R7R1|D42E1_MACFA Short-chain dehydrogenase/reductase family 42E member 1 OS=Macaca fascicularis GN=SDR42E1 PE=2 SV=1 Back     alignment and function desciption
 Score =  249 bits (635), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 134/263 (50%), Positives = 173/263 (65%), Gaps = 10/263 (3%)

Query: 1   MSGKEMLQFGRVDEVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYF 60
           MSG+E L    ++EVNI GT ++++AC    + RLVY ST+NV+FGG+ I NG+ESLPY 
Sbjct: 84  MSGREQLNRNLIEEVNIGGTDNILQACQRRRVPRLVYTSTFNVIFGGQVIRNGDESLPYL 143

Query: 61  PIDEHVDSYGRSKSVAEQLVLKSNGRPFKKNNRKCLYTCAVRPAAIYGPGEERHLPRIVS 120
           P+  H D Y R+KS+AE+ VL++NG P  + +   L TCA+RPA IYGPGE+RHLPRIVS
Sbjct: 144 PLHLHPDHYSRTKSIAEKKVLEANGTPLDRGD-GVLRTCALRPAGIYGPGEQRHLPRIVS 202

Query: 121 LAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDG 180
             + GL  F  G+P    ++++VDNLV A ILAS  L  D    KG  IASGQPYF+SDG
Sbjct: 203 YIEKGLFKFVYGDPRSLVEFVHVDNLVQAHILASEALRAD----KGH-IASGQPYFISDG 257

Query: 181 FPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILP 240
            P+N FEF  PL++ L Y  P + L     L L   F+F   +++  L R +  QP +  
Sbjct: 258 RPVNNFEFFRPLVEGLGYTFPSTRL----PLTLVYCFAFLTEMVHFILGRLYNFQPFLTR 313

Query: 241 AEVYKVGVTHYFSLLKAKDELCY 263
            EVYK GVTHYFSL KAK EL Y
Sbjct: 314 TEVYKTGVTHYFSLEKAKKELGY 336





Macaca fascicularis (taxid: 9541)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9D665|D42E1_MOUSE Short-chain dehydrogenase/reductase family 42E member 1 OS=Mus musculus GN=Sdr42e1 PE=2 SV=1 Back     alignment and function description
>sp|Q8WUS8|D42E1_HUMAN Short-chain dehydrogenase/reductase family 42E member 1 OS=Homo sapiens GN=SDR42E1 PE=2 SV=2 Back     alignment and function description
>sp|Q32L94|D42E1_BOVIN Short-chain dehydrogenase/reductase family 42E member 1 OS=Bos taurus GN=SDR42E1 PE=2 SV=2 Back     alignment and function description
>sp|A8DZE7|D42E1_DANRE Short-chain dehydrogenase/reductase family 42E member 1 OS=Danio rerio GN=sdr42e1 PE=2 SV=1 Back     alignment and function description
>sp|Q0IH73|D42E1_XENLA Short-chain dehydrogenase/reductase family 42E member 1 OS=Xenopus laevis GN=sdr42e1 PE=2 SV=1 Back     alignment and function description
>sp|A6NKP2|D42E2_HUMAN Putative short-chain dehydrogenase/reductase family 42E member 2 OS=Homo sapiens GN=SDR42E2 PE=3 SV=3 Back     alignment and function description
>sp|Q9FX01|HSDD1_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1 OS=Arabidopsis thaliana GN=3BETAHSD/D1 PE=2 SV=1 Back     alignment and function description
>sp|Q67ZE1|HSDD2_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 2 OS=Arabidopsis thaliana GN=3BETAHSD/D2 PE=2 SV=2 Back     alignment and function description
>sp|O53454|3BHS_MYCTU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis GN=Rv1106c PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query389
255539320478 hydroxysteroid dehydrogenase, putative [ 1.0 0.813 0.771 0.0
418729183478 3-beta-hydroxy-delta5-steroid dehydrogen 1.0 0.813 0.763 0.0
225457644478 PREDICTED: short-chain dehydrogenase/red 1.0 0.813 0.735 1e-177
297745599479 unnamed protein product [Vitis vinifera] 0.979 0.795 0.732 1e-173
449455641478 PREDICTED: short-chain dehydrogenase/red 1.0 0.813 0.706 1e-171
15226138480 Rossmann-fold NAD(P)-binding domain-cont 0.997 0.808 0.719 1e-168
297826819480 3-beta hydroxysteroid dehydrogenase/isom 0.994 0.806 0.724 1e-167
356553309478 PREDICTED: short-chain dehydrogenase/red 1.0 0.813 0.699 1e-166
356564410 491 PREDICTED: short-chain dehydrogenase/red 1.0 0.792 0.700 1e-165
388497514479 unknown [Lotus japonicus] 1.0 0.812 0.697 1e-165
>gi|255539320|ref|XP_002510725.1| hydroxysteroid dehydrogenase, putative [Ricinus communis] gi|223551426|gb|EEF52912.1| hydroxysteroid dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/389 (77%), Positives = 346/389 (88%)

Query: 1   MSGKEMLQFGRVDEVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYF 60
           MSGKEM++FGRVDEVNINGTCHV+EAC+EFGI+RLVYVSTYNVVFGGK+IVNGNESLPYF
Sbjct: 90  MSGKEMIRFGRVDEVNINGTCHVLEACIEFGIKRLVYVSTYNVVFGGKQIVNGNESLPYF 149

Query: 61  PIDEHVDSYGRSKSVAEQLVLKSNGRPFKKNNRKCLYTCAVRPAAIYGPGEERHLPRIVS 120
           P D+HVDSYG SKS+AEQLVLK NGRP KKNN K LYTCA+RPAAIYGPGEERH+PRIVS
Sbjct: 150 PTDDHVDSYGGSKSIAEQLVLKYNGRPLKKNNGKRLYTCAIRPAAIYGPGEERHMPRIVS 209

Query: 121 LAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDG 180
            AKLGL+PF+IG+ +VKTDW+YVDNLVLALILASMGLLDDIP   G P+A+GQPYF+SDG
Sbjct: 210 YAKLGLMPFRIGDANVKTDWVYVDNLVLALILASMGLLDDIPNSGGHPVAAGQPYFISDG 269

Query: 181 FPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILP 240
            PIN+FEF+ PLLK+L+YD+PK+ L+VPHAL LGK+F   Y++LYPWLNRWWLPQP ILP
Sbjct: 270 SPINSFEFLQPLLKSLNYDMPKASLSVPHALILGKIFGAIYTLLYPWLNRWWLPQPFILP 329

Query: 241 AEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCL 300
           AEVYKVGVTHYFS LKAK+EL YVP+V+PREGMAATI+YWQ++KRKSLDGPTIY WLF +
Sbjct: 330 AEVYKVGVTHYFSFLKAKEELGYVPMVTPREGMAATIAYWQEKKRKSLDGPTIYIWLFAV 389

Query: 301 IGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKV 360
           IG+  LF  AYLPDIGPVP+ R I LF  +SM M R  F +A +AH+ E ++AW LAK+V
Sbjct: 390 IGMSTLFCAAYLPDIGPVPLFRAISLFFLRSMRMTRTVFLLASAAHIGESIYAWHLAKRV 449

Query: 361 DPANAKGWFWQTLALGVFSLRLLLKRARK 389
           DPANA+GWFWQTLALG+FSLR LLKRARK
Sbjct: 450 DPANARGWFWQTLALGIFSLRFLLKRARK 478




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|418729183|gb|AFX66971.1| 3-beta-hydroxy-delta5-steroid dehydrogenase [Solanum tuberosum] Back     alignment and taxonomy information
>gi|225457644|ref|XP_002275214.1| PREDICTED: short-chain dehydrogenase/reductase family 42E member 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745599|emb|CBI40764.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449455641|ref|XP_004145560.1| PREDICTED: short-chain dehydrogenase/reductase family 42E member 1-like [Cucumis sativus] gi|449522962|ref|XP_004168494.1| PREDICTED: short-chain dehydrogenase/reductase family 42E member 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15226138|ref|NP_180921.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana] gi|16226673|gb|AAL16229.1|AF428460_1 At2g33630/F4P9.40 [Arabidopsis thaliana] gi|2459443|gb|AAB80678.1| putative steroid dehydrogenase [Arabidopsis thaliana] gi|20260208|gb|AAM13002.1| putative steroid dehydrogenase [Arabidopsis thaliana] gi|330253770|gb|AEC08864.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297826819|ref|XP_002881292.1| 3-beta hydroxysteroid dehydrogenase/isomerase family protein [Arabidopsis lyrata subsp. lyrata] gi|297327131|gb|EFH57551.1| 3-beta hydroxysteroid dehydrogenase/isomerase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356553309|ref|XP_003544999.1| PREDICTED: short-chain dehydrogenase/reductase family 42E member 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356564410|ref|XP_003550447.1| PREDICTED: short-chain dehydrogenase/reductase family 42E member 1-like [Glycine max] Back     alignment and taxonomy information
>gi|388497514|gb|AFK36823.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query389
TAIR|locus:2051063480 AT2G33630 [Arabidopsis thalian 0.997 0.808 0.719 9.9e-158
UNIPROTKB|I3L900390 SDR42E1 "Uncharacterized prote 0.640 0.638 0.509 5.5e-61
MGI|MGI:1921282394 Sdr42e1 "short chain dehydroge 0.655 0.647 0.498 1.5e-60
UNIPROTKB|Q8WUS8393 SDR42E1 "Short-chain dehydroge 0.776 0.768 0.452 6.4e-60
UNIPROTKB|J9NYA9393 SDR42E1 "Uncharacterized prote 0.650 0.643 0.498 8.1e-60
UNIPROTKB|F1MDX4398 SDR42E1 "Short-chain dehydroge 0.650 0.635 0.490 2.2e-59
UNIPROTKB|G3X7Y2393 SDR42E1 "Short-chain dehydroge 0.650 0.643 0.490 2.2e-59
UNIPROTKB|Q32L94393 SDR42E1 "Short-chain dehydroge 0.650 0.643 0.490 2.2e-59
ZFIN|ZDB-GENE-051120-63400 sdr42e1 "short chain dehydroge 0.776 0.755 0.421 1.9e-58
UNIPROTKB|E1C6D8391 SDR42E1 "Uncharacterized prote 0.655 0.652 0.483 5.1e-58
TAIR|locus:2051063 AT2G33630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1537 (546.1 bits), Expect = 9.9e-158, P = 9.9e-158
 Identities = 280/389 (71%), Positives = 337/389 (86%)

Query:     1 MSGKEMLQFGRVDEVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYF 60
             MSGKEML+FGR DEVNINGTC+V+EA  +  I R+VYVSTYNVVFGGKEI+NGNE LPYF
Sbjct:    90 MSGKEMLRFGRCDEVNINGTCNVLEAAFKHEITRIVYVSTYNVVFGGKEILNGNEGLPYF 149

Query:    61 PIDEHVDSYGRSKSVAEQLVLKSNGRPFKKNNRKCLYTCAVRPAAIYGPGEERHLPRIVS 120
             P+D+HVD+Y R+KS+AEQLVLKSNGRPFK N  K +YTCA+RPAAIYGPGE+RHLPRIV+
Sbjct:   150 PLDDHVDAYSRTKSIAEQLVLKSNGRPFK-NGGKRMYTCAIRPAAIYGPGEDRHLPRIVT 208

Query:   121 LAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDG 180
             L KLGL  FKIGEPSVK+DWIYV+NLVLA+ILASMGLLDDIPG++G+P+A+GQPYFVSDG
Sbjct:   209 LTKLGLALFKIGEPSVKSDWIYVENLVLAIILASMGLLDDIPGREGQPVAAGQPYFVSDG 268

Query:   181 FPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILP 240
             +P+NTFEF+ PLLK+LDYDLPK  ++VP AL LGK+F  FY+VLYPWL++ WLPQPL+LP
Sbjct:   269 YPVNTFEFLRPLLKSLDYDLPKCTISVPFALSLGKIFQGFYTVLYPWLSKSWLPQPLVLP 328

Query:   241 AEVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKSLDGPTIYAWLFCL 300
             AEVYKVGVTHYFS LKAK+EL YVP  S +EGMAATISYWQ+RKR+SLDGPT++ W+   
Sbjct:   329 AEVYKVGVTHYFSYLKAKEELGYVPFKSSKEGMAATISYWQERKRRSLDGPTMFTWIAVT 388

Query:   301 IGLPALFATAYLPDIGPVPILRTIGLFIFKSMWMMRLAFAIAVSAHVSEGVFAWCLAKKV 360
             IG+ ALFA  +LPDIGPVP LR I LF F+++ +++  F +AV  HV+EG++AW LAK+V
Sbjct:   389 IGMSALFAAGWLPDIGPVPFLRAIHLFFFRTITIVKAVFIVAVVLHVAEGIYAWFLAKRV 448

Query:   361 DPANAKGWFWQTLALGVFSLRLLLKRARK 389
             DP NA GWF QT ALG FS+R LLKRA++
Sbjct:   449 DPGNAMGWFLQTSALGFFSMRFLLKRAKE 477




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003854 "3-beta-hydroxy-delta5-steroid dehydrogenase activity" evidence=IEA;ISS
GO:0006694 "steroid biosynthetic process" evidence=IEA;ISS
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IDA
UNIPROTKB|I3L900 SDR42E1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1921282 Sdr42e1 "short chain dehydrogenase/reductase family 42E, member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WUS8 SDR42E1 "Short-chain dehydrogenase/reductase family 42E member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NYA9 SDR42E1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MDX4 SDR42E1 "Short-chain dehydrogenase/reductase family 42E member 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3X7Y2 SDR42E1 "Short-chain dehydrogenase/reductase family 42E member 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q32L94 SDR42E1 "Short-chain dehydrogenase/reductase family 42E member 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051120-63 sdr42e1 "short chain dehydrogenase/reductase family 42E, member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6D8 SDR42E1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8WUS8D42E1_HUMAN1, ., 1, ., 1, ., -0.50190.65030.6437yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query389
cd09812339 cd09812, 3b-HSD_like_1_SDR_e, 3beta-hydroxysteroid 3e-92
pfam01073280 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydr 1e-72
cd05241331 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid d 4e-64
cd09813335 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD 1e-58
cd09811354 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD 5e-35
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 3e-20
cd08946200 cd08946, SDR_e, extended (e) SDRs 2e-18
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 8e-16
cd05228318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 1e-15
cd05232303 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, 3e-15
cd05246315 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydra 2e-10
cd05263293 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens 5e-09
pfam07993245 pfam07993, NAD_binding_4, Male sterility protein 7e-09
cd05257316 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, 9e-09
cd05256304 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-e 6e-08
cd05271273 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ub 7e-08
cd05264300 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase 1e-07
cd05266251 cd05266, SDR_a4, atypical (a) SDRs, subgroup 4 4e-07
TIGR04180297 TIGR04180, EDH_00030, NAD dependent epimerase/dehy 3e-06
pfam04321284 pfam04321, RmlD_sub_bind, RmlD substrate binding d 1e-05
COG1091281 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [C 3e-05
cd05265250 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 4e-05
COG1087329 COG1087, GalE, UDP-glucose 4-epimerase [Cell envel 5e-05
TIGR01179328 TIGR01179, galE, UDP-glucose-4-epimerase GalE 6e-05
cd05254280 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4 1e-04
cd05240306 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase 1e-04
COG1088340 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cel 1e-04
TIGR01181317 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehyd 2e-04
TIGR01214287 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase 3e-04
cd05235290 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 3e-04
cd05247323 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, 5e-04
TIGR03466328 TIGR03466, HpnA, hopanoid-associated sugar epimera 6e-04
cd05258337 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, e 0.001
cd05226176 cd05226, SDR_e_a, Extended (e) and atypical (a) SD 0.002
>gnl|CDD|187672 cd09812, 3b-HSD_like_1_SDR_e, 3beta-hydroxysteroid dehydrogenase (3b-HSD)-like, subgroup1, extended (e) SDRs Back     alignment and domain information
 Score =  280 bits (717), Expect = 3e-92
 Identities = 133/265 (50%), Positives = 174/265 (65%), Gaps = 10/265 (3%)

Query: 1   MSGKEMLQFGRVDEVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYF 60
           MSG+E L    ++E+N+ GT ++I+ C+   + RL+Y ST+NV+FGG+ I NG+ESLPY 
Sbjct: 73  MSGREQLNRELIEEINVRGTENIIQVCVRRRVPRLIYTSTFNVIFGGQPIRNGDESLPYL 132

Query: 61  PIDEHVDSYGRSKSVAEQLVLKSNGRPFKKNNRKCLYTCAVRPAAIYGPGEERHLPRIVS 120
           P+D HVD Y R+KS+AEQLVLK+N  P   NN   L TCA+RPA IYGPGE+RHLPRIVS
Sbjct: 133 PLDLHVDHYSRTKSIAEQLVLKANNMPL-PNNGGVLRTCALRPAGIYGPGEQRHLPRIVS 191

Query: 121 LAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDG 180
             + GL  F  G+P    ++++VDNLV A ILA+  L       KG  IASGQ YF+SDG
Sbjct: 192 YIEKGLFMFVYGDPKSLVEFVHVDNLVQAHILAAEALTTA----KGY-IASGQAYFISDG 246

Query: 181 FPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILP 240
            P+N FEF  PL++ L Y  P   L +P +L     F+F   +++  L      QPL+  
Sbjct: 247 RPVNNFEFFRPLVEGLGYSFP--SLRLPLSLVY--FFAFLTEMVHFALGPICNFQPLLTR 302

Query: 241 AEVYKVGVTHYFSLLKAKDELCYVP 265
            EVYK GVTHYFS+ KA+ EL Y P
Sbjct: 303 TEVYKTGVTHYFSIEKARAELGYEP 327


An uncharacterized subgroup of the 3b-HSD-like extended-SDR family. Proteins in this subgroup have the characteristic active site tetrad and NAD(P)-binding motif of extended-SDRs. 3 beta-HSD catalyzes the oxidative conversion of delta 5-3 beta-hydroxysteroids to the delta 4-3-keto configuration; this activity is essential for the biosynthesis of all classes of hormonal steroids. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid sythase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 339

>gnl|CDD|216283 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information
>gnl|CDD|187552 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases (3b-HSD)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187673 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD(P)H steroid dehydrogenase-like protein)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187671 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD (hydroxysteroid dehydrogenase) and HSD3B1(delta 5-delta 4-isomerase)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187543 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, subgroup 4, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187557 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein Back     alignment and domain information
>gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187566 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187579 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187574 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase (G4E), subgroup 5, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187576 cd05266, SDR_a4, atypical (a) SDRs, subgroup 4 Back     alignment and domain information
>gnl|CDD|200431 TIGR04180, EDH_00030, NAD dependent epimerase/dehydratase, LLPSF_EDH_00030 family Back     alignment and domain information
>gnl|CDD|218026 pfam04321, RmlD_sub_bind, RmlD substrate binding domain Back     alignment and domain information
>gnl|CDD|224016 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187575 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|224012 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|213592 TIGR01179, galE, UDP-glucose-4-epimerase GalE Back     alignment and domain information
>gnl|CDD|187564 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4-hexulose reductase and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187551 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase (G4E), subgroup 3, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224013 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|130249 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|200085 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>gnl|CDD|187546 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|187558 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase Back     alignment and domain information
>gnl|CDD|187568 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 389
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 100.0
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 100.0
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 100.0
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 99.98
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.97
PLN02166436 dTDP-glucose 4,6-dehydratase 99.97
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.96
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.96
PLN02206442 UDP-glucuronate decarboxylase 99.96
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.96
PLN02427386 UDP-apiose/xylose synthase 99.96
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.96
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.96
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.96
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.96
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.95
PLN02240352 UDP-glucose 4-epimerase 99.95
PLN02572442 UDP-sulfoquinovose synthase 99.95
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.95
PLN02653340 GDP-mannose 4,6-dehydratase 99.95
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.95
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.95
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.95
PLN02260 668 probable rhamnose biosynthetic enzyme 99.95
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.95
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.95
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.94
PLN02214342 cinnamoyl-CoA reductase 99.94
PLN00016378 RNA-binding protein; Provisional 99.94
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 99.94
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.93
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.93
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.93
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.93
PLN00198338 anthocyanidin reductase; Provisional 99.92
PLN02650351 dihydroflavonol-4-reductase 99.92
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.92
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.91
PF1493491 DUF4499: Domain of unknown function (DUF4499) 99.91
PLN02896353 cinnamyl-alcohol dehydrogenase 99.91
PRK07201 657 short chain dehydrogenase; Provisional 99.9
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 99.9
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 99.89
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 99.89
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.88
PLN02686367 cinnamoyl-CoA reductase 99.87
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.86
CHL00194317 ycf39 Ycf39; Provisional 99.86
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.85
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.84
PLN02996491 fatty acyl-CoA reductase 99.83
PRK05865 854 hypothetical protein; Provisional 99.82
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.8
PLN02583297 cinnamoyl-CoA reductase 99.78
PLN02778298 3,5-epimerase/4-reductase 99.76
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.76
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.76
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 99.74
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.7
PLN02503605 fatty acyl-CoA reductase 2 99.68
PLN02260668 probable rhamnose biosynthetic enzyme 99.62
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.62
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.6
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.6
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.56
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.51
PRK12320 699 hypothetical protein; Provisional 99.33
COG3320382 Putative dehydrogenase domain of multifunctional n 99.31
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 99.26
KOG3019315 consensus Predicted nucleoside-diphosphate sugar e 99.26
KOG2774366 consensus NAD dependent epimerase [General functio 99.11
KOG1221467 consensus Acyl-CoA reductase [Lipid transport and 99.08
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.07
PRK06482276 short chain dehydrogenase; Provisional 98.96
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 98.88
PRK09135249 pteridine reductase; Provisional 98.87
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 98.85
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 98.82
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.76
KOG4288283 consensus Predicted oxidoreductase [General functi 98.7
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 98.69
PRK08263275 short chain dehydrogenase; Provisional 98.68
PRK05875276 short chain dehydrogenase; Provisional 98.63
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 98.62
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 98.62
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.59
PRK07806248 short chain dehydrogenase; Provisional 98.59
PRK07074257 short chain dehydrogenase; Provisional 98.58
PLN03209576 translocon at the inner envelope of chloroplast su 98.57
PRK07067257 sorbitol dehydrogenase; Provisional 98.57
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.54
PRK12829264 short chain dehydrogenase; Provisional 98.53
PRK08324681 short chain dehydrogenase; Validated 98.53
PRK06914280 short chain dehydrogenase; Provisional 98.51
PRK06123248 short chain dehydrogenase; Provisional 98.51
PRK07775274 short chain dehydrogenase; Provisional 98.49
PRK12935247 acetoacetyl-CoA reductase; Provisional 98.49
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 98.47
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.45
PRK07774250 short chain dehydrogenase; Provisional 98.44
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 98.41
PRK05876275 short chain dehydrogenase; Provisional 98.41
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 98.4
PRK12828239 short chain dehydrogenase; Provisional 98.39
PRK07523255 gluconate 5-dehydrogenase; Provisional 98.38
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.36
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 98.35
PRK07060245 short chain dehydrogenase; Provisional 98.34
PRK06138252 short chain dehydrogenase; Provisional 98.33
PRK12827249 short chain dehydrogenase; Provisional 98.33
PRK08213259 gluconate 5-dehydrogenase; Provisional 98.27
PRK06128300 oxidoreductase; Provisional 98.25
PRK12746254 short chain dehydrogenase; Provisional 98.24
PRK06180277 short chain dehydrogenase; Provisional 98.23
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 98.23
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 98.22
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.22
PRK07890258 short chain dehydrogenase; Provisional 98.22
PRK12939250 short chain dehydrogenase; Provisional 98.19
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 98.16
PRK06500249 short chain dehydrogenase; Provisional 98.15
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.15
PRK09134258 short chain dehydrogenase; Provisional 98.13
PRK09186256 flagellin modification protein A; Provisional 98.13
PRK12824245 acetoacetyl-CoA reductase; Provisional 98.09
PRK06701290 short chain dehydrogenase; Provisional 98.07
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 98.06
PRK07041230 short chain dehydrogenase; Provisional 98.03
PRK06841255 short chain dehydrogenase; Provisional 98.02
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.02
PLN02253280 xanthoxin dehydrogenase 98.02
PF1395062 Epimerase_Csub: UDP-glucose 4-epimerase C-term sub 98.0
PRK06182273 short chain dehydrogenase; Validated 97.97
PRK12743256 oxidoreductase; Provisional 97.95
PRK12938246 acetyacetyl-CoA reductase; Provisional 97.94
PRK05717255 oxidoreductase; Validated 97.93
PRK06523260 short chain dehydrogenase; Provisional 97.93
PRK07985294 oxidoreductase; Provisional 97.92
PRK08628258 short chain dehydrogenase; Provisional 97.92
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 97.91
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.89
PRK06194287 hypothetical protein; Provisional 97.88
PRK08017256 oxidoreductase; Provisional 97.84
PRK06181263 short chain dehydrogenase; Provisional 97.84
PRK12747252 short chain dehydrogenase; Provisional 97.84
PRK08219227 short chain dehydrogenase; Provisional 97.83
PRK06198260 short chain dehydrogenase; Provisional 97.83
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 97.82
PRK10538248 malonic semialdehyde reductase; Provisional 97.82
PRK07577234 short chain dehydrogenase; Provisional 97.81
KOG1203411 consensus Predicted dehydrogenase [Carbohydrate tr 97.8
PRK07069251 short chain dehydrogenase; Validated 97.79
PRK08085254 gluconate 5-dehydrogenase; Provisional 97.78
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 97.76
PRK12742237 oxidoreductase; Provisional 97.75
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.75
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 97.73
PRK12937245 short chain dehydrogenase; Provisional 97.72
PRK07453322 protochlorophyllide oxidoreductase; Validated 97.7
PRK06196315 oxidoreductase; Provisional 97.69
PRK06124256 gluconate 5-dehydrogenase; Provisional 97.67
PRK05650270 short chain dehydrogenase; Provisional 97.67
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 97.66
PRK07024257 short chain dehydrogenase; Provisional 97.65
PRK08264238 short chain dehydrogenase; Validated 97.65
PRK05993277 short chain dehydrogenase; Provisional 97.65
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.65
PRK06057255 short chain dehydrogenase; Provisional 97.63
PRK06947248 glucose-1-dehydrogenase; Provisional 97.62
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.62
PRK07326237 short chain dehydrogenase; Provisional 97.62
PRK09242257 tropinone reductase; Provisional 97.61
PRK09291257 short chain dehydrogenase; Provisional 97.61
PRK08251248 short chain dehydrogenase; Provisional 97.58
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 97.56
PRK07856252 short chain dehydrogenase; Provisional 97.55
PRK06114254 short chain dehydrogenase; Provisional 97.54
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 97.54
PRK06101240 short chain dehydrogenase; Provisional 97.54
PRK12744257 short chain dehydrogenase; Provisional 97.51
PRK08277278 D-mannonate oxidoreductase; Provisional 97.5
PRK07035252 short chain dehydrogenase; Provisional 97.5
PRK08643256 acetoin reductase; Validated 97.48
PRK07097265 gluconate 5-dehydrogenase; Provisional 97.47
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.46
TIGR02415254 23BDH acetoin reductases. One member of this famil 97.45
PRK07825273 short chain dehydrogenase; Provisional 97.44
PRK08226263 short chain dehydrogenase; Provisional 97.44
PRK06197306 short chain dehydrogenase; Provisional 97.44
PRK08267260 short chain dehydrogenase; Provisional 97.39
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 97.36
PRK07814263 short chain dehydrogenase; Provisional 97.33
PRK06949258 short chain dehydrogenase; Provisional 97.32
PRK06179270 short chain dehydrogenase; Provisional 97.32
PRK06398258 aldose dehydrogenase; Validated 97.26
PRK07102243 short chain dehydrogenase; Provisional 97.26
PRK07063260 short chain dehydrogenase; Provisional 97.26
PRK06172253 short chain dehydrogenase; Provisional 97.26
PRK07454241 short chain dehydrogenase; Provisional 97.25
PRK08703239 short chain dehydrogenase; Provisional 97.24
PRK07478254 short chain dehydrogenase; Provisional 97.24
PRK06924251 short chain dehydrogenase; Provisional 97.21
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.18
PRK06484520 short chain dehydrogenase; Validated 97.16
PRK07677252 short chain dehydrogenase; Provisional 97.16
PRK08265261 short chain dehydrogenase; Provisional 97.13
PRK07576264 short chain dehydrogenase; Provisional 97.12
PRK06483236 dihydromonapterin reductase; Provisional 97.11
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 97.1
PRK07831262 short chain dehydrogenase; Provisional 97.07
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 97.07
PRK05867253 short chain dehydrogenase; Provisional 97.05
PRK08936261 glucose-1-dehydrogenase; Provisional 97.03
PRK07578199 short chain dehydrogenase; Provisional 97.03
PRK07904253 short chain dehydrogenase; Provisional 97.02
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 96.98
PRK08339263 short chain dehydrogenase; Provisional 96.96
PRK05693274 short chain dehydrogenase; Provisional 96.96
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.95
PRK08589272 short chain dehydrogenase; Validated 96.91
PRK07109334 short chain dehydrogenase; Provisional 96.89
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 96.88
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.85
smart00822180 PKS_KR This enzymatic domain is part of bacterial 96.83
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.82
PRK05866293 short chain dehydrogenase; Provisional 96.8
PRK06953222 short chain dehydrogenase; Provisional 96.75
PRK07832272 short chain dehydrogenase; Provisional 96.67
PRK05854313 short chain dehydrogenase; Provisional 96.66
PRK06940275 short chain dehydrogenase; Provisional 96.65
PRK09072263 short chain dehydrogenase; Provisional 96.61
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 96.6
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 96.59
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 96.57
PRK08278273 short chain dehydrogenase; Provisional 96.52
PRK07023243 short chain dehydrogenase; Provisional 96.52
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.5
PRK06139330 short chain dehydrogenase; Provisional 96.49
PRK05872296 short chain dehydrogenase; Provisional 96.48
PRK07791286 short chain dehydrogenase; Provisional 96.47
PRK07201657 short chain dehydrogenase; Provisional 96.47
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 96.42
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 96.39
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 96.36
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 96.35
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 96.33
PRK06125259 short chain dehydrogenase; Provisional 96.16
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 96.15
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 96.07
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 96.06
PLN02780320 ketoreductase/ oxidoreductase 96.05
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 96.02
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 95.96
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 95.94
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 95.91
PRK08340259 glucose-1-dehydrogenase; Provisional 95.87
PRK07062265 short chain dehydrogenase; Provisional 95.84
PRK05855582 short chain dehydrogenase; Validated 95.74
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 95.52
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 95.5
COG2910211 Putative NADH-flavin reductase [General function p 95.33
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 95.32
PRK06484520 short chain dehydrogenase; Validated 95.3
PRK05884223 short chain dehydrogenase; Provisional 95.1
PRK09009235 C factor cell-cell signaling protein; Provisional 94.9
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 94.79
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 94.71
PRK08177225 short chain dehydrogenase; Provisional 94.56
PLN02730303 enoyl-[acyl-carrier-protein] reductase 94.49
PLN00015308 protochlorophyllide reductase 94.41
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 93.97
PF08732410 HIM1: HIM1; InterPro: IPR014843 HIM1 (high inducti 92.83
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 92.62
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 91.75
KOG1208314 consensus Dehydrogenases with different specificit 91.5
TIGR028132582 omega_3_PfaA polyketide-type polyunsaturated fatty 90.81
KOG1611249 consensus Predicted short chain-type dehydrogenase 89.94
PRK05599246 hypothetical protein; Provisional 89.26
PRK08303305 short chain dehydrogenase; Provisional 88.64
COG1028251 FabG Dehydrogenases with different specificities ( 88.46
KOG1204253 consensus Predicted dehydrogenase [Secondary metab 88.08
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 87.67
KOG0725270 consensus Reductases with broad range of substrate 87.25
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 86.8
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 86.56
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 85.89
PRK07424406 bifunctional sterol desaturase/short chain dehydro 85.28
PRK12367245 short chain dehydrogenase; Provisional 84.81
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 84.13
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 83.26
PRK1091089 hypothetical protein; Provisional 80.35
COG0300265 DltE Short-chain dehydrogenases of various substra 80.26
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=1.5e-42  Score=331.34  Aligned_cols=263  Identities=44%  Similarity=0.721  Sum_probs=244.9

Q ss_pred             ccccCcchhhhHhhhhHHHHHHHHHHHcCCCeEEEecCCceecCCcccCCCCCCCCCCCCCCCCCcHHHHHHHHHHHHHH
Q 016468            3 GKEMLQFGRVDEVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYFPIDEHVDSYGRSKSVAEQLVLK   82 (389)
Q Consensus         3 g~~~~~~~~~~~vNv~gt~nll~aa~~~gvkrlV~~SS~~vvyg~~~~~~~~E~~p~~p~~~~~~~Y~~SK~~aE~~l~~   82 (389)
                      +-...+++..+++||.||+|++++|++.||+|+||+||.+|+|++.+..+.+|+.|+.  .++.++|+.||++||+++++
T Consensus        89 ~~~~~~~~~~~~vNV~gT~nvi~~c~~~~v~~lIYtSs~~Vvf~g~~~~n~~E~~p~p--~~~~d~Y~~sKa~aE~~Vl~  166 (361)
T KOG1430|consen   89 DFVENDRDLAMRVNVNGTLNVIEACKELGVKRLIYTSSAYVVFGGEPIINGDESLPYP--LKHIDPYGESKALAEKLVLE  166 (361)
T ss_pred             cccccchhhheeecchhHHHHHHHHHHhCCCEEEEecCceEEeCCeecccCCCCCCCc--cccccccchHHHHHHHHHHH
Confidence            3344579999999999999999999999999999999999999999988999999986  67789999999999999999


Q ss_pred             hCCCCCCCCCCCCceEEEEecCceecCCCCCCHHHHHHHHHcCCCcceecCCCccccceeHHHHHHHHHHHHhcccCCCC
Q 016468           83 SNGRPFKKNNRKCLYTCAVRPAAIYGPGEERHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIP  162 (389)
Q Consensus        83 ~~~~~~~~~~~~gl~~~ilRp~~IyGp~~~~~~~~li~~~~~g~~~~~~g~~~~~~~~v~vdDla~a~~~a~~~l~~~~~  162 (389)
                      +++       ..++.+|+|||+.|||||+...++.++..++.|...+..|+++...|+++++|++.|+++|..+|.+.  
T Consensus       167 an~-------~~~l~T~aLR~~~IYGpgd~~~~~~i~~~~~~g~~~f~~g~~~~~~~~~~~~Nva~ahilA~~aL~~~--  237 (361)
T KOG1430|consen  167 ANG-------SDDLYTCALRPPGIYGPGDKRLLPKIVEALKNGGFLFKIGDGENLNDFTYGENVAWAHILAARALLDK--  237 (361)
T ss_pred             hcC-------CCCeeEEEEccccccCCCCccccHHHHHHHHccCceEEeeccccccceEEechhHHHHHHHHHHHHhc--
Confidence            984       36799999999999999999999999999999999999999999999999999999999999988764  


Q ss_pred             CCCCCCCCCCceEEEeCCCCCChHHHHHHHHHhCCCCCC-ccccCHHHHHHHHHHHHHHHHHhhhccccccCCCCCCCHH
Q 016468          163 GQKGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLP-KSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPA  241 (389)
Q Consensus       163 ~~~~~~~~~g~~y~i~~~~~~s~~e~~~~l~~~lg~~~~-~~~~p~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~  241 (389)
                          .+..+||+|+|+|++|+..++++..+.+.+|+..| ...+|.++...++.+.++++.+++|       .+|.+++.
T Consensus       238 ----~~~~~Gq~yfI~d~~p~~~~~~~~~l~~~lg~~~~~~~~~p~~l~~~~~~l~e~~~~~l~p-------~~p~lt~~  306 (361)
T KOG1430|consen  238 ----SPSVNGQFYFITDDTPVRFFDFLSPLVKALGYCLPSSIKLPLFLSYFLAYLLEIVYFLLRP-------YQPILTRF  306 (361)
T ss_pred             ----CCccCceEEEEeCCCcchhhHHHHHHHHhcCCCCCceeecchHHHHHHHHHHHHHHHhccC-------CCCCcChh
Confidence                77889999999999999999999999999999988 8899999999999999999999876       57899999


Q ss_pred             HHHHhccccccchHHHHHhCCCCCCCChHHHHHHHHHHHHHcccCC
Q 016468          242 EVYKVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRKS  287 (389)
Q Consensus       242 ~~~~~~~~~~~d~~ka~~~LG~~p~~sl~~~l~~~v~~~~~~~~~~  287 (389)
                      ++..+..+++||++||+++|||+|.+++++++++++.|+.......
T Consensus       307 ~v~~~~~~~~f~~~kA~~~lgY~P~~~~~e~~~~~~~~~~~~~~~~  352 (361)
T KOG1430|consen  307 RVALLGVTRTFSIEKAKRELGYKPLVSLEEAIQRTIHWVASESDSA  352 (361)
T ss_pred             heeeeccccccCHHHHHHhhCCCCcCCHHHHHHHHHHHHhhhhhcc
Confidence            9999999999999999999999999999999999999887755543



>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PF14934 DUF4499: Domain of unknown function (DUF4499) Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PF13950 Epimerase_Csub: UDP-glucose 4-epimerase C-term subunit; PDB: 1EK5_A 1I3K_B 1I3M_B 1HZJ_A 1EK6_A 1I3N_A 1I3L_A 2CNB_B 1GY8_D 1NAI_A Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF08732 HIM1: HIM1; InterPro: IPR014843 HIM1 (high induction of mutagenesis protein 1) plays a role in the control of spontaneous and induced mutagenesis [] Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK10910 hypothetical protein; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query389
1r6d_A337 Crystal Structure Of Desiv Double Mutant (Dtdp-Gluc 3e-05
1r66_A337 Crystal Structure Of Desiv (Dtdp-Glucose 4,6-Dehydr 1e-04
>pdb|1R6D|A Chain A, Crystal Structure Of Desiv Double Mutant (Dtdp-Glucose 4,6- Dehydratase) From Streptomyces Venezuelae With Nad And Dau Bound Length = 337 Back     alignment and structure

Iteration: 1

Score = 46.2 bits (108), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 52/191 (27%), Positives = 87/191 (45%), Gaps = 32/191 (16%) Query: 14 EVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYFPIDEHVDSYGRSK 73 E N+ GT +++ ++ G+ R+V+VST N V+G + + ES P P Y SK Sbjct: 101 ETNVQGTQTLLQCAVDAGVGRVVHVST-NQVYGSIDSGSWTESSPLEP----NSPYAASK 155 Query: 74 SVAEQLVLKSNGRPFKKNNRKCLYTCAVRPAAIYGPGE--ERHLPRIVS-LAKLGLVPFK 130 + LV ++ R + + R R YGP + E+ +P V+ L G +P Sbjct: 156 A-GSDLVARAYHRTYGLDVR------ITRCCNNYGPYQHPEKLIPLFVTNLLDGGTLPL- 207 Query: 131 IGEPSVKTDWIYVDNLV--LALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEF 188 G+ + +W++ D+ +AL+LA GR +G+ Y + G + E Sbjct: 208 YGDGANVREWVHTDDHCRGIALVLAG-----------GR---AGEIYHIGGGLELTNREL 253 Query: 189 IGPLLKTLDYD 199 G LL +L D Sbjct: 254 TGILLDSLGAD 264
>pdb|1R66|A Chain A, Crystal Structure Of Desiv (Dtdp-Glucose 4,6-Dehydratase) From Streptomyces Venezuelae With Nad And Tyd Bound Length = 337 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query389
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 1e-46
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 6e-15
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 8e-14
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 9e-13
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 2e-12
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 1e-11
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 2e-11
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 4e-11
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 8e-11
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 2e-10
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 4e-10
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 6e-10
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 7e-10
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 8e-10
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 2e-09
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 4e-09
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 8e-09
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 5e-08
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 6e-08
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 8e-08
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 3e-07
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 4e-07
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 7e-07
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 2e-06
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 5e-06
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 8e-06
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 1e-05
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 3e-05
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 3e-05
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 4e-05
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 4e-05
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 8e-05
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 2e-04
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 2e-04
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 2e-04
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 2e-04
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 2e-04
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 3e-04
1xq6_A253 Unknown protein; structural genomics, protein stru 7e-04
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
 Score =  161 bits (410), Expect = 1e-46
 Identities = 39/271 (14%), Positives = 90/271 (33%), Gaps = 34/271 (12%)

Query: 14  EVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYFPIDEHVDSYGRSK 73
              +  T     ACL+  + R++YV +   +    + + G+E L Y  +     SY   K
Sbjct: 100 ASALGQTNPFYAACLQARVPRILYVGSAYAMPRHPQGLPGHEGLFYDSLPSGKSSYVLCK 159

Query: 74  SVAEQLVLKSNGRPFKKNNRKCLYTCAVRPAAIYGPGEERHLP-RIVSLAKLGLVPFKIG 132
              ++   +                    P  + G  +      R+++    G +   + 
Sbjct: 160 WALDEQAREQARNGLP--------VVIGIPGMVLGELDIGPTTGRVITAIGNGEMTHYVA 211

Query: 133 EPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPINTFEFIGPL 192
               + + I        L++A          ++GR    G+ Y ++ G  +   +    +
Sbjct: 212 ---GQRNVIDAAEAGRGLLMA---------LERGRI---GERYLLT-GHNLEMADLTRRI 255

Query: 193 LKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYKVGVTHYF 252
            + L    P+    +  A+          + L     R     PL+    +  +    + 
Sbjct: 256 AELLGQPAPQP---MSMAMA------RALATLGRLRYRVSGQLPLLDETAIEVMAGGQFL 306

Query: 253 SLLKAKDELCYVPIVSPREGMAATISYWQDR 283
              KA++EL +    +  + +   I +++D 
Sbjct: 307 DGRKAREELGFFSTTALDDTLLRAIDWFRDN 337


>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Length = 311 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Length = 311 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Length = 333 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} Length = 313 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Length = 352 Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Length = 478 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Length = 321 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} PDB: 3icp_A* 3aw9_A* Length = 312 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Length = 267 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Length = 286 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Length = 267 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Length = 351 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Length = 377 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Length = 312 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Length = 342 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Length = 330 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Length = 369 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Length = 357 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Length = 362 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Length = 310 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Length = 219 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Length = 379 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Length = 315 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Length = 292 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} Length = 287 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Length = 299 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Length = 273 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Length = 221 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Length = 404 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Length = 357 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Length = 337 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Length = 236 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Length = 347 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Length = 322 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Length = 338 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Length = 253 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query389
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.98
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.98
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.98
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.97
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.97
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.97
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.97
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.97
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.97
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.97
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.97
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.97
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.97
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.97
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.96
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.96
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.96
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.96
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.96
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.96
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.96
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.96
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.96
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.96
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.96
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.96
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.96
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.96
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.96
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.96
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.95
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.95
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.95
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.95
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.95
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.95
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.95
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.95
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.95
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.95
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.95
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.95
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.94
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.94
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.94
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.94
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.94
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.94
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.94
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.93
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.93
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.93
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.93
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.9
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.9
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.9
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.9
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.9
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.89
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.87
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.87
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.87
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.85
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.85
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.78
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.75
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.74
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.73
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.73
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.73
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.7
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.65
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.64
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.63
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.62
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.62
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.61
1xq6_A253 Unknown protein; structural genomics, protein stru 99.56
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.55
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.54
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.54
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.46
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.37
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.37
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.36
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.33
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.31
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.17
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.12
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 98.96
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 98.95
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 98.95
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 98.93
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 98.92
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 98.9
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 98.89
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 98.87
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 98.87
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 98.87
1spx_A278 Short-chain reductase family member (5L265); paral 98.85
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 98.8
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 98.79
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 98.78
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 98.77
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.76
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 98.76
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 98.75
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 98.74
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 98.74
1xq1_A266 Putative tropinone reducatse; structural genomics, 98.73
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 98.71
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 98.71
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 98.7
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 98.69
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 98.67
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 98.67
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 98.66
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 98.66
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 98.65
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 98.64
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 98.62
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 98.61
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 98.6
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 98.58
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 98.57
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 98.57
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 98.57
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 98.56
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 98.56
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 98.56
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 98.56
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 98.56
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 98.55
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 98.55
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 98.55
3rih_A293 Short chain dehydrogenase or reductase; structural 98.53
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 98.53
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 98.52
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 98.52
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 98.51
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 98.51
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 98.51
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 98.51
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 98.5
3gem_A260 Short chain dehydrogenase; structural genomics, AP 98.5
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 98.5
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 98.5
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 98.48
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 98.48
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 98.47
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 98.47
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.47
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 98.47
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 98.47
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 98.47
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 98.47
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 98.46
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 98.46
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 98.46
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 98.45
1nff_A260 Putative oxidoreductase RV2002; directed evolution 98.44
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 98.43
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 98.43
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 98.43
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 98.42
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 98.42
3qlj_A322 Short chain dehydrogenase; structural genomics, se 98.42
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 98.42
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 98.41
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 98.41
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 98.41
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 98.4
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 98.4
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 98.4
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 98.4
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 98.4
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 98.4
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 98.39
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 98.39
3imf_A257 Short chain dehydrogenase; structural genomics, in 98.37
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 98.37
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 98.36
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 98.36
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 98.36
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 98.35
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 98.35
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 98.35
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 98.35
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 98.34
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 98.34
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 98.34
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 98.34
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 98.32
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 98.31
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 98.31
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 98.31
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 98.3
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 98.29
1xhl_A297 Short-chain dehydrogenase/reductase family member 98.29
4eso_A255 Putative oxidoreductase; NADP, structural genomics 98.29
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 98.29
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 98.28
4e4y_A244 Short chain dehydrogenase family protein; structur 98.28
3cxt_A291 Dehydrogenase with different specificities; rossma 98.27
3tox_A280 Short chain dehydrogenase; structural genomics, PS 98.27
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 98.27
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.27
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.26
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 98.26
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 98.26
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 98.25
4dqx_A277 Probable oxidoreductase protein; structural genomi 98.25
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 98.24
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 98.23
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 98.23
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 98.23
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 98.22
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 98.21
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 98.21
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 98.21
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 98.2
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 98.2
3edm_A259 Short chain dehydrogenase; structural genomics, ox 98.2
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 98.19
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 98.19
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.19
1xkq_A280 Short-chain reductase family member (5D234); parra 98.18
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 98.17
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 98.16
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 98.15
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.15
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 98.14
3tsc_A277 Putative oxidoreductase; structural genomics, seat 98.13
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 98.12
1ooe_A236 Dihydropteridine reductase; structural genomics, P 98.12
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 98.12
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 98.12
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 98.11
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 98.1
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.09
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 98.08
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 98.06
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 98.05
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 98.05
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 98.05
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 98.03
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 98.03
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 98.02
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 98.01
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 98.01
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 98.0
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 97.99
3tjr_A301 Short chain dehydrogenase; structural genomics, se 97.99
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 97.98
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 97.94
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 97.93
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 97.92
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 97.92
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 97.87
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 97.87
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 97.86
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 97.85
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 97.85
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 97.85
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 97.84
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 97.83
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 97.78
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 97.77
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 97.76
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 97.76
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 97.75
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 97.74
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 97.65
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 97.64
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 97.64
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 97.63
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 97.61
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 97.6
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 97.55
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 97.53
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 97.49
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 97.49
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 97.49
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 97.39
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.35
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 97.31
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.26
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 97.26
3e03_A274 Short chain dehydrogenase; structural genomics, PS 97.1
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 97.07
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 97.07
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 97.06
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 97.05
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 97.01
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 97.0
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 96.98
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 96.94
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 96.87
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 96.76
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 96.57
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 96.56
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 96.52
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 96.45
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 96.44
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 94.64
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 93.09
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 93.02
3slk_A795 Polyketide synthase extender module 2; rossmann fo 90.29
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 88.47
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 85.54
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 80.13
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
Probab=99.98  E-value=5.8e-32  Score=257.91  Aligned_cols=221  Identities=18%  Similarity=0.126  Sum_probs=189.0

Q ss_pred             cchhhhHhhhhHHHHHHHHHHHcCCCeEEEecCCceecCCcccCCCCCCCCCCCCCCCCCcHHHHHHHHHHHHHHhCCCC
Q 016468            8 QFGRVDEVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYFPIDEHVDSYGRSKSVAEQLVLKSNGRP   87 (389)
Q Consensus         8 ~~~~~~~vNv~gt~nll~aa~~~gvkrlV~~SS~~vvyg~~~~~~~~E~~p~~p~~~~~~~Y~~SK~~aE~~l~~~~~~~   87 (389)
                      +++..+++|+.++.|++++|++.+++|+||+||.. +||.....+.+|+++..|    .+.|+.||..+|++++++..  
T Consensus        77 ~~~~~~~~n~~~~~~ll~a~~~~~~~r~v~~SS~~-vyg~~~~~~~~E~~~~~p----~~~Y~~sK~~~E~~~~~~~~--  149 (311)
T 3m2p_A           77 GKISEFHDNEILTQNLYDACYENNISNIVYASTIS-AYSDETSLPWNEKELPLP----DLMYGVSKLACEHIGNIYSR--  149 (311)
T ss_dssp             SCGGGTHHHHHHHHHHHHHHHHTTCCEEEEEEEGG-GCCCGGGCSBCTTSCCCC----SSHHHHHHHHHHHHHHHHHH--
T ss_pred             ChHHHHHHHHHHHHHHHHHHHHcCCCEEEEEccHH-HhCCCCCCCCCCCCCCCC----CchhHHHHHHHHHHHHHHHH--
Confidence            67888999999999999999999999999999988 799888888899998777    79999999999999999863  


Q ss_pred             CCCCCCCCceEEEEecCceecCCCC--CCHHHHHHHHHcCCCcceecCCCccccceeHHHHHHHHHHHHhcccCCCCCCC
Q 016468           88 FKKNNRKCLYTCAVRPAAIYGPGEE--RHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQK  165 (389)
Q Consensus        88 ~~~~~~~gl~~~ilRp~~IyGp~~~--~~~~~li~~~~~g~~~~~~g~~~~~~~~v~vdDla~a~~~a~~~l~~~~~~~~  165 (389)
                           +.+++++++||+.||||+..  ..++.++..+..|....++|++++.++|+|++|+|++++.+++          
T Consensus       150 -----~~g~~~~ilRp~~v~G~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~v~v~Dva~a~~~~~~----------  214 (311)
T 3m2p_A          150 -----KKGLCIKNLRFAHLYGFNEKNNYMINRFFRQAFHGEQLTLHANSVAKREFLYAKDAAKSVIYALK----------  214 (311)
T ss_dssp             -----HSCCEEEEEEECEEECSCC--CCHHHHHHHHHHTCCCEEESSBCCCCEEEEEHHHHHHHHHHHTT----------
T ss_pred             -----HcCCCEEEEeeCceeCcCCCCCCHHHHHHHHHHcCCCeEEecCCCeEEceEEHHHHHHHHHHHHh----------
Confidence                 26899999999999999887  5688899999999988888999999999999999999999986          


Q ss_pred             CCCCCCCceEEEeCCCCCChHHHHHHHHHhCCCCCCccccCHHHHHHHHHHHHHHHHHhhhccccccCCCCCCCHHHHHH
Q 016468          166 GRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVYK  245 (389)
Q Consensus       166 ~~~~~~g~~y~i~~~~~~s~~e~~~~l~~~lg~~~~~~~~p~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  245 (389)
                       .+. .+++||+++++++|+.|+++.+.+.+|.+.+....|.+                          .+        .
T Consensus       215 -~~~-~~~~~~i~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~--------------------------~~--------~  258 (311)
T 3m2p_A          215 -QEK-VSGTFNIGSGDALTNYEVANTINNAFGNKDNLLVKNPN--------------------------AN--------E  258 (311)
T ss_dssp             -CTT-CCEEEEECCSCEECHHHHHHHHHHHTTCTTCEEECSSS--------------------------BC--------C
T ss_pred             -cCC-CCCeEEeCCCCcccHHHHHHHHHHHhCCCCcceecCCC--------------------------CC--------C
Confidence             333 68899999999999999999999999987665443321                          00        0


Q ss_pred             hccccccchHHHHHhCCCCCCCChHHHHHHHHHHHHHcccC
Q 016468          246 VGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRK  286 (389)
Q Consensus       246 ~~~~~~~d~~ka~~~LG~~p~~sl~~~l~~~v~~~~~~~~~  286 (389)
                      ...+..+|++|++++|||+|+++++++|+++++||++.+..
T Consensus       259 ~~~~~~~d~~k~~~~lG~~p~~~~~~~l~~~~~~~~~~~~~  299 (311)
T 3m2p_A          259 GIHSSYMDSSKAKELLDFSTDYNFATAVEEIHLLMRGLDDV  299 (311)
T ss_dssp             SCCCBCBCCHHHHHHSCCCCSCCHHHHHHHHHHHHCC----
T ss_pred             CcCceecCHHHHHHHhCCCcccCHHHHHHHHHHHHHhcccC
Confidence            11245799999999999999999999999999999876553



>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 389
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 4e-19
d1r6da_322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 1e-17
d2b69a1312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 4e-16
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 5e-16
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 2e-10
d1e6ua_315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 2e-09
d1rpna_321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 6e-08
d2c5aa1363 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T 6e-07
d1sb8a_341 c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W 7e-07
d1oc2a_346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 4e-05
d1z45a2347 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-ep 2e-04
d1udca_338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 6e-04
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: GDP-mannose 4,6-dehydratase
species: Escherichia coli [TaxId: 562]
 Score = 85.6 bits (211), Expect = 4e-19
 Identities = 46/282 (16%), Positives = 92/282 (32%), Gaps = 38/282 (13%)

Query: 14  EVNINGTCHVIEACLEFGIQ---RLVYVSTYNVVFGGKEIVNGNESLPYFPIDEHVDSYG 70
           +V+  GT  ++EA    G++   R    ST + ++G  + +   E+ P++P       Y 
Sbjct: 103 DVDAMGTLRLLEAIRFLGLEKKTRFYQAST-SELYGLVQEIPQKETTPFYPRS----PYA 157

Query: 71  RSKSVAEQLVLKSNGRPFKKNNRKCLYTCAVRPAAIYGP-----GEERHLPRIVSLAKLG 125
            +K  A  + +              +Y C         P        R + R ++    G
Sbjct: 158 VAKLYAYWITVNYR-------ESYGMYACNGILFNHESPRRGETFVTRKITRAIANIAQG 210

Query: 126 L-VPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQKGRPIASGQPYFVSDGFPIN 184
           L     +G      DW +  + V    +                    + + ++ G   +
Sbjct: 211 LESCLYLGNMDSLRDWGHAKDYVKMQWMMLQQ-------------EQPEDFVIATGVQYS 257

Query: 185 TFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVY 244
             +F+      L   L      V     +  V       + P      +      PAEV 
Sbjct: 258 VRQFVEMAAAQLGIKLRFEGTGVEEKGIVVSVTGHDAPGVKPGDVIIAVDPRYFRPAEVE 317

Query: 245 KVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKRK 286
               T      KA ++L + P ++ RE ++  ++   +  +K
Sbjct: 318 ----TLLGDPTKAHEKLGWKPEITLREMVSEMVANDLEAAKK 355


>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 347 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query389
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 100.0
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.98
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.98
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.97
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.96
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.96
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.96
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.96
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.96
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.96
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.96
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.95
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.95
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.95
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.93
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.92
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.92
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.91
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.91
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.88
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.87
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.86
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 99.77
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.56
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.5
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.42
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.34
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.23
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.04
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 98.94
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 97.65
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 97.55
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 97.54
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 97.46
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 97.42
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 97.28
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 97.27
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 97.27
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 97.26
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 97.2
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 97.17
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 97.11
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 97.11
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 97.11
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 97.08
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 97.08
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 97.06
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 97.05
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 97.05
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 97.04
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 97.01
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 97.01
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 97.01
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 96.92
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 96.92
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 96.91
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 96.91
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 96.89
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 96.86
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 96.81
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 96.79
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 96.78
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 96.76
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 96.75
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 96.68
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 96.68
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 96.63
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 96.53
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 96.45
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 96.45
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 96.39
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 96.37
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 96.29
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 96.23
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 96.16
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 96.03
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 95.99
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 95.82
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 95.72
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 95.72
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 95.58
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 95.45
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 95.38
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 95.33
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 95.13
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 94.38
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 93.85
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 92.74
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 92.7
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 92.02
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 91.79
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 90.86
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 90.17
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 89.58
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 88.63
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: dTDP-glucose 4,6-dehydratase (RmlB)
species: Streptomyces venezuelae [TaxId: 54571]
Probab=100.00  E-value=2.4e-34  Score=273.77  Aligned_cols=221  Identities=23%  Similarity=0.320  Sum_probs=189.7

Q ss_pred             CcchhhhHhhhhHHHHHHHHHHHcCCCeEEEecCCceecCCcccCCCCCCCCCCCCCCCCCcHHHHHHHHHHHHHHhCCC
Q 016468            7 LQFGRVDEVNINGTCHVIEACLEFGIQRLVYVSTYNVVFGGKEIVNGNESLPYFPIDEHVDSYGRSKSVAEQLVLKSNGR   86 (389)
Q Consensus         7 ~~~~~~~~vNv~gt~nll~aa~~~gvkrlV~~SS~~vvyg~~~~~~~~E~~p~~p~~~~~~~Y~~SK~~aE~~l~~~~~~   86 (389)
                      .+++...++|+.||.|++++|++.+++++||+||.. +||.....+.+|++|..|    .+.||.||..+|+++..+.  
T Consensus        94 ~~~~~~~~~N~~gt~~ll~~~~~~~~~~~I~~Ss~~-~yg~~~~~~~~E~~~~~p----~~~Y~~sK~~~E~~~~~~~--  166 (322)
T d1r6da_          94 AGASVFTETNVQGTQTLLQCAVDAGVGRVVHVSTNQ-VYGSIDSGSWTESSPLEP----NSPYAASKAGSDLVARAYH--  166 (322)
T ss_dssp             HCCHHHHHHHTHHHHHHHHHHHHTTCCEEEEEEEGG-GGCCCSSSCBCTTSCCCC----CSHHHHHHHHHHHHHHHHH--
T ss_pred             cchHHHhhhhHHHHHHHHHHHHHcCCceEEEeecce-eecCCCCCCCCCCCCCCC----CCHHHHHHHHHHHHHHHHH--
Confidence            466778899999999999999999999999999998 799888888999999888    7899999999999999986  


Q ss_pred             CCCCCCCCCceEEEEecCceecCCCC--CCHHHHHHHHHcCCCcceecCCCccccceeHHHHHHHHHHHHhcccCCCCCC
Q 016468           87 PFKKNNRKCLYTCAVRPAAIYGPGEE--RHLPRIVSLAKLGLVPFKIGEPSVKTDWIYVDNLVLALILASMGLLDDIPGQ  164 (389)
Q Consensus        87 ~~~~~~~~gl~~~ilRp~~IyGp~~~--~~~~~li~~~~~g~~~~~~g~~~~~~~~v~vdDla~a~~~a~~~l~~~~~~~  164 (389)
                           ++.+++++++||++||||++.  +.++.++..+..|+++.++|+|++.+||+|++|+|+++..+++.        
T Consensus       167 -----~~~~~~~~~lR~~~vyGp~~~~~~~i~~~i~~~~~~~~i~v~~~g~~~r~~i~v~D~a~ai~~~~~~--------  233 (322)
T d1r6da_         167 -----RTYGLDVRITRCCNNYGPYQHPEKLIPLFVTNLLDGGTLPLYGDGANVREWVHTDDHCRGIALVLAG--------  233 (322)
T ss_dssp             -----HHHCCCEEEEEECEEECTTCCTTSHHHHHHHHHHTTCCEEEETTSCCEEEEEEHHHHHHHHHHHHHH--------
T ss_pred             -----HHhCCCEEEEEeeeEECcCCCcCcHHHHHHHHHHcCCCcEEecCCCeEEccEEHHHHHHHHHHHHhC--------
Confidence                 336899999999999999875  46789999999999888899999999999999999999999973        


Q ss_pred             CCCCCCCCceEEEeCCCCCChHHHHHHHHHhCCCCCCccccCHHHHHHHHHHHHHHHHHhhhccccccCCCCCCCHHHHH
Q 016468          165 KGRPIASGQPYFVSDGFPINTFEFIGPLLKTLDYDLPKSWLAVPHALFLGKVFSFFYSVLYPWLNRWWLPQPLILPAEVY  244 (389)
Q Consensus       165 ~~~~~~~g~~y~i~~~~~~s~~e~~~~l~~~lg~~~~~~~~p~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  244 (389)
                         + ..|++||+++++++++.|+++.+.+.+|.+.+......                          ..+.       
T Consensus       234 ---~-~~~~~~ni~~~~~~s~~e~~~~i~~~~~~~~~~~~~~~--------------------------~~~~-------  276 (322)
T d1r6da_         234 ---G-RAGEIYHIGGGLELTNRELTGILLDSLGADWSSVRKVA--------------------------DRKG-------  276 (322)
T ss_dssp             ---C-CTTCEEEECCCCEEEHHHHHHHHHHHHTCCGGGEEEEC--------------------------CCTT-------
T ss_pred             ---C-CCCCeeEEeecccchhHHHHHHHHHHhCCCccceeecC--------------------------CCCC-------
Confidence               2 24789999999999999999999999997754321100                          1110       


Q ss_pred             HhccccccchHHHHHhCCCCCCCChHHHHHHHHHHHHHccc
Q 016468          245 KVGVTHYFSLLKAKDELCYVPIVSPREGMAATISYWQDRKR  285 (389)
Q Consensus       245 ~~~~~~~~d~~ka~~~LG~~p~~sl~~~l~~~v~~~~~~~~  285 (389)
                       -.....+|++|++++|||+|+++++++|+++++||+++..
T Consensus       277 -~~~~~~~d~~k~~~~lg~~p~~~~eegI~~~i~w~~~n~~  316 (322)
T d1r6da_         277 -HDLRYSLDGGKIERELGYRPQVSFADGLARTVRWYRENRG  316 (322)
T ss_dssp             -CCCBCCBCCHHHHHHHCCCCCSCHHHHHHHHHHHHHHCHH
T ss_pred             -CCceeeeCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHhHH
Confidence             0122468999999999999999999999999999998543



>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure