Citrus Sinensis ID: 016529

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39
MELGVHISSSFGSLFPHYSTLTAYREIKFGFQGRSSSITCRSNEHQSLVLSEKEVQQQKLWSNQREMDLDDGDEMEFDDASSFLSLSEKPDRNMASPDDYEIEEFDYASHPNHKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILLVLNKKDLIKPGEIAKKLEWYEKFTDVDEVIPVSAKYGHGVEDIRDWILTKLPLGPAYYPKDIVSEHPERFFVGEIIREKIFMQYRNEVPYACQVNVVSYKTRPTAKDFIQVEIVVEKNSQKIILIGKGGKALKLLATAARLDIEDFLQKKVYLEVPT
ccccEEEEEccccccccccccccEEEccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccHHHHHHHHHccEEEEEcccccccccccEEEEEcccEEEEEEcccccccccccHHHHHHHHHHHHHcccccEEEEEEEccccccccHHHHHHHcccccccccEEEEEEccccccccHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEccccEEEEEEEEEEEEcccccEEEccccHHHHHHHHHHHHHHHHHccccEEEEccc
cccEEEEEccccccccccEEEEEEEEEcccEEEccccEEccccEcccHHHHHHHHHHHHHHHcccccccccHHHHHHcccHccccccccccccHHHHHHHHHHHcccccccccccEEEEEEccccccHHHHHHHHHcccEEEcccccccccccEEEEEEEccEEEEEEccccccHHHHHHHHHHHccccccccccEEEEEEEEEcccccccccHHHHHHHHHccccccEEEEEcHHHcccHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHcccEccccccccccccccHHHHHHHHHHHHHHHHccccccccEEEcEEEEEccccccEEEEEEEEEccHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccEEEEEcc
melgvhisssfgslfphystltayreikfgfqgrsssitcrsnehqslvlSEKEVQQQKLWSNqremdlddgdemefddassflslsekpdrnmaspddyeieefdyashpnhksgyvavlgkpnvgkstlaNQMIGQklsivtnkpqttrhrilgicsgpeyqmilydtPGIIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEegvgdhkdklpILLVLnkkdlikpgeiAKKLEWYekftdvdevipvsakyghgvedIRDWILtklplgpayypkdivsehperffvGEIIREKIFMQYRNEVPYACQVNvvsyktrptakdFIQVEIVVEKNSQKIILIGKGGKALKLLATAARLDIEDFLQkkvylevpt
MELGVhisssfgslfpHYSTLTAYREIKFGFQGRSSSITCRSNEHQSLVLSEKEVQQQKLWSNQREMDLDDGDEMEFDDASSflslsekpdrnMASPDDYEIEEFDYASHPNHKSGYVAVLGKPNVGKSTLANQMIGQKlsivtnkpqttrHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILeegvgdhkdklpillvlnkkdlikpgeiaKKLEWYEKFTDVDEVIPVSAKYGHGVEDIRDWILTKLPLGPAYYPKDIVSEHPERFFVGEIIREKIFMQYRNEVPYACQVNVVSYKTRPTAKDFIQVEIVVEKNSQKIILIGKGGKALKLLATAARLDIedflqkkvylevpt
MELGVHISSSFGSLFPHYSTLTAYREIKFGFQGRSSSITCRSNEHQSLVLSEKEVQQQKLWSNQRemdlddgdemefddASSFLSLSEKPDRNMASPDDYEIEEFDYASHPNHKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILLVLNKKDLIKPGEIAKKLEWYEKFTDVDEVIPVSAKYGHGVEDIRDWILTKLPLGPAYYPKDIVSEHPERFFVGEIIREKIFMQYRNEVPYACQVNVVSYKTRPTAKDFIQVEIVVEKNSQkiiligkggkalkllataaRLDIEDFLQKKVYLEVPT
******ISSSFGSLFPHYSTLTAYREIKFGFQG*********************************************************************************SGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILLVLNKKDLIKPGEIAKKLEWYEKFTDVDEVIPVSAKYGHGVEDIRDWILTKLPLGPAYYPKDIVSEHPERFFVGEIIREKIFMQYRNEVPYACQVNVVSYKTRPTAKDFIQVEIVVEKNSQKIILIGKGGKALKLLATAARLDIEDFLQKKVYL****
***GV**SSSFGSLFPHYST**********************************************************************************************SGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILLVLNKKDLIKPGEIAKKLEWYEKFTDVDEVIPVSAKYGHGVEDIRDWILTKLPLGPAYYPKDIVSEHPERFFVGEIIREKIFMQYRNEVPYACQVNVVSYKTRPTAKDFIQVEIVVEKNSQKIILIGKGGKALKLLATAARLDIEDFLQKKVYLEVPT
MELGVHISSSFGSLFPHYSTLTAYREIKFGFQGRSSSITCRSNEHQSLVLSEKEVQQQKLWSNQREMDLDDGDEMEFDDASSFLSLSEKPDRNMASPDDYEIEEFDYASHPNHKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILLVLNKKDLIKPGEIAKKLEWYEKFTDVDEVIPVSAKYGHGVEDIRDWILTKLPLGPAYYPKDIVSEHPERFFVGEIIREKIFMQYRNEVPYACQVNVVSYKTRPTAKDFIQVEIVVEKNSQKIILIGKGGKALKLLATAARLDIEDFLQKKVYLEVPT
*ELGVHISSSFGSLFPHYSTLTAYREIKFGFQGRSSSITCRSNEHQSLVLSEKEVQQQKLWSNQ********************SLSEKPDRNMASPDDYEIEEFDYASHPNHKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILLVLNKKDLIKPGEIAKKLEWYEKFTDVDEVIPVSAKYGHGVEDIRDWILTKLPLGPAYYPKDIVSEHPERFFVGEIIREKIFMQYRNEVPYACQVNVVSYKTRPTAKDFIQVEIVVEKNSQKIILIGKGGKALKLLATAARLDIEDFLQKKVYLEVPT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELGVHISSSFGSLFPHYSTLTAYREIKFGFQGRSSSITCRSNEHQSLVLSEKEVQQQKLWSNQREMDLDDGDEMEFDDASSFLSLSEKPDRNMASPDDYEIEEFDYASHPNHKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILLVLNKKDLIKPGEIAKKLEWYEKFTDVDEVIPVSAKYGHGVEDIRDWILTKLPLGPAYYPKDIVSEHPERFFVGEIIREKIFMQYRNEVPYACQVNVVSYKTRPTAKDFIQVEIVVEKNSQKIILIGKGGKALKLLATAARLDIEDFLQKKVYLEVPT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query388 2.2.26 [Sep-21-2011]
P64086299 GTPase Era OS=Staphylococ yes no 0.698 0.906 0.452 1e-57
A8Z4A6299 GTPase Era OS=Staphylococ yes no 0.698 0.906 0.452 1e-57
Q6G900299 GTPase Era OS=Staphylococ yes no 0.698 0.906 0.452 1e-57
Q6GGD3299 GTPase Era OS=Staphylococ yes no 0.698 0.906 0.452 1e-57
P64085299 GTPase Era OS=Staphylococ yes no 0.698 0.906 0.452 1e-57
P64084299 GTPase Era OS=Staphylococ yes no 0.698 0.906 0.452 1e-57
A6QHB0299 GTPase Era OS=Staphylococ yes no 0.698 0.906 0.452 1e-57
Q5HFJ3299 GTPase Era OS=Staphylococ yes no 0.698 0.906 0.452 1e-57
A5IT95299 GTPase Era OS=Staphylococ yes no 0.698 0.906 0.452 1e-57
Q2FGF6299 GTPase Era OS=Staphylococ N/A no 0.698 0.906 0.452 1e-57
>sp|P64086|ERA_STAAW GTPase Era OS=Staphylococcus aureus (strain MW2) GN=era PE=3 SV=1 Back     alignment and function desciption
 Score =  223 bits (569), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 175/274 (63%), Gaps = 3/274 (1%)

Query: 113 HKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTPG 172
           HKSG+V+++G+PNVGKST  N++IG K++I+++K QTTR++I G+ +  + Q+I  DTPG
Sbjct: 4   HKSGFVSIIGRPNVGKSTFVNRVIGHKIAIMSDKAQTTRNKIQGVMTRDDAQIIFIDTPG 63

Query: 173 IIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILLV 232
           I + K H L   MMK  ++     D I+ +V+A +   R DE + E + + K   P+ LV
Sbjct: 64  IHKPK-HKLGDYMMKVAKNTLSEIDAIMFMVNANEEIGRGDEYIIEMLKNVK--TPVFLV 120

Query: 233 LNKKDLIKPGEIAKKLEWYEKFTDVDEVIPVSAKYGHGVEDIRDWILTKLPLGPAYYPKD 292
           LNK DL+ P E+  K+E Y+ + D  E++P+SA  G  V+   D + T LP GP YYP D
Sbjct: 121 LNKIDLVHPDELMPKIEEYQSYMDFTEIVPISALEGLNVDHFIDVLKTYLPEGPKYYPDD 180

Query: 293 IVSEHPERFFVGEIIREKIFMQYRNEVPYACQVNVVSYKTRPTAKDFIQVEIVVEKNSQK 352
            +S+HPE+F VGEIIREKI      E+P+A  VNV         +  I+  I VE++SQK
Sbjct: 181 QISDHPEQFVVGEIIREKILHLTSEEIPHAIGVNVDRMVKESEDRVHIEATIYVERDSQK 240

Query: 353 IILIGKGGKALKLLATAARLDIEDFLQKKVYLEV 386
            I+IGKGGK LK +   AR DIE  L  KVYLE+
Sbjct: 241 GIVIGKGGKKLKEVGKRARRDIEMLLGSKVYLEL 274
An essential GTPase that binds both GDP and GTP, with rapid nucleotide exchange. Plays a role in 16S rRNA processing and 30S ribosomal subunit biogenesis and possibly also in cell cycle regulation and energy metabolism.
Staphylococcus aureus (strain MW2) (taxid: 196620)
>sp|A8Z4A6|ERA_STAAT GTPase Era OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=era PE=3 SV=1 Back     alignment and function description
>sp|Q6G900|ERA_STAAS GTPase Era OS=Staphylococcus aureus (strain MSSA476) GN=era PE=3 SV=1 Back     alignment and function description
>sp|Q6GGD3|ERA_STAAR GTPase Era OS=Staphylococcus aureus (strain MRSA252) GN=era PE=3 SV=1 Back     alignment and function description
>sp|P64085|ERA_STAAN GTPase Era OS=Staphylococcus aureus (strain N315) GN=era PE=1 SV=1 Back     alignment and function description
>sp|P64084|ERA_STAAM GTPase Era OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=era PE=1 SV=1 Back     alignment and function description
>sp|A6QHB0|ERA_STAAE GTPase Era OS=Staphylococcus aureus (strain Newman) GN=era PE=3 SV=1 Back     alignment and function description
>sp|Q5HFJ3|ERA_STAAC GTPase Era OS=Staphylococcus aureus (strain COL) GN=era PE=3 SV=1 Back     alignment and function description
>sp|A5IT95|ERA_STAA9 GTPase Era OS=Staphylococcus aureus (strain JH9) GN=era PE=3 SV=1 Back     alignment and function description
>sp|Q2FGF6|ERA_STAA3 GTPase Era OS=Staphylococcus aureus (strain USA300) GN=era PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query388
225430700435 PREDICTED: GTPase Era-like [Vitis vinife 0.786 0.701 0.901 1e-162
255561072443 GTP-binding protein era, putative [Ricin 0.963 0.844 0.745 1e-158
297735123320 unnamed protein product [Vitis vinifera] 0.755 0.915 0.901 1e-154
449457520433 PREDICTED: GTPase Era-like [Cucumis sati 0.796 0.713 0.834 1e-153
22328152427 GTP-binding protein Era [Arabidopsis tha 0.935 0.850 0.699 1e-152
224097032414 predicted protein [Populus trichocarpa] 0.783 0.734 0.836 1e-151
78499699429 hypothetical protein [Eutrema halophilum 0.935 0.846 0.691 1e-150
312190415426 GTP binding protein [Eutrema parvulum] 0.907 0.826 0.702 1e-148
297794363427 GTP binding protein [Arabidopsis lyrata 0.793 0.721 0.808 1e-148
356502167421 PREDICTED: GTPase Era-like [Glycine max] 0.783 0.722 0.805 1e-145
>gi|225430700|ref|XP_002264259.1| PREDICTED: GTPase Era-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/305 (90%), Positives = 294/305 (96%)

Query: 82  SFLSLSEKPDRNMASPDDYEIEEFDYASHPNHKSGYVAVLGKPNVGKSTLANQMIGQKLS 141
           +FLSLSEKPDRNMA  DDYE+EE D+AS+PNH+SGYVAVLGKPNVGKSTLANQMIGQKLS
Sbjct: 104 TFLSLSEKPDRNMALLDDYELEELDFASNPNHRSGYVAVLGKPNVGKSTLANQMIGQKLS 163

Query: 142 IVTNKPQTTRHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRSAGINADCIVV 201
           IVT+KPQTTRHRILGICSGPEYQMILYDTPG+IEKK+H LDSMMMKNVRSA INADC+VV
Sbjct: 164 IVTDKPQTTRHRILGICSGPEYQMILYDTPGVIEKKMHKLDSMMMKNVRSATINADCVVV 223

Query: 202 LVDACKAPERIDEILEEGVGDHKDKLPILLVLNKKDLIKPGEIAKKLEWYEKFTDVDEVI 261
           LVDACK P++IDE+LEEGVG+ KDKLP LLVLNKKDLIKPGEIAKKLEWYEKF DVDEVI
Sbjct: 224 LVDACKEPQKIDEVLEEGVGNLKDKLPTLLVLNKKDLIKPGEIAKKLEWYEKFIDVDEVI 283

Query: 262 PVSAKYGHGVEDIRDWILTKLPLGPAYYPKDIVSEHPERFFVGEIIREKIFMQYRNEVPY 321
           PVSAKYG GV+D++DWIL+KLPLGPAYYPKDIVSEHPERFFVGEI+REKIFMQYRNEVPY
Sbjct: 284 PVSAKYGQGVDDVKDWILSKLPLGPAYYPKDIVSEHPERFFVGEIVREKIFMQYRNEVPY 343

Query: 322 ACQVNVVSYKTRPTAKDFIQVEIVVEKNSQKIILIGKGGKALKLLATAARLDIEDFLQKK 381
           ACQVNVVSYKTRPTAKDFIQVEIVVEKNSQKIILIGK GKALKLLATAARLDIEDFLQKK
Sbjct: 344 ACQVNVVSYKTRPTAKDFIQVEIVVEKNSQKIILIGKEGKALKLLATAARLDIEDFLQKK 403

Query: 382 VYLEV 386
           V+LEV
Sbjct: 404 VFLEV 408

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255561072|ref|XP_002521548.1| GTP-binding protein era, putative [Ricinus communis] gi|223539226|gb|EEF40819.1| GTP-binding protein era, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297735123|emb|CBI17485.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449457520|ref|XP_004146496.1| PREDICTED: GTPase Era-like [Cucumis sativus] gi|449529894|ref|XP_004171933.1| PREDICTED: GTPase Era-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|22328152|ref|NP_201448.2| GTP-binding protein Era [Arabidopsis thaliana] gi|17473914|gb|AAL38371.1| GTP-binding protein-like [Arabidopsis thaliana] gi|20259794|gb|AAM13244.1| GTP-binding protein-like [Arabidopsis thaliana] gi|332010835|gb|AED98218.1| GTP-binding protein Era [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224097032|ref|XP_002310817.1| predicted protein [Populus trichocarpa] gi|222853720|gb|EEE91267.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|78499699|gb|ABB45853.1| hypothetical protein [Eutrema halophilum] Back     alignment and taxonomy information
>gi|312190415|gb|ADQ43214.1| GTP binding protein [Eutrema parvulum] Back     alignment and taxonomy information
>gi|297794363|ref|XP_002865066.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata] gi|297310901|gb|EFH41325.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356502167|ref|XP_003519892.1| PREDICTED: GTPase Era-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query388
TAIR|locus:2154915427 AT5G66470 [Arabidopsis thalian 0.788 0.716 0.754 1.8e-126
TIGR_CMR|BA_4524301 BA_4524 "GTP-binding protein E 0.698 0.900 0.375 1e-45
UNIPROTKB|Q74AX3299 era "GTPase Era" [Geobacter su 0.693 0.899 0.392 5.6e-45
TIGR_CMR|GSU_2226299 GSU_2226 "GTP-binding protein 0.693 0.899 0.392 5.6e-45
UNIPROTKB|P37214299 era "GTPase Era" [Streptococcu 0.693 0.899 0.355 8.4e-42
TIGR_CMR|CPS_4121305 CPS_4121 "GTP-binding protein 0.698 0.888 0.345 1.3e-38
TIGR_CMR|SPO_0691301 SPO_0691 "GTP-binding protein 0.693 0.893 0.323 1.5e-37
TIGR_CMR|CHY_0430298 CHY_0430 "GTP-binding protein 0.701 0.912 0.336 2.4e-37
UNIPROTKB|Q9KPB3325 era "GTPase Era" [Vibrio chole 0.703 0.84 0.335 1.7e-36
TIGR_CMR|VC_2460325 VC_2460 "GTP-binding protein E 0.703 0.84 0.335 1.7e-36
TAIR|locus:2154915 AT5G66470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1242 (442.3 bits), Expect = 1.8e-126, P = 1.8e-126
 Identities = 231/306 (75%), Positives = 263/306 (85%)

Query:    81 SSFLSLSEKPDRNMASPDDYEIEEFDYASHPNHKSGYVAVLGKPNVGKSTLANQMIGQKL 140
             +S LSLS KPDRNMA  DDYE+EE  +  + +H+SGYVAV+G PNVGKSTL+NQMIGQK+
Sbjct:    95 ASLLSLSMKPDRNMALLDDYEMEELGHTPNTHHRSGYVAVVGMPNVGKSTLSNQMIGQKI 154

Query:   141 SIVTNKPQTTRHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRSAGINADCIV 200
             SIVT+KPQTTRHRILGICS PEYQMILYDTPG+IEKK+H LD+MMMKNVR A INADC+V
Sbjct:   155 SIVTDKPQTTRHRILGICSSPEYQMILYDTPGVIEKKMHRLDTMMMKNVRDAAINADCVV 214

Query:   201 VLVDACKAPERIDEILEEGVGDHKDKLPILLVLNKKDLIKPGEIAKKLEWYEKFTDVDEV 260
             +LVDACK P  I+E+L+EG+GD + K P+LLV+NKKDLIKPGEIAKKLEWYEKFTDVDEV
Sbjct:   215 ILVDACKTPTNIEEVLKEGLGDLEKKPPMLLVMNKKDLIKPGEIAKKLEWYEKFTDVDEV 274

Query:   261 IPVSAKYGHGVEDIRDWILTKLPLGPAYYPKDIVSEHPERFFVGEIIREKIFMQYRNEVP 320
             IPVSAKYGHG+ED+++WIL+KLP GP YYPKDIVSEHPERFFV EI+REKIFMQYRNEVP
Sbjct:   275 IPVSAKYGHGIEDVKEWILSKLPFGPPYYPKDIVSEHPERFFVSEIVREKIFMQYRNEVP 334

Query:   321 YACQVNVVSYKTRPTAKDFIQVEIVVEKNSQXXXXXXXXXXXXXXXXXXXRLDIEDFLQK 380
             YACQVNV+SYKTRP AKDFIQVE+VV+KNSQ                   RLDIEDFLQK
Sbjct:   335 YACQVNVLSYKTRPAAKDFIQVEVVVDKNSQKIILIGKEGKALKTLATAARLDIEDFLQK 394

Query:   381 KVYLEV 386
             KV+LEV
Sbjct:   395 KVFLEV 400
GO:0003723 "RNA binding" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009793 "embryo development ending in seed dormancy" evidence=RCA
GO:0016226 "iron-sulfur cluster assembly" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0042793 "transcription from plastid promoter" evidence=RCA
GO:0045036 "protein targeting to chloroplast" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
TIGR_CMR|BA_4524 BA_4524 "GTP-binding protein Era" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q74AX3 era "GTPase Era" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2226 GSU_2226 "GTP-binding protein Era" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P37214 era "GTPase Era" [Streptococcus mutans UA159 (taxid:210007)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4121 CPS_4121 "GTP-binding protein Era" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0691 SPO_0691 "GTP-binding protein Era" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0430 CHY_0430 "GTP-binding protein Era" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KPB3 era "GTPase Era" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2460 VC_2460 "GTP-binding protein Era" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT5G66470
GTP binding / RNA binding; GTP binding / RNA binding; FUNCTIONS IN- RNA binding, GTP binding; LOCATED IN- chloroplast; EXPRESSED IN- 20 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- K Homology, type 2 (InterPro-IPR004044), K Homology, prokaryotic type (InterPro-IPR009019), Small GTP-binding protein (InterPro-IPR005225), GTP1/OBG (InterPro-IPR006073), GTP-binding protein Era (InterPro-IPR005662), GTP-binding protein, HSR1-related (InterPro-IPR002917), K homology-like, alpha/beta (InterPro-IPR015946); BEST Arabidopsis thaliana protein match is- GTP-bin [...] (427 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT5G08650
GTP-binding protein LepA, putative; GTP-binding protein LepA, putative; FUNCTIONS IN- GTP bindi [...] (681 aa)
• ••  • 0.935
RPL9
RPL9 (RIBOSOMAL PROTEIN L9); structural constituent of ribosome; Plastid ribosomal protein CL9 [...] (197 aa)
•  •  • 0.931
AT3G63490
ribosomal protein L1 family protein; ribosomal protein L1 family protein; FUNCTIONS IN- structu [...] (346 aa)
•  •  • 0.908
AT5G11480
GTP binding; GTP binding; FUNCTIONS IN- GTP binding; INVOLVED IN- biological_process unknown; L [...] (318 aa)
• ••  • 0.899
RPL3A
ribosomal protein L3 family protein; ribosomal protein L3 family protein; FUNCTIONS IN- structu [...] (271 aa)
   •  • 0.895
EDD1
EDD1 (EMBRYO-DEFECTIVE-DEVELOPMENT 1); glycine-tRNA ligase; glycine-tRNA ligase (1067 aa)
•  •    0.890
AT3G18680
aspartate/glutamate/uridylate kinase family protein; aspartate/glutamate/uridylate kinase famil [...] (339 aa)
•  •    0.889
AT5G55220
trigger factor type chaperone family protein; trigger factor type chaperone family protein; FUN [...] (547 aa)
   •    0.889
OVA1
OVA1 (OVULE ABORTION 1); ATP binding / aminoacyl-tRNA ligase/ methionine-tRNA ligase/ nucleotid [...] (616 aa)
•  •  • 0.884
CPSRP54
CPSRP54 (CHLOROPLAST SIGNAL RECOGNITION PARTICLE 54 KDA SUBUNIT); 7S RNA binding / GTP binding [...] (564 aa)
• ••  • 0.869

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
PRK00089292 PRK00089, era, GTPase Era; Reviewed 1e-116
COG1159298 COG1159, Era, GTPase [General function prediction 4e-94
cd04163168 cd04163, Era, E 3e-66
TIGR00436270 TIGR00436, era, GTP-binding protein Era 2e-65
PRK15494339 PRK15494, era, GTPase Era; Provisional 1e-39
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 6e-31
cd00880161 cd00880, Era_like, E 1e-29
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 3e-27
TIGR03594 429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 1e-26
cd01894157 cd01894, EngA1, EngA1 GTPase contains the first do 2e-26
COG1160 444 COG1160, COG1160, Predicted GTPases [General funct 7e-24
PRK00093 435 PRK00093, PRK00093, GTP-binding protein Der; Revie 8e-24
cd04164159 cd04164, trmE, trmE is a tRNA modification GTPase 1e-21
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 2e-20
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 3e-20
COG0486454 COG0486, ThdF, Predicted GTPase [General function 4e-20
cd01895174 cd01895, EngA2, EngA2 GTPase contains the second d 8e-19
TIGR03918 391 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster 2e-18
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Rev 3e-18
PRK09518 712 PRK09518, PRK09518, bifunctional cytidylate kinase 6e-18
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Revie 3e-17
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 3e-16
PRK03003 472 PRK03003, PRK03003, GTP-binding protein Der; Revie 3e-15
cd01898170 cd01898, Obg, Obg GTPase 4e-15
COG1160444 COG1160, COG1160, Predicted GTPases [General funct 7e-15
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [In 1e-13
pfam02421190 pfam02421, FeoB_N, Ferrous iron transport protein 4e-13
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas 1e-12
cd01879159 cd01879, FeoB, Ferrous iron transport protein B (F 2e-12
cd01878204 cd01878, HflX, HflX GTPase family 5e-12
TIGR02729329 TIGR02729, Obg_CgtA, Obg family GTPase CgtA 8e-12
COG2262411 COG2262, HflX, GTPases [General function predictio 1e-11
COG0218200 COG0218, COG0218, Predicted GTPase [General functi 2e-11
PRK00454196 PRK00454, engB, GTP-binding protein YsxC; Reviewed 3e-11
COG0536369 COG0536, Obg, Predicted GTPase [General function p 4e-11
cd11383140 cd11383, YfjP, YfjP GTPase 1e-10
cd01856171 cd01856, YlqF, Circularly permuted YlqF GTPase 1e-09
COG1161322 COG1161, COG1161, Predicted GTPases [General funct 2e-09
TIGR03598178 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-bi 2e-09
PRK12297424 PRK12297, obgE, GTPase CgtA; Reviewed 3e-09
TIGR00437 591 TIGR00437, feoB, ferrous iron transporter FeoB 4e-09
cd00881183 cd00881, GTP_translation_factor, GTP translation f 5e-09
cd01854211 cd01854, YjeQ_EngC, Ribosomal interacting GTPase Y 5e-09
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 7e-09
cd09912180 cd09912, DLP_2, Dynamin-like protein including dyn 1e-08
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi 2e-08
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 2e-08
COG1163365 COG1163, DRG, Predicted GTPase [General function p 3e-08
PRK12299335 PRK12299, obgE, GTPase CgtA; Reviewed 4e-08
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 5e-08
COG1084346 COG1084, COG1084, Predicted GTPase [General functi 6e-08
cd00878158 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf 6e-08
cd01897167 cd01897, NOG, Nucleolar GTP-binding protein (NOG) 9e-08
PRK12298390 PRK12298, obgE, GTPase CgtA; Reviewed 9e-08
PRK09518712 PRK09518, PRK09518, bifunctional cytidylate kinase 2e-07
PRK04213201 PRK04213, PRK04213, GTP-binding protein; Provision 5e-07
pfam0765077 pfam07650, KH_2, KH domain 5e-07
cd01896233 cd01896, DRG, Developmentally Regulated GTP-bindin 1e-06
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 2e-06
COG1161322 COG1161, COG1161, Predicted GTPases [General funct 4e-06
cd01856171 cd01856, YlqF, Circularly permuted YlqF GTPase 6e-06
PRK03003472 PRK03003, PRK03003, GTP-binding protein Der; Revie 8e-06
cd01881167 cd01881, Obg_like, Obg-like family of GTPases cons 8e-06
PRK13796365 PRK13796, PRK13796, GTPase YqeH; Provisional 4e-05
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi 5e-05
cd01890179 cd01890, LepA, LepA also known as Elongation Facto 5e-05
pfam00025174 pfam00025, Arf, ADP-ribosylation factor family 1e-04
cd01855191 cd01855, YqeH, Circularly permuted YqeH GTPase 1e-04
cd04142198 cd04142, RRP22, Ras-related protein on chromosome 1e-04
cd04137180 cd04137, RheB, Ras Homolog Enriched in Brain (RheB 2e-04
cd04155174 cd04155, Arl3, Arf-like 3 (Arl3) GTPase 2e-04
COG2229187 COG2229, COG2229, Predicted GTPase [General functi 2e-04
TIGR03597360 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase 4e-04
pfam03029235 pfam03029, ATP_bind_1, Conserved hypothetical ATP 5e-04
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 0.001
cd01859157 cd01859, MJ1464, An uncharacterized, circularly pe 0.001
COG3596296 COG3596, COG3596, Predicted GTPase [General functi 0.001
cd01857140 cd01857, HSR1_MMR1, A circularly permuted subfamil 0.002
cd01855191 cd01855, YqeH, Circularly permuted YqeH GTPase 0.003
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information 
 Score =  340 bits (874), Expect = e-116
 Identities = 124/277 (44%), Positives = 174/277 (62%), Gaps = 6/277 (2%)

Query: 111 PNHKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDT 170
              KSG+VA++G+PNVGKSTL N ++GQK+SIV+ KPQTTRHRI GI +  + Q+I  DT
Sbjct: 1   MGFKSGFVAIVGRPNVGKSTLLNALVGQKISIVSPKPQTTRHRIRGIVTEDDAQIIFVDT 60

Query: 171 PGIIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPIL 230
           PGI + K   L+  M K   S+  + D ++ +VDA +     DE + E +   K K P++
Sbjct: 61  PGIHKPK-RALNRAMNKAAWSSLKDVDLVLFVVDADEKIGPGDEFILEKLK--KVKTPVI 117

Query: 231 LVLNKKDLIKP-GEIAKKLEWYEKFTDVDEVIPVSAKYGHGVEDIRDWILTKLPLGPAYY 289
           LVLNK DL+K   E+   LE   +  D  E++P+SA  G  V+++ D I   LP GP YY
Sbjct: 118 LVLNKIDLVKDKEELLPLLEELSELMDFAEIVPISALKGDNVDELLDVIAKYLPEGPPYY 177

Query: 290 PKDIVSEHPERFFVGEIIREKIFMQYRNEVPYACQVNVVSYKTRPTAKDFIQVEIVVEKN 349
           P+D +++ PERF   EIIREK+     +E+PY+  V +  ++ R      I+  I VE++
Sbjct: 178 PEDQITDRPERFLAAEIIREKLLRLLGDELPYSVAVEIEKFEERG--LVRIEATIYVERD 235

Query: 350 SQKIILIGKGGKALKLLATAARLDIEDFLQKKVYLEV 386
           SQK I+IGKGG  LK + T AR DIE  L KKV+LE+
Sbjct: 236 SQKGIIIGKGGAMLKKIGTEARKDIEKLLGKKVFLEL 272

Length = 292
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|185391 PRK15494, era, GTPase Era; Provisional Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA Back     alignment and domain information
>gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF Back     alignment and domain information
>gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|236546 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|206685 cd01898, Obg, Obg GTPase Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family Back     alignment and domain information
>gnl|CDD|206666 cd01878, HflX, HflX GTPase family Back     alignment and domain information
>gnl|CDD|233986 TIGR02729, Obg_CgtA, Obg family GTPase CgtA Back     alignment and domain information
>gnl|CDD|225171 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223296 COG0218, COG0218, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234770 PRK00454, engB, GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>gnl|CDD|223610 COG0536, Obg, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206743 cd11383, YfjP, YfjP GTPase Back     alignment and domain information
>gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase Back     alignment and domain information
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|213835 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>gnl|CDD|237046 PRK12297, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|232975 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|206747 cd01854, YjeQ_EngC, Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|234125 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins Back     alignment and domain information
>gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|224085 COG1163, DRG, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237048 PRK12299, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|224009 COG1084, COG1084, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases Back     alignment and domain information
>gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) Back     alignment and domain information
>gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|236546 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|203707 pfam07650, KH_2, KH domain Back     alignment and domain information
>gnl|CDD|206683 cd01896, DRG, Developmentally Regulated GTP-binding protein (DRG) Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|206668 cd01881, Obg_like, Obg-like family of GTPases consist of five subfamilies: Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|237511 PRK13796, PRK13796, GTPase YqeH; Provisional Back     alignment and domain information
>gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|206677 cd01890, LepA, LepA also known as Elongation Factor 4 (EF4) Back     alignment and domain information
>gnl|CDD|200938 pfam00025, Arf, ADP-ribosylation factor family Back     alignment and domain information
>gnl|CDD|206748 cd01855, YqeH, Circularly permuted YqeH GTPase Back     alignment and domain information
>gnl|CDD|133342 cd04142, RRP22, Ras-related protein on chromosome 22 (RRP22) family Back     alignment and domain information
>gnl|CDD|206709 cd04137, RheB, Ras Homolog Enriched in Brain (RheB) is a small GTPase Back     alignment and domain information
>gnl|CDD|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase Back     alignment and domain information
>gnl|CDD|225138 COG2229, COG2229, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213834 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase YqeH Back     alignment and domain information
>gnl|CDD|217326 pfam03029, ATP_bind_1, Conserved hypothetical ATP binding protein Back     alignment and domain information
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206752 cd01859, MJ1464, An uncharacterized, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|226124 COG3596, COG3596, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206748 cd01855, YqeH, Circularly permuted YqeH GTPase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 388
COG1159298 Era GTPase [General function prediction only] 100.0
TIGR00436270 era GTP-binding protein Era. Era is an essential G 100.0
PRK15494339 era GTPase Era; Provisional 100.0
PRK00089292 era GTPase Era; Reviewed 100.0
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 100.0
COG1160 444 Predicted GTPases [General function prediction onl 100.0
PRK12298390 obgE GTPase CgtA; Reviewed 99.95
COG0486454 ThdF Predicted GTPase [General function prediction 99.94
PRK03003 472 GTP-binding protein Der; Reviewed 99.94
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.93
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.92
PRK00093 435 GTP-binding protein Der; Reviewed 99.92
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.92
COG1160444 Predicted GTPases [General function prediction onl 99.91
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.9
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.9
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 99.9
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.9
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.9
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.9
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.89
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.89
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.88
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.88
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.88
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.88
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.88
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.88
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.88
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.88
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.88
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.88
PRK03003472 GTP-binding protein Der; Reviewed 99.88
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.88
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.88
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.87
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.87
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.87
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.87
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.87
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.87
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.87
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.87
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.87
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.87
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.87
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 99.87
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.87
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.87
PRK00093435 GTP-binding protein Der; Reviewed 99.87
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.87
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.87
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.87
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.87
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.87
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.87
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.87
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.87
PLN03118211 Rab family protein; Provisional 99.87
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.87
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.87
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.87
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.87
PRK12299335 obgE GTPase CgtA; Reviewed 99.87
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.86
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.86
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.86
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.86
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.86
PRK04213201 GTP-binding protein; Provisional 99.86
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.86
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.86
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.86
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.86
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.86
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.86
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.86
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.86
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.86
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 99.86
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.86
PLN00223181 ADP-ribosylation factor; Provisional 99.86
cd00881189 GTP_translation_factor GTP translation factor fami 99.86
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.86
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.86
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.86
PTZ00369189 Ras-like protein; Provisional 99.86
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.86
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.86
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.86
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.86
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.86
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.86
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.86
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.86
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.86
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.85
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.85
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.85
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.85
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.85
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.85
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.85
COG0218200 Predicted GTPase [General function prediction only 99.85
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.85
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.85
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.85
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.85
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.85
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.85
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.85
PRK11058426 GTPase HflX; Provisional 99.85
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.85
PRK12296500 obgE GTPase CgtA; Reviewed 99.85
PTZ00133182 ADP-ribosylation factor; Provisional 99.85
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.85
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.85
KOG0394210 consensus Ras-related GTPase [General function pre 99.85
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.85
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.84
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.84
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.84
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.84
PRK12297424 obgE GTPase CgtA; Reviewed 99.84
PRK05306 787 infB translation initiation factor IF-2; Validated 99.84
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.84
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.84
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.84
PLN03110216 Rab GTPase; Provisional 99.84
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.84
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.84
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.84
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.84
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.83
CHL00189 742 infB translation initiation factor 2; Provisional 99.83
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.83
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.83
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.83
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.83
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.83
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.83
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 99.83
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.83
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.83
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.83
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.83
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.83
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.83
COG1084346 Predicted GTPase [General function prediction only 99.83
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.82
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.82
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.82
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.82
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.82
KOG0078207 consensus GTP-binding protein SEC4, small G protei 99.82
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.82
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.82
PLN03108210 Rab family protein; Provisional 99.82
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.82
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.82
KOG0098216 consensus GTPase Rab2, small G protein superfamily 99.82
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.81
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.81
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.81
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.81
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.81
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.81
PRK09602396 translation-associated GTPase; Reviewed 99.81
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.81
KOG0080209 consensus GTPase Rab18, small G protein superfamil 99.8
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.8
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.8
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.8
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.8
cd01896233 DRG The developmentally regulated GTP-binding prot 99.79
PRK10218 607 GTP-binding protein; Provisional 99.79
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.79
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.79
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.79
PRK05433 600 GTP-binding protein LepA; Provisional 99.78
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.78
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.78
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.78
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 99.78
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.78
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.78
KOG1145 683 consensus Mitochondrial translation initiation fac 99.78
PRK12317 425 elongation factor 1-alpha; Reviewed 99.77
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.77
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.77
COG2262411 HflX GTPases [General function prediction only] 99.77
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.77
TIGR00503 527 prfC peptide chain release factor 3. This translat 99.77
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.76
PRK12739 691 elongation factor G; Reviewed 99.76
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.76
PRK12736 394 elongation factor Tu; Reviewed 99.76
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.76
KOG0079198 consensus GTP-binding protein H-ray, small G prote 99.76
PRK04004 586 translation initiation factor IF-2; Validated 99.76
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.75
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 99.75
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.75
PRK00007 693 elongation factor G; Reviewed 99.75
KOG1489366 consensus Predicted GTP-binding protein (ODN super 99.74
CHL00071409 tufA elongation factor Tu 99.74
KOG0086214 consensus GTPase Rab4, small G protein superfamily 99.74
COG1163365 DRG Predicted GTPase [General function prediction 99.74
KOG0462 650 consensus Elongation factor-type GTP-binding prote 99.74
KOG0093193 consensus GTPase Rab3, small G protein superfamily 99.74
PRK12735396 elongation factor Tu; Reviewed 99.74
PLN03127 447 Elongation factor Tu; Provisional 99.74
KOG0095213 consensus GTPase Rab30, small G protein superfamil 99.73
PRK13351 687 elongation factor G; Reviewed 99.73
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.73
PRK09866 741 hypothetical protein; Provisional 99.73
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.73
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.72
TIGR00485 394 EF-Tu translation elongation factor TU. This align 99.72
PRK00049 396 elongation factor Tu; Reviewed 99.72
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.72
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 99.72
KOG0088218 consensus GTPase Rab21, small G protein superfamil 99.71
KOG0091213 consensus GTPase Rab39, small G protein superfamil 99.71
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 99.71
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 99.7
PRK04000 411 translation initiation factor IF-2 subunit gamma; 99.69
PLN03126478 Elongation factor Tu; Provisional 99.69
KOG0395196 consensus Ras-related GTPase [General function pre 99.69
COG0536369 Obg Predicted GTPase [General function prediction 99.68
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 99.67
cd04105203 SR_beta Signal recognition particle receptor, beta 99.67
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.67
COG3596296 Predicted GTPase [General function prediction only 99.67
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.67
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.66
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 99.66
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 99.65
PRK12740 668 elongation factor G; Reviewed 99.65
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.65
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.64
PRK09435332 membrane ATPase/protein kinase; Provisional 99.64
PTZ00141 446 elongation factor 1- alpha; Provisional 99.63
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.63
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 99.62
KOG0097215 consensus GTPase Rab14, small G protein superfamil 99.62
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 99.62
COG2229187 Predicted GTPase [General function prediction only 99.62
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 99.6
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 99.6
PTZ00099176 rab6; Provisional 99.6
COG1100219 GTPase SAR1 and related small G proteins [General 99.6
PLN00023334 GTP-binding protein; Provisional 99.59
COG1217 603 TypA Predicted membrane GTPase involved in stress 99.58
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 99.58
KOG1490 620 consensus GTP-binding protein CRFG/NOG1 (ODN super 99.58
KOG0081219 consensus GTPase Rab27, small G protein superfamil 99.58
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.57
PLN00043 447 elongation factor 1-alpha; Provisional 99.56
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 99.54
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 99.53
PRK07560 731 elongation factor EF-2; Reviewed 99.52
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.51
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.51
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.51
PTZ00258390 GTP-binding protein; Provisional 99.5
PRK14845 1049 translation initiation factor IF-2; Provisional 99.5
PRK13768253 GTPase; Provisional 99.5
COG4917148 EutP Ethanolamine utilization protein [Amino acid 99.48
KOG1707 625 consensus Predicted Ras related/Rac-GTP binding pr 99.48
KOG3883198 consensus Ras family small GTPase [Signal transduc 99.48
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.47
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 99.47
KOG1424562 consensus Predicted GTP-binding protein MMR1 [Gene 99.46
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 99.46
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.44
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 99.44
PRK09601364 GTP-binding protein YchF; Reviewed 99.42
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 99.41
KOG0090238 consensus Signal recognition particle receptor, be 99.39
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 99.39
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 99.39
COG3276 447 SelB Selenocysteine-specific translation elongatio 99.38
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 99.38
KOG4252246 consensus GTP-binding protein [Signal transduction 99.37
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.35
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.33
PTZ00416 836 elongation factor 2; Provisional 99.32
PLN00116 843 translation elongation factor EF-2 subunit; Provis 99.32
KOG0461 522 consensus Selenocysteine-specific elongation facto 99.32
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 99.32
KOG0410410 consensus Predicted GTP binding protein [General f 99.31
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.31
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 99.31
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 99.3
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 99.29
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 99.29
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 99.28
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 99.27
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 99.26
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 99.26
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 99.25
COG0050394 TufB GTPases - translation elongation factors [Tra 99.25
KOG1673205 consensus Ras GTPases [General function prediction 99.25
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 99.25
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 99.24
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 99.24
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 99.24
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 99.23
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 99.21
KOG0465 721 consensus Mitochondrial elongation factor [Transla 99.21
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 99.2
KOG0458 603 consensus Elongation factor 1 alpha [Translation, 99.19
COG0012372 Predicted GTPase, probable translation factor [Tra 99.19
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 99.18
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 99.18
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 99.17
KOG2486320 consensus Predicted GTPase [General function predi 99.17
KOG4423229 consensus GTP-binding protein-like, RAS superfamil 99.16
PRK09563287 rbgA GTPase YlqF; Reviewed 99.16
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 99.15
TIGR00101199 ureG urease accessory protein UreG. This model rep 99.14
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 99.13
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 99.12
PRK12289352 GTPase RsgA; Reviewed 99.11
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 99.1
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.09
KOG1487358 consensus GTP-binding protein DRG1 (ODN superfamil 99.01
PRK13796 365 GTPase YqeH; Provisional 98.99
KOG1954 532 consensus Endocytosis/signaling protein EHD1 [Sign 98.98
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.96
KOG0468 971 consensus U5 snRNP-specific protein [Translation, 98.94
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.94
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.94
COG5258527 GTPBP1 GTPase [General function prediction only] 98.92
PRK12288347 GTPase RsgA; Reviewed 98.91
PRK00098298 GTPase RsgA; Reviewed 98.9
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.87
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.85
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 98.84
COG5019373 CDC3 Septin family protein [Cell division and chro 98.83
KOG1143591 consensus Predicted translation elongation factor 98.82
KOG0467 887 consensus Translation elongation factor 2/ribosome 98.8
COG1161322 Predicted GTPases [General function prediction onl 98.8
KOG0460449 consensus Mitochondrial translation elongation fac 98.8
KOG0466 466 consensus Translation initiation factor 2, gamma s 98.77
KOG2655366 consensus Septin family protein (P-loop GTPase) [C 98.76
KOG1491391 consensus Predicted GTP-binding protein (ODN super 98.75
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 98.75
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.75
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.73
PRK09563287 rbgA GTPase YlqF; Reviewed 98.72
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.71
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.7
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 98.7
KOG0464 753 consensus Elongation factor G [Translation, riboso 98.68
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 98.67
KOG3886295 consensus GTP-binding protein [Signal transduction 98.6
COG1161 322 Predicted GTPases [General function prediction onl 98.59
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 98.53
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.53
PRK12289352 GTPase RsgA; Reviewed 98.52
PRK12288347 GTPase RsgA; Reviewed 98.51
KOG0448 749 consensus Mitofusin 1 GTPase, involved in mitochon 98.5
KOG0463 641 consensus GTP-binding protein GP-1 [General functi 98.49
PRK10416318 signal recognition particle-docking protein FtsY; 98.48
cd03112158 CobW_like The function of this protein family is u 98.46
KOG1424 562 consensus Predicted GTP-binding protein MMR1 [Gene 98.44
PRK13796365 GTPase YqeH; Provisional 98.43
KOG3905473 consensus Dynein light intermediate chain [Cell mo 98.41
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 98.4
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 98.38
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 98.35
TIGR00064272 ftsY signal recognition particle-docking protein F 98.35
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 98.34
COG1162301 Predicted GTPases [General function prediction onl 98.28
COG1162301 Predicted GTPases [General function prediction onl 98.28
PRK14974336 cell division protein FtsY; Provisional 98.23
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 98.23
COG0523323 Putative GTPases (G3E family) [General function pr 98.22
PF05783 472 DLIC: Dynein light intermediate chain (DLIC); Inte 98.22
PRK00098298 GTPase RsgA; Reviewed 98.19
KOG2423572 consensus Nucleolar GTPase [General function predi 98.19
KOG2484435 consensus GTPase [General function prediction only 98.15
KOG0459 501 consensus Polypeptide release factor 3 [Translatio 98.12
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.12
PRK01889356 GTPase RsgA; Reviewed 98.11
KOG2484435 consensus GTPase [General function prediction only 98.11
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 98.08
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 98.03
KOG0447 980 consensus Dynamin-like GTP binding protein [Genera 98.03
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 97.99
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.97
KOG2423 572 consensus Nucleolar GTPase [General function predi 97.97
TIGR02475341 CobW cobalamin biosynthesis protein CobW. A broade 97.95
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.94
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.92
KOG1534273 consensus Putative transcription factor FET5 [Tran 97.91
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 97.88
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 97.85
PRK11537318 putative GTP-binding protein YjiA; Provisional 97.85
KOG3859406 consensus Septins (P-loop GTPases) [Cell cycle con 97.85
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.83
cd03114148 ArgK-like The function of this protein family is u 97.83
cd03115173 SRP The signal recognition particle (SRP) mediates 97.81
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.78
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.76
PF0765078 KH_2: KH domain syndrome, contains KH motifs.; Int 97.75
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.75
KOG2743391 consensus Cobalamin synthesis protein [Coenzyme tr 97.73
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.71
KOG2485 335 consensus Conserved ATP/GTP binding protein [Gener 97.69
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 97.68
KOG3887347 consensus Predicted small GTPase involved in nucle 97.68
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.67
KOG0469 842 consensus Elongation factor 2 [Translation, riboso 97.66
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 97.65
PRK00771437 signal recognition particle protein Srp54; Provisi 97.63
PRK10867433 signal recognition particle protein; Provisional 97.62
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.6
PRK13695174 putative NTPase; Provisional 97.6
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 97.6
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.58
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.51
TIGR00959428 ffh signal recognition particle protein. This mode 97.46
cd03110179 Fer4_NifH_child This protein family's function is 97.4
KOG1533290 consensus Predicted GTPase [General function predi 97.29
cd03111106 CpaE_like This protein family consists of proteins 97.27
KOG0705 749 consensus GTPase-activating protein Centaurin gamm 97.23
COG3523 1188 IcmF Type VI protein secretion system component Va 97.22
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 97.22
cd02036179 MinD Bacterial cell division requires the formatio 97.18
PF09547 492 Spore_IV_A: Stage IV sporulation protein A (spore_ 97.15
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 97.13
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 97.11
KOG0780483 consensus Signal recognition particle, subunit Srp 97.04
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 97.04
COG0552340 FtsY Signal recognition particle GTPase [Intracell 97.04
PRK01889356 GTPase RsgA; Reviewed 97.04
PF00004132 AAA: ATPase family associated with various cellula 96.67
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.65
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 96.62
KOG0446 657 consensus Vacuolar sorting protein VPS1, dynamin, 96.58
KOG0082354 consensus G-protein alpha subunit (small G protein 96.56
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.49
PRK14737186 gmk guanylate kinase; Provisional 96.48
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 96.43
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 96.41
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 96.38
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.36
PF1355562 AAA_29: P-loop containing region of AAA domain 96.35
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 96.28
COG1341398 Predicted GTPase or GTP-binding protein [General f 96.26
PRK14738206 gmk guanylate kinase; Provisional 96.26
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 96.19
cd02032267 Bchl_like This family of proteins contains bchL an 96.12
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.11
PF00005137 ABC_tran: ABC transporter This structure is on hol 96.11
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 96.1
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 96.04
COG1136226 SalX ABC-type antimicrobial peptide transport syst 96.03
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 96.02
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 96.02
KOG1191 531 consensus Mitochondrial GTPase [Translation, ribos 95.9
PRK04195 482 replication factor C large subunit; Provisional 95.87
PRK07261171 topology modulation protein; Provisional 95.81
PF05729166 NACHT: NACHT domain 95.81
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.79
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.78
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 95.73
PRK08118167 topology modulation protein; Reviewed 95.72
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 95.69
PHA02518211 ParA-like protein; Provisional 95.69
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 95.69
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 95.69
COG1126240 GlnQ ABC-type polar amino acid transport system, A 95.68
KOG2203 772 consensus GTP-binding protein [General function pr 95.63
PRK13849231 putative crown gall tumor protein VirC1; Provision 95.63
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 95.58
PF02263260 GBP: Guanylate-binding protein, N-terminal domain; 95.56
PRK08181269 transposase; Validated 95.54
smart00382148 AAA ATPases associated with a variety of cellular 95.53
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.52
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 95.49
PRK00300205 gmk guanylate kinase; Provisional 95.47
PRK08233182 hypothetical protein; Provisional 95.44
TIGR00235207 udk uridine kinase. Model contains a number of lon 95.41
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 95.39
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 95.39
PRK05480209 uridine/cytidine kinase; Provisional 95.38
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 95.38
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 95.38
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 95.36
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 95.36
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 95.36
PRK14530215 adenylate kinase; Provisional 95.34
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 95.33
PF05879 742 RHD3: Root hair defective 3 GTP-binding protein (R 95.32
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 95.29
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 95.28
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=9.2e-59  Score=416.95  Aligned_cols=274  Identities=44%  Similarity=0.669  Sum_probs=259.3

Q ss_pred             CCCccEEEEEeCCCCChhHHHHHHhCCceeeecCCCCceEEeEEEEEeCCCeeEEEEeCCCCcchhhhhhhHHHHHhHHh
Q 016529          112 NHKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRS  191 (388)
Q Consensus       112 ~~~~~~v~ivG~~~~GKSSLln~l~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~liDtpG~~~~~~~~~~~~~~~~~~~  191 (388)
                      .++++.|+|+|.||||||||+|+|+|.+.+++++.++||+..+.+++..++.+++|+||||++. +.+.+...+++.+..
T Consensus         3 ~~ksGfVaIiGrPNvGKSTLlN~l~G~KisIvS~k~QTTR~~I~GI~t~~~~QiIfvDTPGih~-pk~~l~~~m~~~a~~   81 (298)
T COG1159           3 KFKSGFVAIIGRPNVGKSTLLNALVGQKISIVSPKPQTTRNRIRGIVTTDNAQIIFVDTPGIHK-PKHALGELMNKAARS   81 (298)
T ss_pred             CceEEEEEEEcCCCCcHHHHHHHHhcCceEeecCCcchhhhheeEEEEcCCceEEEEeCCCCCC-cchHHHHHHHHHHHH
Confidence            4588899999999999999999999999999999999999999999999999999999999954 578889999999999


Q ss_pred             hhccccEEEEEEeCCCCCchHHHHHHHhcccCCCCCCEEEEEeCCCCCChhh-HhHHHHHhhhcCCCceEEEecCCCCCC
Q 016529          192 AGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILLVLNKKDLIKPGE-IAKKLEWYEKFTDVDEVIPVSAKYGHG  270 (388)
Q Consensus       192 ~~~~ad~ii~VvD~~~~~~~~~~~l~~~~~~~~~~~piilV~NK~Dl~~~~~-~~~~~~~~~~~~~~~~v~~vSA~~g~g  270 (388)
                      .+.++|+++||+|+.++....++++.+.++.  .+.|+++++||+|+..+.. +....+.+.....+..++++||++|.|
T Consensus        82 sl~dvDlilfvvd~~~~~~~~d~~il~~lk~--~~~pvil~iNKID~~~~~~~l~~~~~~~~~~~~f~~ivpiSA~~g~n  159 (298)
T COG1159          82 ALKDVDLILFVVDADEGWGPGDEFILEQLKK--TKTPVILVVNKIDKVKPKTVLLKLIAFLKKLLPFKEIVPISALKGDN  159 (298)
T ss_pred             HhccCcEEEEEEeccccCCccHHHHHHHHhh--cCCCeEEEEEccccCCcHHHHHHHHHHHHhhCCcceEEEeeccccCC
Confidence            9999999999999999888888888888876  6789999999999988776 567777777778888999999999999


Q ss_pred             HHHHHHHHHHhCCCCCCCCCCCccCCcchHHHHHHHHHHHHHhhcCCCCCceeEEEEEEEEecCCceEEEEEEEEEeeCC
Q 016529          271 VEDIRDWILTKLPLGPAYYPKDIVSEHPERFFVGEIIREKIFMQYRNEVPYACQVNVVSYKTRPTAKDFIQVEIVVEKNS  350 (388)
Q Consensus       271 i~eL~~~i~~~l~~~~~~~~~~~~~~~~~~~~~~eiire~i~~~~~~~vp~s~~v~~~~~~~~~~~~~~i~~~~~~e~~~  350 (388)
                      ++.|.+.+..+++++|++||.+++|+++.+++++|++||+++..+++|+||++.+.+..++.++++..+|.+.++|+|+|
T Consensus       160 ~~~L~~~i~~~Lpeg~~~yp~d~itD~~~rf~~aEiiREk~~~~l~eElPhsv~VeIe~~~~~~~~~~~I~a~I~Ver~s  239 (298)
T COG1159         160 VDTLLEIIKEYLPEGPWYYPEDQITDRPERFLAAEIIREKLLLLLREELPHSVAVEIEEFEEREKGLLKIHATIYVERES  239 (298)
T ss_pred             HHHHHHHHHHhCCCCCCcCChhhccCChHHHHHHHHHHHHHHHhcccccCceEEEEEEEEEecCCCeEEEEEEEEEecCC
Confidence            99999999999999999999999999999999999999999999999999999999999999877899999999999999


Q ss_pred             eeeEEEecCChhHHHHHHHHHHHHHHhcCCceEEEecC
Q 016529          351 QKIILIGKGGKALKLLATAARLDIEDFLQKKVYLEVPT  388 (388)
Q Consensus       351 q~~~vig~~g~~i~~i~~~~~~~l~~~~~~~v~l~l~~  388 (388)
                      |+.|+||++|++||+|+..||++||++|+++|||+||.
T Consensus       240 QK~IiIGk~G~~iK~IG~~AR~~ie~l~~~kV~L~L~V  277 (298)
T COG1159         240 QKGIIIGKNGAMIKKIGTAARKDIEKLLGCKVYLELWV  277 (298)
T ss_pred             ccceEECCCcHHHHHHHHHHHHHHHHHhCCceEEEEEE
Confidence            99999999999999999999999999999999999983

>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>KOG0465 consensus Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>KOG3905 consensus Dynein light intermediate chain [Cell motility] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>KOG0459 consensus Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF07650 KH_2: KH domain syndrome, contains KH motifs Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>KOG3887 consensus Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0469 consensus Elongation factor 2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>KOG0446 consensus Vacuolar sorting protein VPS1, dynamin, and related proteins [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] Back     alignment and domain information
>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2203 consensus GTP-binding protein [General function prediction only] Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PF02263 GBP: Guanylate-binding protein, N-terminal domain; InterPro: IPR015894 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PF05879 RHD3: Root hair defective 3 GTP-binding protein (RHD3); InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
3r9w_A307 Crystal Structure Of Era In Complex With Mggdpnp An 1e-34
3iev_A308 Crystal Structure Of Era In Complex With Mggnp And 2e-34
1x18_X292 Contact Sites Of Era Gtpase On The Thermus Thermoph 4e-33
1ega_A301 Crystal Structure Of A Widely Conserved Gtpase Era 4e-33
1wf3_A301 Crystal Structure Of Gtp-Binding Protein Tt1341 Fro 9e-31
3k53_A271 Crystal Structure Of Nfeob From P. Furiosus Length 2e-12
3pqc_A195 Crystal Structure Of Thermotoga Maritima Ribosome B 5e-12
2hjg_A 436 The Crystal Structure Of The B. Subtilis Yphc Gtpas 1e-11
4dcs_A 456 Crystal Structure Of B. Subtilis Enga In Complex Wi 1e-11
3geh_A462 Crystal Structure Of Mnme From Nostoc In Complex Wi 4e-10
3qq5_A 423 Crystal Structure Of The [fefe]-Hydrogenase Maturat 9e-09
2e87_A357 Crystal Structure Of Hypothetical Gtp-Binding Prote 2e-08
1mky_A 439 Structural Analysis Of The Domain Interactions In D 8e-08
2wjg_A188 Structure And Function Of The Feob G-Domain From Me 2e-07
1xzp_A482 Structure Of The Gtp-Binding Protein Trme From Ther 2e-07
2wji_A165 Structure And Function Of The Feob G-Domain From Me 3e-07
2wjh_A166 Structure And Function Of The Feob G-Domain From Me 3e-07
2wjj_A168 Structure And Function Of The Feob G-Domain From Me 4e-07
3gee_A476 Crystal Structure Of Mnme From Chlorobium Tepidum I 5e-07
2dyk_A161 Crystal Structure Of N-Terminal Gtp-Binding Domain 3e-06
1xtq_A177 Structure Of Small Gtpase Human Rheb In Complex Wit 1e-05
3t5g_A181 Structure Of Fully Modified Farnesylated Rheb In Co 2e-05
2gj9_A172 Structure Of The Mnme G-Domain In Complex With GdpA 2e-05
1rfl_A172 Nmr Data Driven Structural Model Of G-Domain Of Mnm 2e-05
2gj8_A172 Structure Of The Mnme G-domain In Complex With Gdp* 3e-05
3sea_A167 Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bo 6e-05
3a1t_A258 Crystal Structue Of The Cytosolic Domain Of T. Mari 7e-05
3a1s_A258 Crystal Structue Of The Cytosolic Domain Of T. Mari 9e-05
3a1w_A168 Crystal Structue Of The G Domain Of T. Maritima Feo 1e-04
1udx_A416 Crystal Structure Of The Conserved Protein Tt1381 F 2e-04
2l0x_A169 Solution Structure Of The 21 Kda Gtpase Rheb Bound 2e-04
2qtf_A364 Crystal Structure Of A Gtp-Binding Protein From The 3e-04
2wia_A267 Crystal Structures Of The N-Terminal Intracellular 4e-04
3kxk_A364 Crystal Structure Of Ssgbp Mutation Variant G235p L 4e-04
3hyr_A270 Structural Insight Into G Protein Coupling And Regu 5e-04
3hyt_A270 Structural Basis Of Gdp Release And Gating In G Pro 7e-04
1u0l_A301 Crystal Structure Of Yjeq From Thermotoga Maritima 7e-04
3i8s_A274 Structure Of The Cytosolic Domain Of E. Coli Feob, 9e-04
>pdb|3R9W|A Chain A, Crystal Structure Of Era In Complex With Mggdpnp And Nucleotides 1506- 1542 Of 16s Ribosomal Rna Length = 307 Back     alignment and structure 
Iteration: 1

 Score =  143 bits (361), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 154/279 (55%), Gaps = 7/279 (2%)
Query: 114 KSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGP-EYQMILYDTPG 172
           K GYVA++GKPNVGKSTL N ++G K+SI++ K  TTR R+LG+ + P E Q+I  DTPG
Sbjct: 8   KVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPG 67
Query: 173 IIE-KKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILL 231
           I E KK  +L   M++  + +   AD I+ ++DA +     DE + +      +K P+++
Sbjct: 68  IYEPKKSDVLGHSMVEIAKQSLEEADVILFMIDATEGWRPRDEEIYQNFIKPLNK-PVIV 126
Query: 232 VLNKKDLIKPGEIAKKL--EWYEKFTDVDEVIPVSAKYGHGVEDIRDWILTKLPLGPAYY 289
           V+NK D I P +    L  E ++K  ++ E++P+SA  G  ++++   IL  LP G   +
Sbjct: 127 VINKIDKIGPAKNVLPLIDEIHKKHPELTEIVPISALKGANLDELVKTILKYLPEGEPLF 186
Query: 290 PKDIVSEHPERFFVGEIIREKIFMQYRNEVPYACQVNVVSYKTRPTAKDFIQV--EIVVE 347
           P+D++++ P R    EI+REK  M  R EVP +  V +   K      + + +  EI+V+
Sbjct: 187 PEDMITDLPLRLLAAEIVREKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKGEIIVD 246
Query: 348 KNSQXXXXXXXXXXXXXXXXXXXRLDIEDFLQKKVYLEV 386
           + +                    R ++E  L + VYLE+
Sbjct: 247 RENLKPIIIGKKGQRLKEIGKRARQELELILGRPVYLEL 285
>pdb|3IEV|A Chain A, Crystal Structure Of Era In Complex With Mggnp And The 3' End Of 16s Rrna Length = 308 Back     alignment and structure
>pdb|1X18|X Chain X, Contact Sites Of Era Gtpase On The Thermus Thermophilus 30s Subunit Length = 292 Back     alignment and structure
>pdb|1EGA|A Chain A, Crystal Structure Of A Widely Conserved Gtpase Era Length = 301 Back     alignment and structure
>pdb|1WF3|A Chain A, Crystal Structure Of Gtp-Binding Protein Tt1341 From Thermus Thermophilus Hb8 Length = 301 Back     alignment and structure
>pdb|3K53|A Chain A, Crystal Structure Of Nfeob From P. Furiosus Length = 271 Back     alignment and structure
>pdb|3PQC|A Chain A, Crystal Structure Of Thermotoga Maritima Ribosome Biogenesis Gtp- Binding Protein Engb (YsxcYIHA) IN COMPLEX WITH GDP Length = 195 Back     alignment and structure
>pdb|2HJG|A Chain A, The Crystal Structure Of The B. Subtilis Yphc Gtpase In Complex With Gdp Length = 436 Back     alignment and structure
>pdb|4DCS|A Chain A, Crystal Structure Of B. Subtilis Enga In Complex With Sulfate Ion And Gdp Length = 456 Back     alignment and structure
>pdb|3GEH|A Chain A, Crystal Structure Of Mnme From Nostoc In Complex With Gdp, Folinic Acid And Zn Length = 462 Back     alignment and structure
>pdb|3QQ5|A Chain A, Crystal Structure Of The [fefe]-Hydrogenase Maturation Protein Hydf Length = 423 Back     alignment and structure
>pdb|2E87|A Chain A, Crystal Structure Of Hypothetical Gtp-Binding Protein Ph1320 From Pyrococcus Horikoshii Ot3, In Complex With Gdp Length = 357 Back     alignment and structure
>pdb|1MKY|A Chain A, Structural Analysis Of The Domain Interactions In Der, A Switch Protein Containing Two Gtpase Domains Length = 439 Back     alignment and structure
>pdb|2WJG|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 188 Back     alignment and structure
>pdb|1XZP|A Chain A, Structure Of The Gtp-Binding Protein Trme From Thermotoga Maritima Length = 482 Back     alignment and structure
>pdb|2WJI|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 165 Back     alignment and structure
>pdb|2WJH|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 166 Back     alignment and structure
>pdb|2WJJ|A Chain A, Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii Length = 168 Back     alignment and structure
>pdb|3GEE|A Chain A, Crystal Structure Of Mnme From Chlorobium Tepidum In Complex With Gdp And Folinic Acid Length = 476 Back     alignment and structure
>pdb|2DYK|A Chain A, Crystal Structure Of N-Terminal Gtp-Binding Domain Of Enga From Thermus Thermophilus Hb8 Length = 161 Back     alignment and structure
>pdb|1XTQ|A Chain A, Structure Of Small Gtpase Human Rheb In Complex With Gdp Length = 177 Back     alignment and structure
>pdb|3T5G|A Chain A, Structure Of Fully Modified Farnesylated Rheb In Complex With Pde6d Length = 181 Back     alignment and structure
>pdb|2GJ9|A Chain A, Structure Of The Mnme G-Domain In Complex With GdpAlf4-, Mg2+ And Rb+ Length = 172 Back     alignment and structure
>pdb|1RFL|A Chain A, Nmr Data Driven Structural Model Of G-Domain Of Mnme Protein Length = 172 Back     alignment and structure
>pdb|2GJ8|A Chain A, Structure Of The Mnme G-domain In Complex With Gdp*alf4-, Mg2+ And K+ Length = 172 Back     alignment and structure
>pdb|3SEA|A Chain A, Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bound Forms Length = 167 Back     alignment and structure
>pdb|3A1T|A Chain A, Crystal Structue Of The Cytosolic Domain Of T. Maritima Feob Iron Iransporter In Gdp Form Ii Length = 258 Back     alignment and structure
>pdb|3A1S|A Chain A, Crystal Structue Of The Cytosolic Domain Of T. Maritima Feob Iron Iransporter In Gdp Form I Length = 258 Back     alignment and structure
>pdb|3A1W|A Chain A, Crystal Structue Of The G Domain Of T. Maritima Feob Iron Iransporter Length = 168 Back     alignment and structure
>pdb|1UDX|A Chain A, Crystal Structure Of The Conserved Protein Tt1381 From Thermus Thermophilus Hb8 Length = 416 Back     alignment and structure
>pdb|2L0X|A Chain A, Solution Structure Of The 21 Kda Gtpase Rheb Bound To Gdp Length = 169 Back     alignment and structure
>pdb|2QTF|A Chain A, Crystal Structure Of A Gtp-Binding Protein From The Hyperthermophilic Archaeon Sulfolobus Solfataricus Length = 364 Back     alignment and structure
>pdb|2WIA|A Chain A, Crystal Structures Of The N-Terminal Intracellular Domain Of Feob From Klebsiella Pneumoniae In Apo Form Length = 267 Back     alignment and structure
>pdb|3KXK|A Chain A, Crystal Structure Of Ssgbp Mutation Variant G235p Length = 364 Back     alignment and structure
>pdb|3HYR|A Chain A, Structural Insight Into G Protein Coupling And Regulation Of Fe2+ Membrane Transport Length = 270 Back     alignment and structure
>pdb|3HYT|A Chain A, Structural Basis Of Gdp Release And Gating In G Protein Coupled Fe2+ Transport Length = 270 Back     alignment and structure
>pdb|1U0L|A Chain A, Crystal Structure Of Yjeq From Thermotoga Maritima Length = 301 Back     alignment and structure
>pdb|3I8S|A Chain A, Structure Of The Cytosolic Domain Of E. Coli Feob, Nucleotide-Free Form Length = 274 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 1e-124
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 1e-122
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 1e-121
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 3e-71
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 4e-30
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 6e-26
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 8e-16
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 3e-25
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 8e-23
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 3e-16
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 2e-22
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 4e-20
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 1e-19
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 4e-19
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 1e-16
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 2e-16
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 3e-15
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 1e-14
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 3e-14
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 1e-12
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 1e-11
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 2e-11
3lxx_A239 GTPase IMAP family member 4; structural genomics c 5e-11
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 6e-11
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 1e-10
3t1o_A198 Gliding protein MGLA; G domain containing protein, 2e-10
2wji_A165 Ferrous iron transport protein B homolog; membrane 2e-10
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 3e-10
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 6e-10
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 6e-10
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 1e-09
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 1e-09
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 2e-07
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 3e-09
3cnl_A262 YLQF, putative uncharacterized protein; circular p 6e-09
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 9e-09
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 1e-08
3lxw_A247 GTPase IMAP family member 1; immunity, structural 2e-08
3iby_A256 Ferrous iron transport protein B; G protein, G dom 3e-08
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 6e-08
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 2e-07
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 4e-06
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 2e-07
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 6e-07
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 2e-06
1nrj_B218 SR-beta, signal recognition particle receptor beta 1e-06
2ged_A193 SR-beta, signal recognition particle receptor beta 1e-06
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 2e-06
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 3e-06
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 4e-06
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 6e-06
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 1e-05
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 1e-05
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 2e-05
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 2e-05
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 3e-05
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 3e-05
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 4e-05
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 4e-05
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 5e-05
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 7e-05
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 8e-05
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 2e-04
3o47_A329 ADP-ribosylation factor GTPase-activating protein 3e-04
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 3e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-04
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 6e-04
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
 Score =  359 bits (925), Expect = e-124
 Identities = 85/279 (30%), Positives = 157/279 (56%), Gaps = 4/279 (1%)

Query: 109 SHPNHKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILY 168
           S      G++A++G+PNVGKSTL N+++GQK+SI + K QTTRHRI+GI +   YQ I  
Sbjct: 2   SIDKSYCGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQAIYV 61

Query: 169 DTPGIIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLP 228
           DTPG+  ++   ++ +M K   S+  + + ++ +V+  +     + +L +     + K P
Sbjct: 62  DTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLR---EGKAP 118

Query: 229 ILLVLNKKDLIKP-GEIAKKLEWYEKFTDVDEVIPVSAKYGHGVEDIRDWILTKLPLGPA 287
           ++L +NK D ++   ++   L++     +  +++P+SA+ G  V+ I   +   LP    
Sbjct: 119 VILAVNKVDNVQEKADLLPHLQFLASQMNFLDIVPISAETGLNVDTIAAIVRKHLPEATH 178

Query: 288 YYPKDIVSEHPERFFVGEIIREKIFMQYRNEVPYACQVNVVSYKTRPTAKDFIQVEIVVE 347
           ++P+D +++  +RF   EIIREK+      E+PY+  V +  + +       I   I+VE
Sbjct: 179 HFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFVSNERGGYDINGLILVE 238

Query: 348 KNSQKIILIGKGGKALKLLATAARLDIEDFLQKKVYLEV 386
           +  QK ++IG  G  +K +   AR D+++  +  V+LE+
Sbjct: 239 REGQKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHLEL 277
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Length = 161 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Length = 262 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Length = 195 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Length = 223 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Length = 195 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Length = 210 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Length = 239 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Length = 270 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Length = 364 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Length = 165 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Length = 188 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Length = 258 Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Length = 416 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Length = 271 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Length = 342 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Length = 272 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Length = 274 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Length = 256 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Length = 260 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Length = 262 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Length = 301 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Length = 302 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Length = 358 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Length = 171 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Length = 192 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Length = 307 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Length = 198 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query388
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 100.0
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 100.0
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 100.0
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.94
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.93
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.92
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.91
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.91
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.91
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.9
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.9
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.9
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.9
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.9
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.9
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.9
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.9
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.9
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.89
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.89
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.89
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.89
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.89
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.89
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.89
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.89
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.89
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.89
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.89
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.89
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.89
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.88
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.88
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.88
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.88
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.88
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.88
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.88
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.88
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.88
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.88
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.88
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.88
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.88
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.88
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.88
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.88
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.88
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.88
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.88
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.88
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.87
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.87
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.87
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.87
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.87
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.87
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.87
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.87
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.87
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.87
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.87
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.87
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.87
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.87
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.87
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.87
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.87
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.87
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.87
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.87
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.87
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.87
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.87
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.87
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.87
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.87
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.87
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.87
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.87
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.87
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.86
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.86
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.86
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.86
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.86
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.86
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.86
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.86
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.86
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.86
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.86
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.86
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.86
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.86
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.86
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.86
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.86
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.86
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.86
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.86
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.86
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.86
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.86
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 99.86
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.86
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.86
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.86
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.86
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.86
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.86
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.86
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.86
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.85
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.85
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.85
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.85
1wxq_A397 GTP-binding protein; structural genomics, riken st 99.85
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.85
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.85
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.85
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.85
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.85
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.85
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.85
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.84
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.84
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.84
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.84
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.84
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.84
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.84
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.83
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.83
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.83
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.83
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.83
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.83
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.82
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.82
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.82
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.71
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.81
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.81
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.81
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.81
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.8
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.8
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.8
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.8
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.8
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 99.78
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.78
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.78
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.78
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.78
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.77
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 99.77
2elf_A370 Protein translation elongation factor 1A; tRNA, py 99.77
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.77
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.77
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 99.77
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.77
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.76
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.76
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.76
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.75
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.75
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.75
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 99.75
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.74
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.74
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.74
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.72
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.72
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.72
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.72
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.71
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.71
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.69
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.68
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.67
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.67
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.67
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.65
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.64
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.64
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.64
2ged_A193 SR-beta, signal recognition particle receptor beta 99.62
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 99.61
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.6
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 99.6
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.6
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.59
1jal_A363 YCHF protein; nucleotide-binding fold, structural 99.52
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.51
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.49
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 99.47
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 99.43
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.42
2hf9_A226 Probable hydrogenase nickel incorporation protein 99.4
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 99.38
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 99.34
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 99.32
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.3
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.29
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.27
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.23
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 99.2
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 99.14
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.11
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.09
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 99.09
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 99.04
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.04
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.0
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 98.99
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 98.95
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 98.94
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 98.85
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.83
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 98.76
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 98.73
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 98.7
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.66
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.54
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.52
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 98.43
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.36
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 98.27
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 98.09
2xxa_A433 Signal recognition particle protein; protein trans 97.94
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.91
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.68
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.64
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.6
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.53
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.51
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.43
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 97.36
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.29
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 97.13
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 97.1
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.01
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.01
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 96.95
2og2_A359 Putative signal recognition particle receptor; nuc 96.95
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.95
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 96.89
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.82
3end_A307 Light-independent protochlorophyllide reductase ir 96.81
3cwq_A209 Para family chromosome partitioning protein; alpha 96.79
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 96.74
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 96.64
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.63
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 96.34
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.32
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.27
4ido_A 457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 96.26
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.23
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 96.12
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.08
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 95.94
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.91
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.9
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 95.83
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.81
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.77
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 95.77
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 95.76
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 95.74
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 95.72
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 95.68
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 95.66
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.6
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 95.57
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 95.55
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 95.55
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 95.5
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 95.49
1b0u_A262 Histidine permease; ABC transporter, transport pro 95.48
1g6h_A257 High-affinity branched-chain amino acid transport 95.48
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 95.47
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 95.47
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 95.46
1sgw_A214 Putative ABC transporter; structural genomics, P p 95.44
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 95.44
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 95.43
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 95.42
1ji0_A240 ABC transporter; ATP binding protein, structural g 95.37
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 95.36
2ghi_A260 Transport protein; multidrug resistance protein, M 95.35
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.35
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 95.34
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 95.32
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 95.31
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 95.3
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 95.3
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 95.29
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 95.25
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 95.25
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 95.23
2eyu_A261 Twitching motility protein PILT; pilus retraction 95.19
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 95.19
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 95.18
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.18
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 95.18
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 95.16
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.16
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 95.15
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.14
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.13
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 95.12
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 95.1
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.09
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 95.08
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.04
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 95.02
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 95.0
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 94.99
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.98
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 94.9
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 94.9
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 94.85
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 94.85
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.81
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 94.8
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.79
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.79
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 94.77
4a74_A231 DNA repair and recombination protein RADA; hydrola 94.75
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.72
1xjc_A169 MOBB protein homolog; structural genomics, midwest 94.72
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 94.69
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 94.65
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.64
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 94.63
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 94.63
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 94.62
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.62
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.61
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.61
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 94.61
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 94.59
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 94.57
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 94.56
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.55
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 94.54
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 94.54
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 94.52
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 94.51
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.5
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 94.49
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 94.49
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 94.49
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 94.46
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.43
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 94.42
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 94.4
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 94.4
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.39
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.39
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 94.38
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 94.38
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.38
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 94.36
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 94.35
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 94.32
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 94.31
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.31
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 94.31
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.31
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.3
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.29
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 94.28
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 94.26
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 94.23
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 94.2
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 94.19
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 94.19
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 94.17
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 94.15
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 94.13
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 94.12
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 94.07
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.07
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 94.06
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 94.04
2ewv_A372 Twitching motility protein PILT; pilus retraction 94.04
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 94.03
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 94.02
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 94.02
2vli_A183 Antibiotic resistance protein; transferase, tunica 94.0
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 94.0
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 93.99
3kta_A182 Chromosome segregation protein SMC; structural mai 93.95
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 93.95
2v1u_A387 Cell division control protein 6 homolog; DNA repli 93.93
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 93.88
1p9r_A418 General secretion pathway protein E; bacterial typ 93.85
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 93.82
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 93.8
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 93.77
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 93.74
1via_A175 Shikimate kinase; structural genomics, transferase 93.7
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 93.69
2oap_1511 GSPE-2, type II secretion system protein; hexameri 93.68
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 93.63
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.63
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 93.61
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 93.6
3tlx_A243 Adenylate kinase 2; structural genomics, structura 93.58
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.57
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 93.57
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 93.5
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 93.36
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 93.36
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 93.35
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 93.34
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.34
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 93.28
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.26
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 93.24
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 93.19
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 93.17
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 93.15
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 93.11
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 93.11
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 93.11
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 93.09
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 93.06
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 93.04
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.04
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 93.02
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 93.0
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 92.96
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 92.95
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 92.94
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 92.85
3bos_A242 Putative DNA replication factor; P-loop containing 92.83
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 92.81
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 92.81
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 92.8
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 92.79
3r20_A233 Cytidylate kinase; structural genomics, seattle st 92.78
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 92.71
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 92.71
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 92.61
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 92.57
2cvh_A220 DNA repair and recombination protein RADB; filamen 92.52
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 92.5
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 92.45
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 92.45
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 92.45
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 92.44
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 92.39
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 92.38
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 92.33
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 92.32
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 92.27
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 92.25
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 92.25
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 92.23
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 92.23
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 92.23
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 92.15
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 92.12
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 92.07
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 92.03
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 92.0
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 91.99
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 91.99
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 91.97
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 91.85
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 91.7
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 91.69
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 91.66
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 91.62
1tue_A212 Replication protein E1; helicase, replication, E1E 91.59
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 91.5
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 91.46
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 91.42
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 91.37
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 91.25
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 91.24
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 91.19
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 91.14
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 91.06
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 91.06
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 91.03
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 90.99
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 90.83
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 90.72
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 90.72
3co5_A143 Putative two-component system transcriptional RES 90.69
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 90.55
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 90.45
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 90.44
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 90.44
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 90.43
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
Probab=100.00  E-value=1e-48  Score=369.68  Aligned_cols=276  Identities=37%  Similarity=0.569  Sum_probs=242.4

Q ss_pred             CCCCCccEEEEEeCCCCChhHHHHHHhCCceeeecCCCCceEEeEEEEEeCC-CeeEEEEeCCCCcchh-hhhhhHHHHH
Q 016529          110 HPNHKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGP-EYQMILYDTPGIIEKK-IHMLDSMMMK  187 (388)
Q Consensus       110 ~~~~~~~~v~ivG~~~~GKSSLln~l~~~~~~~~~~~~~~t~~~~~~~~~~~-~~~~~liDtpG~~~~~-~~~~~~~~~~  187 (388)
                      +++...+.|+++|.+|||||||+|+|++.++.+++..+++|+.......... +.++.||||||+.... ...+...+..
T Consensus         5 ~~~~~~g~v~ivG~~nvGKSTLin~l~g~~~~i~s~~~~tT~~~~~~~~~~~~~~~i~lvDTPG~~~~~~~~~l~~~~~~   84 (308)
T 3iev_A            5 HHHMKVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPGIYEPKKSDVLGHSMVE   84 (308)
T ss_dssp             --CCEEEEEEEECSTTSSHHHHHHHHHTSCCSCCCSSSCCCCSCEEEEEEETTTEEEEEEECCCCCCCCTTCHHHHHHHH
T ss_pred             CCCCCCCEEEEECCCCCcHHHHHHHHhCCCccccCCCCCceeeEEEEEEecCCCCeEEEEECcCCCccccchhHHHHHHH
Confidence            3455677999999999999999999999999888999999999988888887 8999999999985422 1456667777


Q ss_pred             hHHhhhccccEEEEEEeCCCCCchHHHHH-HHhcccCCCCCCEEEEEeCCCCC-ChhhHhHHHHHhhhcC-CCceEEEec
Q 016529          188 NVRSAGINADCIVVLVDACKAPERIDEIL-EEGVGDHKDKLPILLVLNKKDLI-KPGEIAKKLEWYEKFT-DVDEVIPVS  264 (388)
Q Consensus       188 ~~~~~~~~ad~ii~VvD~~~~~~~~~~~l-~~~~~~~~~~~piilV~NK~Dl~-~~~~~~~~~~~~~~~~-~~~~v~~vS  264 (388)
                      .+..++..+|++++|+|++++.......+ ...+..  .+.|+++|+||+|+. +..........+.... .+.+++++|
T Consensus        85 ~~~~~l~~aD~il~VvD~~~~~~~~~~~~~~~~l~~--~~~pvilV~NK~Dl~~~~~~~~~~~~~l~~~~~~~~~i~~vS  162 (308)
T 3iev_A           85 IAKQSLEEADVILFMIDATEGWRPRDEEIYQNFIKP--LNKPVIVVINKIDKIGPAKNVLPLIDEIHKKHPELTEIVPIS  162 (308)
T ss_dssp             HHHHHHHHCSEEEEEEETTTBSCHHHHHHHHHHTGG--GCCCEEEEEECGGGSSSGGGGHHHHHHHHHHCTTCCCEEECB
T ss_pred             HHHHHhhcCCEEEEEEeCCCCCCchhHHHHHHHHHh--cCCCEEEEEECccCCCCHHHHHHHHHHHHHhccCCCeEEEEe
Confidence            88888999999999999998765555554 666665  579999999999998 5555555555555544 467899999


Q ss_pred             CCCCCCHHHHHHHHHHhCCCCCCCCCCCccCCcchHHHHHHHHHHHHHhhcCCCCCceeEEEEEEEEecC--CceEEEEE
Q 016529          265 AKYGHGVEDIRDWILTKLPLGPAYYPKDIVSEHPERFFVGEIIREKIFMQYRNEVPYACQVNVVSYKTRP--TAKDFIQV  342 (388)
Q Consensus       265 A~~g~gi~eL~~~i~~~l~~~~~~~~~~~~~~~~~~~~~~eiire~i~~~~~~~vp~s~~v~~~~~~~~~--~~~~~i~~  342 (388)
                      |++|.|+++|+++|.+.++++++.||.+..++++.+++++|++||+++..+.+++||++.+.+..|+.++  ++..+|.+
T Consensus       163 A~~g~gv~~L~~~l~~~l~~~~~~~~~~~~td~~~~~~~~e~irek~~~~~~~eiP~~~~v~i~~~~~~~~~~~~~~i~a  242 (308)
T 3iev_A          163 ALKGANLDELVKTILKYLPEGEPLFPEDMITDLPLRLLAAEIVREKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKG  242 (308)
T ss_dssp             TTTTBSHHHHHHHHHHHSCBCCCSSCTTCCBCCCHHHHHHHHHHHHHHHTCCTTHHHHCEEEEEEEEECSSCTTSEEEEE
T ss_pred             CCCCCCHHHHHHHHHHhCccCCCCCCcccccCCCHHHHHHHHHHHHHHhhhhhhcCCeeEEEeEEEEEccCCCCeEEEEE
Confidence            9999999999999999999999999999999999999999999999999999999999999999999886  36789999


Q ss_pred             EEEEeeCCeeeEEEecCChhHHHHHHHHHHHHHHhcCCceEEEec
Q 016529          343 EIVVEKNSQKIILIGKGGKALKLLATAARLDIEDFLQKKVYLEVP  387 (388)
Q Consensus       343 ~~~~e~~~q~~~vig~~g~~i~~i~~~~~~~l~~~~~~~v~l~l~  387 (388)
                      .++|+|++|+.|+||++|++||+|+..||++||++||++|||+||
T Consensus       243 ~i~ve~~~~k~i~ig~~g~~ik~i~~~ar~~~~~~~~~~v~l~l~  287 (308)
T 3iev_A          243 EIIVDRENLKPIIIGKKGQRLKEIGKRARQELELILGRPVYLELW  287 (308)
T ss_dssp             EEEESSGGGHHHHHCGGGHHHHHHHHHHHHHHHHHHTSCEEEEEE
T ss_pred             EEEEccCCcceEEEcCCcHHHHHHHHHHHHHHHHHhCCceEEEEE
Confidence            999999999999999999999999999999999999999999997
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 388
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 6e-34
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 3e-27
d1egaa2113 d.52.3.1 (A:183-295) GTPase Era C-terminal domain 4e-27
d1wf3a2118 d.52.3.1 (A:181-298) GTPase Era C-terminal domain 8e-27
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 9e-23
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 2e-22
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 5e-22
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 8e-22
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 2e-20
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 5e-19
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 6e-19
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 2e-16
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 6e-16
d1tq4a_400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 1e-15
d1h65a_257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 2e-15
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 3e-13
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 7e-13
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 2e-12
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 7e-12
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 2e-11
d1wb1a4179 c.37.1.8 (A:1-179) Elongation factor SelB, N-termi 4e-11
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 6e-11
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 6e-11
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 1e-10
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 1e-10
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 1e-10
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 2e-10
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 2e-10
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 4e-10
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 5e-10
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 8e-10
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 2e-09
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 2e-09
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 2e-09
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 2e-09
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 4e-09
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 5e-09
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 5e-09
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 6e-09
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 1e-08
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 2e-08
d1wxqa1319 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyr 2e-08
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 2e-08
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 2e-08
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 5e-08
d2fn4a1173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 5e-08
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 6e-08
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 6e-08
d1mh1a_183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 1e-07
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 2e-07
d1z0ja1167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 2e-07
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 3e-07
d1i2ma_170 c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 3e-07
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 5e-07
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 7e-07
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 7e-07
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 1e-06
d1puja_273 c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti 2e-06
d1puja_273 c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti 3e-04
d2atxa1185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 2e-06
d1u0la2225 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C 4e-06
d1u0la2225 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C 1e-05
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 4e-06
d2ngra_191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 4e-06
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 6e-06
d2erya1171 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ 8e-06
d2bmja1175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 1e-05
d2qn6a3205 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su 2e-05
d1yrba1244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 2e-05
d1c1ya_167 c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 4e-05
d1kk1a3195 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma su 1e-04
d1ni3a1296 c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter 2e-04
d1kmqa_177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 2e-04
d1xtqa1167 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human 2e-04
d1x1ra1169 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa 3e-04
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 3e-04
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 3e-04
d1t9ha2231 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C 5e-04
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 5e-04
d1m7ba_179 c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T 9e-04
d1ly1a_152 c.37.1.1 (A:) Polynucleotide kinase, kinase domain 0.002
d1r5ba3245 c.37.1.8 (A:215-459) Eukaryotic peptide chain rele 0.002
d1jala1278 c.37.1.8 (A:1-278) YchF GTP-binding protein N-term 0.003
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTPase Era, N-terminal domain
species: Escherichia coli [TaxId: 562]

 Score =  122 bits (306), Expect = 6e-34
 Identities = 54/181 (29%), Positives = 101/181 (55%), Gaps = 4/181 (2%)

Query: 112 NHKSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTP 171
               G++A++G+PNVGKSTL N+++GQK+SI + K QTTRHRI+GI +   YQ I  DTP
Sbjct: 2   KSYCGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQAIYVDTP 61

Query: 172 GIIEKKIHMLDSMMMKNVRSAGINADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILL 231
           G+  ++   ++ +M K   S+  + + ++ +V+  +     + +L +     + K P++L
Sbjct: 62  GLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNK---LREGKAPVIL 118

Query: 232 VLNKKDLIKPGEIAKKLEWY-EKFTDVDEVIPVSAKYGHGVEDIRDWILTKLPLGPAYYP 290
            +NK D ++          +     +  +++P+SA+ G  V+ I   +   LP    ++P
Sbjct: 119 AVNKVDNVQEKADLLPHLQFLASQMNFLDIVPISAETGLNVDTIAAIVRKHLPEATHHFP 178

Query: 291 K 291
           +
Sbjct: 179 E 179
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} Length = 113 Back     information, alignment and structure
>d1wf3a2 d.52.3.1 (A:181-298) GTPase Era C-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 118 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Length = 179 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 319 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 225 Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 225 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 195 Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 231 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 278 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query388
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.97
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.93
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.91
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.91
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.91
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.91
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.9
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.9
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.9
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.89
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.89
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.89
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.89
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.88
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.88
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.88
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.88
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.88
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.88
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.87
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.87
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.87
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.86
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.86
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.86
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.85
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.85
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.85
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.85
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.85
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1egaa2113 GTPase Era C-terminal domain {Escherichia coli [Ta 99.84
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.84
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.84
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.84
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.83
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.83
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.83
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.82
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.82
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.82
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.81
d1wf3a2118 GTPase Era C-terminal domain {Thermus thermophilus 99.81
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.79
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.79
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.79
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.78
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.76
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.73
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.73
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.71
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.71
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.64
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.64
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.63
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.63
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.62
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.61
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.6
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.58
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.5
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 99.44
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.43
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.37
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 99.36
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 99.29
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 99.19
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 99.17
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 99.15
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 99.14
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 99.03
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.92
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.65
d1j8yf2211 GTPase domain of the signal sequence recognition p 98.47
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.38
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 98.31
d2qy9a2211 GTPase domain of the signal recognition particle r 98.26
d1okkd2207 GTPase domain of the signal recognition particle r 98.1
d1vmaa2213 GTPase domain of the signal recognition particle r 98.08
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.08
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.89
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.67
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.58
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.57
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 97.41
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.88
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.58
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.55
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.42
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.36
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.35
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.18
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.17
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.11
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.07
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.05
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.02
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 95.93
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.93
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 95.92
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.89
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.87
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.82
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.81
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.79
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 95.79
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.76
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.73
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.72
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.69
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 95.69
d2awna2232 Maltose transport protein MalK, N-terminal domain 95.68
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.66
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.63
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.6
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.6
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.57
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 95.56
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.54
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 95.5
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.5
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.46
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.45
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.44
d1g2912240 Maltose transport protein MalK, N-terminal domain 95.4
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 95.4
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.39
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.36
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.36
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.34
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.32
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.32
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.32
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 95.32
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.26
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 95.23
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 95.23
d2hyda1255 Putative multidrug export ATP-binding/permease pro 95.21
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.21
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.19
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.19
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.14
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 95.13
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 95.08
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.97
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 94.96
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.96
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.96
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.95
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 94.81
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.66
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.62
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.53
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.43
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.34
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 94.32
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.24
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.22
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 94.22
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 94.21
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.2
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.18
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.04
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 93.93
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.92
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.82
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 93.81
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.64
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 93.54
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 93.27
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.2
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 93.0
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 92.61
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 92.57
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 92.56
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 92.52
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.47
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 92.37
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 92.0
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 91.82
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 91.48
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 91.48
d1svma_362 Papillomavirus large T antigen helicase domain {Si 91.0
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 90.96
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.81
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.58
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 90.41
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.26
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.06
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 90.03
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 90.0
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 89.92
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 89.85
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 89.79
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 89.7
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.63
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 89.19
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 89.06
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 89.03
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 88.8
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 88.49
d1tuea_205 Replication protein E1 helicase domain {Human papi 88.25
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 88.05
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 87.93
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 87.59
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 86.83
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 86.65
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 86.48
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 86.41
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 86.41
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 86.19
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 85.74
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 85.12
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 84.9
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 84.39
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 83.92
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 82.97
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 82.43
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 82.1
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 81.68
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 81.32
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 80.89
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 80.33
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTPase Era, N-terminal domain
species: Thermus thermophilus [TaxId: 274]

Probab=99.97  E-value=2.3e-30  Score=222.58  Aligned_cols=175  Identities=35%  Similarity=0.547  Sum_probs=146.2

Q ss_pred             CccEEEEEeCCCCChhHHHHHHhCCceeeecCCCCceEEeEEEEEeCCCeeEEEEeCCCCcchhhhhhhHHHHHhHHhhh
Q 016529          114 KSGYVAVLGKPNVGKSTLANQMIGQKLSIVTNKPQTTRHRILGICSGPEYQMILYDTPGIIEKKIHMLDSMMMKNVRSAG  193 (388)
Q Consensus       114 ~~~~v~ivG~~~~GKSSLln~l~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~liDtpG~~~~~~~~~~~~~~~~~~~~~  193 (388)
                      .++.|+|+|.+|||||||+|+|++.+...++..+++|...........+.++.+|||||+.. ........+...+..++
T Consensus         4 ~~~~I~lvG~~~~GKSSLin~l~~~~~~~~~~~~~tt~~~~~~~~~~~~~~~~~~DtpG~~~-~~~~~~~~~~~~~~~~~   82 (178)
T d1wf3a1           4 YSGFVAIVGKPNVGKSTLLNNLLGVKVAPISPRPQTTRKRLRGILTEGRRQIVFVDTPGLHK-PMDALGEFMDQEVYEAL   82 (178)
T ss_dssp             EEEEEEEECSTTSSHHHHHHHHHTSCCSCCCSSSCCCCSCEEEEEEETTEEEEEEECCCCCC-CCSHHHHHHHHHHHHHT
T ss_pred             cCcEEEEECCCCCCHHHHHHHHhCCCceeecccCCcccccccceeeeeeeeeeecccccccc-cccccchhccccccccc
Confidence            45689999999999999999999998877888999999888888888889999999999743 22334445566677778


Q ss_pred             ccccEEEEEEeCCCCCchHHHHHHHhcccCCCCCCEEEEEeCCCCCChhhHhHHHHHhhhcCCCceEEEecCCCCCCHHH
Q 016529          194 INADCIVVLVDACKAPERIDEILEEGVGDHKDKLPILLVLNKKDLIKPGEIAKKLEWYEKFTDVDEVIPVSAKYGHGVED  273 (388)
Q Consensus       194 ~~ad~ii~VvD~~~~~~~~~~~l~~~~~~~~~~~piilV~NK~Dl~~~~~~~~~~~~~~~~~~~~~v~~vSA~~g~gi~e  273 (388)
                      ..||++|+|+|++++....+.++...++....+.|+++|+||+|+....+  ...+.+....+...++++||++|.|+++
T Consensus        83 ~~ad~il~v~D~~~~~~~~~~~i~~~l~~~~~~~piilv~NK~Dl~~~~~--~~~~~~~~~~~~~~~~~iSA~~~~gi~~  160 (178)
T d1wf3a1          83 ADVNAVVWVVDLRHPPTPEDELVARALKPLVGKVPILLVGNKLDAAKYPE--EAMKAYHELLPEAEPRMLSALDERQVAE  160 (178)
T ss_dssp             SSCSEEEEEEETTSCCCHHHHHHHHHHGGGTTTSCEEEEEECGGGCSSHH--HHHHHHHHTSTTSEEEECCTTCHHHHHH
T ss_pred             ccccceeeeechhhhhcccccchhhheeccccchhhhhhhcccccccCHH--HHHHHHHhhcccCceEEEecCCCCCHHH
Confidence            99999999999999888888888887776656899999999999976432  2334445555566889999999999999


Q ss_pred             HHHHHHHhCCCCCCCCCC
Q 016529          274 IRDWILTKLPLGPAYYPK  291 (388)
Q Consensus       274 L~~~i~~~l~~~~~~~~~  291 (388)
                      |+++|.+.+|++|++||+
T Consensus       161 L~~~i~~~lpe~p~~~p~  178 (178)
T d1wf3a1         161 LKADLLALMPEGPFFYPE  178 (178)
T ss_dssp             HHHHHHTTCCBCCCSSCT
T ss_pred             HHHHHHHhCCCCCCCCCC
Confidence            999999999999999984
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a2 d.52.3.1 (A:181-298) GTPase Era C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure