Citrus Sinensis ID: 016530
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 388 | ||||||
| 224124910 | 507 | predicted protein [Populus trichocarpa] | 0.865 | 0.662 | 0.719 | 1e-150 | |
| 294440430 | 506 | aspartic protease 1 [Nicotiana tabacum] | 0.863 | 0.662 | 0.721 | 1e-148 | |
| 171854659 | 506 | putative aspartic protease [Capsicum chi | 0.865 | 0.664 | 0.715 | 1e-148 | |
| 12231178 | 505 | aspartic proteinase 4 [Nepenthes alata] | 0.863 | 0.663 | 0.728 | 1e-147 | |
| 82623417 | 506 | aspartic protease precursor-like [Solanu | 0.865 | 0.664 | 0.713 | 1e-146 | |
| 418731269 | 372 | aspartic protease, partial [Solanum tube | 0.865 | 0.903 | 0.713 | 1e-146 | |
| 350535356 | 506 | aspartic protease precursor [Solanum lyc | 0.865 | 0.664 | 0.707 | 1e-146 | |
| 50540937 | 497 | Asp [Solanum tuberosum] | 0.860 | 0.672 | 0.708 | 1e-144 | |
| 255543036 | 494 | Aspartic proteinase precursor, putative | 0.837 | 0.657 | 0.728 | 1e-144 | |
| 356534977 | 508 | PREDICTED: aspartic proteinase-like [Gly | 0.863 | 0.659 | 0.715 | 1e-143 |
| >gi|224124910|ref|XP_002319454.1| predicted protein [Populus trichocarpa] gi|222857830|gb|EEE95377.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 536 bits (1381), Expect = e-150, Method: Compositional matrix adjust.
Identities = 244/339 (71%), Positives = 298/339 (87%), Gaps = 3/339 (0%)
Query: 53 QVFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLVSEEVFSFWLNRD 112
QVF+EAT+EGSL+F+L +FDGI+GLGF+EI+VG+ VP+W NM++Q LV +EVFSFWLNR+
Sbjct: 169 QVFVEATKEGSLSFILGKFDGILGLGFQEISVGNVVPLWYNMIQQDLVDDEVFSFWLNRN 228
Query: 113 PDAEEGGEIVFGGVDPKHFKGKHTYVPVTKKGYWQFELGDILIGNQSTGVCEGGCAAIVD 172
P+A+EGGE+VFGGVDPKHFKGKHTYVPVT+KGYWQ +GD LIG STG+CEGGCAAIVD
Sbjct: 229 PEAKEGGELVFGGVDPKHFKGKHTYVPVTQKGYWQINMGDFLIGKHSTGLCEGGCAAIVD 288
Query: 173 SGTSLLAGPTPVVTEINHAIGGEGVVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGL 232
SGTSLLAGPTP++TEINHAIG EG+VSAECK VVS YGDLIW+L++SG+ P KVC Q+GL
Sbjct: 289 SGTSLLAGPTPIITEINHAIGAEGLVSAECKEVVSHYGDLIWELIISGVQPSKVCTQLGL 348
Query: 233 CAFNGAEYVSTGIKTVVEKEN---VSAGDSAVCSACEMAVVWVQNQLKQKQTKEKVLSYI 289
C FN A+ TGI++VVEKEN SAG+ C+AC+M V+WVQNQL++K TKE ++Y+
Sbjct: 349 CIFNEAKSARTGIESVVEKENKEKSSAGNDLPCTACQMLVIWVQNQLREKATKETAINYL 408
Query: 290 NELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPEQYILKTGEGIAEVCISGFM 349
++LC+SLP+PMG+S IDC+ I TMPN++FTIGDK F+L+PEQYILKTGEGIA+VCISGFM
Sbjct: 409 DKLCESLPSPMGQSSIDCNSISTMPNITFTIGDKPFSLTPEQYILKTGEGIAQVCISGFM 468
Query: 350 AFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAEAA 388
A D+PPPRGPLWILGDVFMG YHT+FD G L +GFAEAA
Sbjct: 469 ALDVPPPRGPLWILGDVFMGAYHTIFDYGNLEVGFAEAA 507
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|294440430|gb|ADE74632.1| aspartic protease 1 [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|171854659|dbj|BAG16519.1| putative aspartic protease [Capsicum chinense] | Back alignment and taxonomy information |
|---|
| >gi|12231178|dbj|BAB20972.1| aspartic proteinase 4 [Nepenthes alata] | Back alignment and taxonomy information |
|---|
| >gi|82623417|gb|ABB87123.1| aspartic protease precursor-like [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|418731269|gb|AFX67029.1| aspartic protease, partial [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|350535356|ref|NP_001234702.1| aspartic protease precursor [Solanum lycopersicum] gi|951449|gb|AAB18280.1| aspartic protease precursor [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|50540937|gb|AAT77954.1| Asp [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|255543036|ref|XP_002512581.1| Aspartic proteinase precursor, putative [Ricinus communis] gi|223548542|gb|EEF50033.1| Aspartic proteinase precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356534977|ref|XP_003536026.1| PREDICTED: aspartic proteinase-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 388 | ||||||
| TAIR|locus:2008940 | 506 | APA1 "aspartic proteinase A1" | 0.863 | 0.662 | 0.661 | 3.3e-127 | |
| UNIPROTKB|B9RXH6 | 511 | RCOM_0903730 "Aspartic protein | 0.865 | 0.657 | 0.666 | 4.2e-127 | |
| TAIR|locus:2018037 | 513 | AT1G62290 [Arabidopsis thalian | 0.863 | 0.653 | 0.642 | 9.2e-123 | |
| TAIR|locus:2137189 | 508 | AT4G04460 [Arabidopsis thalian | 0.865 | 0.661 | 0.601 | 1.7e-114 | |
| WB|WBGene00000217 | 444 | asp-4 [Caenorhabditis elegans | 0.378 | 0.331 | 0.496 | 2.6e-61 | |
| DICTYBASE|DDB_G0279411 | 383 | ctsD "cathepsin D" [Dictyostel | 0.389 | 0.394 | 0.481 | 7.8e-54 | |
| UNIPROTKB|E2RJN2 | 396 | CTSE "Uncharacterized protein" | 0.384 | 0.376 | 0.457 | 9.9e-52 | |
| UNIPROTKB|P43159 | 396 | CTSE "Cathepsin E" [Oryctolagu | 0.386 | 0.378 | 0.448 | 3.3e-51 | |
| FB|FBgn0033933 | 404 | CG10104 [Drosophila melanogast | 0.358 | 0.344 | 0.415 | 1.3e-49 | |
| UNIPROTKB|F1NLA4 | 399 | LOC431167 "Uncharacterized pro | 0.396 | 0.385 | 0.345 | 4.2e-49 |
| TAIR|locus:2008940 APA1 "aspartic proteinase A1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1249 (444.7 bits), Expect = 3.3e-127, P = 3.3e-127
Identities = 225/340 (66%), Positives = 276/340 (81%)
Query: 53 QVFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLVSEEVFSFWLNRD 112
Q FIEAT+E +TF++A+FDGI+GLGF+EI+VG A PVW NM++QGL+ E VFSFWLNR+
Sbjct: 168 QEFIEATKEPGITFVVAKFDGILGLGFQEISVGKAAPVWYNMLKQGLIKEPVFSFWLNRN 227
Query: 113 PDAEEGGEIVFGGVDPKHFKGKHTYVPVTKKGYWQFELGDILIGNQSTGVCEGGCAAIVD 172
D EEGGE+VFGGVDP HFKGKHTYVPVT+KGYWQF++GD+LIG TG CE GC+AI D
Sbjct: 228 ADEEEGGELVFGGVDPNHFKGKHTYVPVTQKGYWQFDMGDVLIGGAPTGFCESGCSAIAD 287
Query: 173 SGTSLLAGPTPVVTEINHAIGGEGVVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGL 232
SGTSLLAGPT ++T INHAIG GVVS +CK VV QYG I DLL+S P+K+C QIGL
Sbjct: 288 SGTSLLAGPTTIITMINHAIGAAGVVSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGL 347
Query: 233 CAFNGAEYVSTGIKTVVEKENVS----AGDSAVCSACEMAVVWVQNQLKQKQTKEKVLSY 288
C F+G VS GI++VV+KEN GD+A CSACEMAVVW+Q+QL+Q T+E++L+Y
Sbjct: 348 CTFDGTRGVSMGIESVVDKENAKLSNGVGDAA-CSACEMAVVWIQSQLRQNMTQERILNY 406
Query: 289 INELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPEQYILKTGEGIAEVCISGF 348
+NELC+ LP+PMGES +DC ++ TMP VS TIG K+F+L+PE+Y+LK GEG CISGF
Sbjct: 407 VNELCERLPSPMGESAVDCAQLSTMPTVSLTIGGKVFDLAPEEYVLKVGEGPVAQCISGF 466
Query: 349 MAFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAEAA 388
+A D+ PPRGPLWILGDVFMG YHTVFD G ++GFAEAA
Sbjct: 467 IALDVAPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEAA 506
|
|
| UNIPROTKB|B9RXH6 RCOM_0903730 "Aspartic proteinase, putative" [Ricinus communis (taxid:3988)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018037 AT1G62290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2137189 AT4G04460 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000217 asp-4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0279411 ctsD "cathepsin D" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RJN2 CTSE "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P43159 CTSE "Cathepsin E" [Oryctolagus cuniculus (taxid:9986)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033933 CG10104 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLA4 LOC431167 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pm.C_LG_XIII0008 | hypothetical protein (507 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 388 | |||
| cd06098 | 317 | cd06098, phytepsin, Phytepsin, a plant homolog of | 1e-99 | |
| cd05485 | 329 | cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsi | 2e-55 | |
| pfam00026 | 316 | pfam00026, Asp, Eukaryotic aspartyl protease | 2e-55 | |
| cd06098 | 317 | cd06098, phytepsin, Phytepsin, a plant homolog of | 3e-52 | |
| cd05490 | 325 | cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family | 2e-49 | |
| cd05471 | 283 | cd05471, pepsin_like, Pepsin-like aspartic proteas | 4e-47 | |
| cd05478 | 317 | cd05478, pepsin_A, Pepsin A, aspartic protease pro | 6e-44 | |
| cd05486 | 316 | cd05486, Cathespin_E, Cathepsin E, non-lysosomal a | 3e-43 | |
| cd05487 | 326 | cd05487, renin_like, Renin stimulates production o | 1e-41 | |
| cd05488 | 320 | cd05488, Proteinase_A_fungi, Fungal Proteinase A , | 2e-39 | |
| cd05477 | 318 | cd05477, gastricsin, Gastricsins, asparate proteas | 1e-38 | |
| cd05490 | 325 | cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family | 2e-36 | |
| cd05485 | 329 | cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsi | 2e-33 | |
| pfam00026 | 316 | pfam00026, Asp, Eukaryotic aspartyl protease | 9e-26 | |
| cd05486 | 316 | cd05486, Cathespin_E, Cathepsin E, non-lysosomal a | 3e-25 | |
| PTZ00165 | 482 | PTZ00165, PTZ00165, aspartyl protease; Provisional | 9e-24 | |
| cd05487 | 326 | cd05487, renin_like, Renin stimulates production o | 5e-22 | |
| cd05488 | 320 | cd05488, Proteinase_A_fungi, Fungal Proteinase A , | 4e-20 | |
| PTZ00165 | 482 | PTZ00165, PTZ00165, aspartyl protease; Provisional | 2e-17 | |
| cd05473 | 364 | cd05473, beta_secretase_like, Beta-secretase, aspa | 2e-15 | |
| cd05478 | 317 | cd05478, pepsin_A, Pepsin A, aspartic protease pro | 5e-15 | |
| cd05477 | 318 | cd05477, gastricsin, Gastricsins, asparate proteas | 8e-15 | |
| PTZ00147 | 453 | PTZ00147, PTZ00147, plasmepsin-1; Provisional | 1e-13 | |
| cd05474 | 295 | cd05474, SAP_like, SAPs, pepsin-like proteinases s | 1e-12 | |
| PTZ00013 | 450 | PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisiona | 6e-12 | |
| cd06097 | 278 | cd06097, Aspergillopepsin_like, Aspergillopepsin_l | 4e-11 | |
| pfam03489 | 35 | pfam03489, SapB_2, Saposin-like type B, region 2 | 1e-10 | |
| pfam05184 | 39 | pfam05184, SapB_1, Saposin-like type B, region 1 | 5e-10 | |
| smart00741 | 76 | smart00741, SapB, Saposin (B) Domains | 8e-08 | |
| PTZ00147 | 453 | PTZ00147, PTZ00147, plasmepsin-1; Provisional | 7e-07 | |
| cd05471 | 283 | cd05471, pepsin_like, Pepsin-like aspartic proteas | 8e-07 | |
| cd06096 | 326 | cd06096, Plasmepsin_5, Plasmepsins are a class of | 1e-05 | |
| PTZ00013 | 450 | PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisiona | 3e-04 | |
| smart00741 | 76 | smart00741, SapB, Saposin (B) Domains | 0.001 |
| >gnl|CDD|133162 cd06098, phytepsin, Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
Score = 298 bits (764), Expect = 1e-99
Identities = 112/140 (80%), Positives = 127/140 (90%)
Query: 53 QVFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLVSEEVFSFWLNRD 112
QVFIEAT+E LTFLLA+FDGI+GLGF+EI+VG AVPVW NMVEQGLV E VFSFWLNR+
Sbjct: 97 QVFIEATKEPGLTFLLAKFDGILGLGFQEISVGKAVPVWYNMVEQGLVKEPVFSFWLNRN 156
Query: 113 PDAEEGGEIVFGGVDPKHFKGKHTYVPVTKKGYWQFELGDILIGNQSTGVCEGGCAAIVD 172
PD EEGGE+VFGGVDPKHFKG+HTYVPVT+KGYWQFE+GD+LIG +STG C GGCAAI D
Sbjct: 157 PDEEEGGELVFGGVDPKHFKGEHTYVPVTRKGYWQFEMGDVLIGGKSTGFCAGGCAAIAD 216
Query: 173 SGTSLLAGPTPVVTEINHAI 192
SGTSLLAGPT +VT+IN A+
Sbjct: 217 SGTSLLAGPTTIVTQINSAV 236
|
Phytepsin, a plant homolog of mammalian lysosomal pepsins, resides in grains, roots, stems, leaves and flowers. Phytepsin may participate in metabolic turnover and in protein processing events. In addition, it highly expressed in several plant tissues undergoing apoptosis. Phytepsin contains an internal region consisting of about 100 residues not present in animal or microbial pepsins. This region is thus called a plant specific insert. The insert is highly similar to saponins, which are lysosomal sphingolipid-activating proteins in mammalian cells. The saponin-like domain may have a role in the vacuolar targeting of phytepsin. Phytepsin, as its animal counterparts, possesses a topology typical of all aspartic proteases. They are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localized between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. This family of aspartate proteases is classified by MEROPS as the peptidase family A1 (pepsin A, clan AA). Length = 317 |
| >gnl|CDD|133152 cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|215663 pfam00026, Asp, Eukaryotic aspartyl protease | Back alignment and domain information |
|---|
| >gnl|CDD|133162 cd06098, phytepsin, Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
| >gnl|CDD|133157 cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133138 cd05471, pepsin_like, Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >gnl|CDD|133145 cd05478, pepsin_A, Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >gnl|CDD|133153 cd05486, Cathespin_E, Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >gnl|CDD|133154 cd05487, renin_like, Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >gnl|CDD|133155 cd05488, Proteinase_A_fungi, Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|133144 cd05477, gastricsin, Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >gnl|CDD|133157 cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133152 cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|215663 pfam00026, Asp, Eukaryotic aspartyl protease | Back alignment and domain information |
|---|
| >gnl|CDD|133153 cd05486, Cathespin_E, Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >gnl|CDD|240300 PTZ00165, PTZ00165, aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133154 cd05487, renin_like, Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >gnl|CDD|133155 cd05488, Proteinase_A_fungi, Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240300 PTZ00165, PTZ00165, aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133140 cd05473, beta_secretase_like, Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease | Back alignment and domain information |
|---|
| >gnl|CDD|133145 cd05478, pepsin_A, Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >gnl|CDD|133144 cd05477, gastricsin, Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >gnl|CDD|140176 PTZ00147, PTZ00147, plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133141 cd05474, SAP_like, SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
| >gnl|CDD|140051 PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133161 cd06097, Aspergillopepsin_like, Aspergillopepsin_like, aspartic proteases of fungal origin | Back alignment and domain information |
|---|
| >gnl|CDD|112314 pfam03489, SapB_2, Saposin-like type B, region 2 | Back alignment and domain information |
|---|
| >gnl|CDD|191220 pfam05184, SapB_1, Saposin-like type B, region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|214797 smart00741, SapB, Saposin (B) Domains | Back alignment and domain information |
|---|
| >gnl|CDD|140176 PTZ00147, PTZ00147, plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133138 cd05471, pepsin_like, Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >gnl|CDD|133160 cd06096, Plasmepsin_5, Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite | Back alignment and domain information |
|---|
| >gnl|CDD|140051 PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214797 smart00741, SapB, Saposin (B) Domains | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 388 | |||
| cd05490 | 325 | Cathepsin_D2 Cathepsin_D2, pepsin family of protei | 100.0 | |
| cd05486 | 316 | Cathespin_E Cathepsin E, non-lysosomal aspartic pr | 100.0 | |
| PTZ00165 | 482 | aspartyl protease; Provisional | 100.0 | |
| cd05487 | 326 | renin_like Renin stimulates production of angioten | 100.0 | |
| cd06098 | 317 | phytepsin Phytepsin, a plant homolog of mammalian | 100.0 | |
| cd05485 | 329 | Cathepsin_D_like Cathepsin_D_like, pepsin family o | 100.0 | |
| cd05477 | 318 | gastricsin Gastricsins, asparate proteases produce | 100.0 | |
| cd05478 | 317 | pepsin_A Pepsin A, aspartic protease produced in g | 100.0 | |
| cd05488 | 320 | Proteinase_A_fungi Fungal Proteinase A , aspartic | 100.0 | |
| PF00026 | 317 | Asp: Eukaryotic aspartyl protease The Prosite entr | 100.0 | |
| PTZ00147 | 453 | plasmepsin-1; Provisional | 100.0 | |
| PTZ00013 | 450 | plasmepsin 4 (PM4); Provisional | 100.0 | |
| cd05474 | 295 | SAP_like SAPs, pepsin-like proteinases secreted fr | 100.0 | |
| cd06097 | 278 | Aspergillopepsin_like Aspergillopepsin_like, aspar | 100.0 | |
| cd05472 | 299 | cnd41_like Chloroplast Nucleoids DNA-binding Prote | 100.0 | |
| cd05473 | 364 | beta_secretase_like Beta-secretase, aspartic-acid | 100.0 | |
| cd06096 | 326 | Plasmepsin_5 Plasmepsins are a class of aspartic p | 100.0 | |
| cd05476 | 265 | pepsin_A_like_plant Chroloplast Nucleoids DNA-bind | 100.0 | |
| KOG1339 | 398 | consensus Aspartyl protease [Posttranslational mod | 100.0 | |
| cd05471 | 283 | pepsin_like Pepsin-like aspartic proteases, biloba | 100.0 | |
| cd05489 | 362 | xylanase_inhibitor_I_like TAXI-I inhibits degradat | 100.0 | |
| cd05475 | 273 | nucellin_like Nucellins, plant aspartic proteases | 100.0 | |
| PLN03146 | 431 | aspartyl protease family protein; Provisional | 99.96 | |
| PF14541 | 161 | TAXi_C: Xylanase inhibitor C-terminal; PDB: 3AUP_D | 99.71 | |
| PF14543 | 164 | TAXi_N: Xylanase inhibitor N-terminal; PDB: 3HD8_A | 98.51 | |
| PF03489 | 35 | SapB_2: Saposin-like type B, region 2; InterPro: I | 98.11 | |
| PF05184 | 39 | SapB_1: Saposin-like type B, region 1; InterPro: I | 97.88 | |
| cd05470 | 109 | pepsin_retropepsin_like Cellular and retroviral pe | 97.61 | |
| KOG1340 | 218 | consensus Prosaposin [Lipid transport and metaboli | 97.39 | |
| smart00741 | 76 | SapB Saposin (B) Domains. Present in multiple copi | 93.89 | |
| smart00741 | 76 | SapB Saposin (B) Domains. Present in multiple copi | 93.24 | |
| KOG1340 | 218 | consensus Prosaposin [Lipid transport and metaboli | 92.37 | |
| cd05479 | 124 | RP_DDI RP_DDI; retropepsin-like domain of DNA dama | 91.92 | |
| PF08284 | 135 | RVP_2: Retroviral aspartyl protease; InterPro: IPR | 89.89 | |
| TIGR02281 | 121 | clan_AA_DTGA clan AA aspartic protease, TIGR02281 | 85.0 | |
| PF13650 | 90 | Asp_protease_2: Aspartyl protease | 83.69 |
| >cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-45 Score=362.28 Aligned_cols=259 Identities=46% Similarity=0.886 Sum_probs=226.0
Q ss_pred eEEeeeeEEEEEEEeeeEEeecccceEeeCcEEEEEEeeCCccccccCccEEEeeccCccccCCCCchhhhhhhcCCCCc
Q 016530 23 RIRCVLVLIVHFLNWCPFTWQCACLQIFLLQVFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLVSE 102 (388)
Q Consensus 23 ~~~~~~~~~~g~~~~d~~~~~~~~~~~v~~~~Fg~~~~~~~~~f~~~~~dGIlGLg~~~~s~~~~~~~~~~L~~qg~i~~ 102 (388)
.|+|+.+.++|++++|+|+++ +.++++|.||+++.+++..|....+|||||||++.++....+|++++|++||+|++
T Consensus 67 ~i~Yg~G~~~G~~~~D~v~~g---~~~~~~~~Fg~~~~~~~~~~~~~~~dGilGLg~~~~s~~~~~~~~~~l~~~g~i~~ 143 (325)
T cd05490 67 AIQYGSGSLSGYLSQDTVSIG---GLQVEGQLFGEAVKQPGITFIAAKFDGILGMAYPRISVDGVTPVFDNIMAQKLVEQ 143 (325)
T ss_pred EEEECCcEEEEEEeeeEEEEC---CEEEcCEEEEEEeeccCCcccceeeeEEEecCCccccccCCCCHHHHHHhcCCCCC
Confidence 578988999999999999999 89999999999998766556666789999999999887778899999999999999
Q ss_pred ceEEEEecCCCCCCCCcEEEECCCCCCceecceeEeeecccceeEEEEccEEEcCeeeceecCCceEEEcCCCcCcccCH
Q 016530 103 EVFSFWLNRDPDAEEGGEIVFGGVDPKHFKGKHTYVPVTKKGYWQFELGDILIGNQSTGVCEGGCAAIVDSGTSLLAGPT 182 (388)
Q Consensus 103 ~~FSl~L~~~~~~~~~G~L~fGgid~~~~~g~l~~~pv~~~~~w~v~l~~i~vgg~~~~~~~~~~~aivDSGTs~i~lP~ 182 (388)
++||+||.++++....|+|+|||+|++++.|++.|+|+.+..||.|++++|+|++... .+..+..++|||||+++++|+
T Consensus 144 ~~FS~~L~~~~~~~~~G~l~~Gg~d~~~~~g~l~~~~~~~~~~w~v~l~~i~vg~~~~-~~~~~~~aiiDSGTt~~~~p~ 222 (325)
T cd05490 144 NVFSFYLNRDPDAQPGGELMLGGTDPKYYTGDLHYVNVTRKAYWQIHMDQVDVGSGLT-LCKGGCEAIVDTGTSLITGPV 222 (325)
T ss_pred CEEEEEEeCCCCCCCCCEEEECccCHHHcCCceEEEEcCcceEEEEEeeEEEECCeee-ecCCCCEEEECCCCccccCCH
Confidence 9999999876444457999999999999999999999998899999999999988743 234567899999999999999
Q ss_pred HHHHHHHHHhCCcceeecchhhhhhhhhhhHHHHHhhCCCchhhhhhccccccCCcccccccceeeeecccccCCCCccc
Q 016530 183 PVVTEINHAIGGEGVVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENVSAGDSAVC 262 (388)
Q Consensus 183 ~~~~~i~~~i~~~~~~~~~~~~~~~~y~~~i~~~l~~~~~p~~~c~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 262 (388)
+++++|.+++++.
T Consensus 223 ~~~~~l~~~~~~~------------------------------------------------------------------- 235 (325)
T cd05490 223 EEVRALQKAIGAV------------------------------------------------------------------- 235 (325)
T ss_pred HHHHHHHHHhCCc-------------------------------------------------------------------
Confidence 9999999988542
Q ss_pred chhhhhHHHHHHHhhhchhHHHHHHHhhhhccCCCCCCCceeecCCCCCCCCcEEEEECCEEEEeCcccceeeeccCccc
Q 016530 263 SACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPEQYILKTGEGIAE 342 (388)
Q Consensus 263 ~~~~~~~~~~~~~~~~~~t~~~i~~~~~~~c~~~p~~~~~~~v~C~~~~~lP~i~f~~gg~~~~l~p~~yi~~~~~~~~~ 342 (388)
+...+.|.++|+....+|+|+|+|+|+.++|+|++|+++.......
T Consensus 236 ----------------------------------~~~~~~~~~~C~~~~~~P~i~f~fgg~~~~l~~~~y~~~~~~~~~~ 281 (325)
T cd05490 236 ----------------------------------PLIQGEYMIDCEKIPTLPVISFSLGGKVYPLTGEDYILKVSQRGTT 281 (325)
T ss_pred ----------------------------------cccCCCEEecccccccCCCEEEEECCEEEEEChHHeEEeccCCCCC
Confidence 1123458899998888999999999999999999999976544456
Q ss_pred ceeEeeEeccCCCCCCCceEEcHhhhcceEEEEeCCCCeEEEEe
Q 016530 343 VCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAE 386 (388)
Q Consensus 343 ~C~~~i~~~d~~~~~~~~~ILG~~Flr~~y~VfD~~~~rIGfA~ 386 (388)
.|++.|+..+.+.+.++.||||++|||++|+|||++++|||||+
T Consensus 282 ~C~~~~~~~~~~~~~~~~~ilGd~flr~~y~vfD~~~~~IGfA~ 325 (325)
T cd05490 282 ICLSGFMGLDIPPPAGPLWILGDVFIGRYYTVFDRDNDRVGFAK 325 (325)
T ss_pred EEeeEEEECCCCCCCCceEEEChHhheeeEEEEEcCCcEeeccC
Confidence 89999988775544557899999999999999999999999996
|
Cathepsin D is the major aspartic proteinase of the lysosomal compartment where it functions in protein catabolism. It is a member of the pepsin family of proteinases. This enzyme is distinguished from other members of the pepsin family by two features that are characteristic of lysosomal hydrolases. First, mature Cathepsin D is found predominantly in a two-chain form due to a posttranslational cleavage event. Second, it contains phosphorylated, N-linked oligosaccharides that target the enzyme to lysosomes via mannose-6-phosphate receptors. Cathepsin D preferentially attacks peptide bonds flanked by bulky hydrophobic amino acids and its pH optimum is between pH 2.8 and 4.0. Two active site aspartic acid residues are essential for the catalytic activity of aspartic proteinases. Like other aspartic proteinases, Cathepsin D is a bilobed molecule; the two evolutionary related lobes are mostly made up of beta-sheets and flank |
| >cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >PTZ00165 aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
| >cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 | Back alignment and domain information |
|---|
| >PTZ00147 plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >PTZ00013 plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
| >cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin | Back alignment and domain information |
|---|
| >cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase | Back alignment and domain information |
|---|
| >cd05473 beta_secretase_like Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease | Back alignment and domain information |
|---|
| >cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite | Back alignment and domain information |
|---|
| >cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants | Back alignment and domain information |
|---|
| >KOG1339 consensus Aspartyl protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >cd05489 xylanase_inhibitor_I_like TAXI-I inhibits degradation of xylan in the cell wall | Back alignment and domain information |
|---|
| >cd05475 nucellin_like Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation | Back alignment and domain information |
|---|
| >PLN03146 aspartyl protease family protein; Provisional | Back alignment and domain information |
|---|
| >PF14541 TAXi_C: Xylanase inhibitor C-terminal; PDB: 3AUP_D 3HD8_A 1T6G_A 1T6E_X 2B42_A 3VLB_A 3VLA_A | Back alignment and domain information |
|---|
| >PF14543 TAXi_N: Xylanase inhibitor N-terminal; PDB: 3HD8_A 3VLB_A 3VLA_A 3AUP_D 1T6G_A 1T6E_X 2B42_A | Back alignment and domain information |
|---|
| >PF03489 SapB_2: Saposin-like type B, region 2; InterPro: IPR008138 Saposins are small lysosomal proteins that serve as activators of various lysosomal lipid-degrading enzymes [] | Back alignment and domain information |
|---|
| >PF05184 SapB_1: Saposin-like type B, region 1; InterPro: IPR007856 Synonym(s):cerebroside sulphate activator, CSAct Saposin B is a small non-enzymatic glycoprotein required for the breakdown of cerebroside sulphates (sulphatides) in lysosomes | Back alignment and domain information |
|---|
| >cd05470 pepsin_retropepsin_like Cellular and retroviral pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >KOG1340 consensus Prosaposin [Lipid transport and metabolism; Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >smart00741 SapB Saposin (B) Domains | Back alignment and domain information |
|---|
| >smart00741 SapB Saposin (B) Domains | Back alignment and domain information |
|---|
| >KOG1340 consensus Prosaposin [Lipid transport and metabolism; Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein | Back alignment and domain information |
|---|
| >PF08284 RVP_2: Retroviral aspartyl protease; InterPro: IPR013242 This region defines single domain aspartyl proteases from retroviruses, retrotransposons, and badnaviruses (plant dsDNA viruses) | Back alignment and domain information |
|---|
| >TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family | Back alignment and domain information |
|---|
| >PF13650 Asp_protease_2: Aspartyl protease | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 388 | ||||
| 1qdm_A | 478 | Crystal Structure Of Prophytepsin, A Zymogen Of A B | 1e-129 | ||
| 1b5f_A | 239 | Native Cardosin A From Cynara Cardunculus L. Length | 1e-48 | ||
| 1lya_B | 241 | Crystal Structures Of Native And Inhibited Forms Of | 3e-37 | ||
| 1lya_B | 241 | Crystal Structures Of Native And Inhibited Forms Of | 7e-25 | ||
| 3rfi_A | 108 | Crystal Structure Of The Saposin-Like Domain Of Pla | 3e-33 | ||
| 2x0b_A | 383 | Crystal Structure Of Human Angiotensinogen Complexe | 4e-32 | ||
| 2x0b_A | 383 | Crystal Structure Of Human Angiotensinogen Complexe | 8e-14 | ||
| 2bks_A | 340 | Crystal Structure Of Renin-Pf00074777 Complex Lengt | 5e-32 | ||
| 2bks_A | 340 | Crystal Structure Of Renin-Pf00074777 Complex Lengt | 8e-14 | ||
| 3d91_A | 341 | Human Renin In Complex With Remikiren Length = 341 | 5e-32 | ||
| 3d91_A | 341 | Human Renin In Complex With Remikiren Length = 341 | 7e-14 | ||
| 2g24_A | 333 | Ketopiperazine-Based Renin Inhibitors: Optimization | 5e-32 | ||
| 2g24_A | 333 | Ketopiperazine-Based Renin Inhibitors: Optimization | 8e-14 | ||
| 2i4q_A | 336 | Human ReninPF02342674 COMPLEX Length = 336 | 5e-32 | ||
| 2i4q_A | 336 | Human ReninPF02342674 COMPLEX Length = 336 | 8e-14 | ||
| 1hrn_A | 337 | High Resolution Crystal Structures Of Recombinant H | 6e-32 | ||
| 1hrn_A | 337 | High Resolution Crystal Structures Of Recombinant H | 8e-14 | ||
| 1tzs_A | 351 | Crystal Structure Of An Activation Intermediate Of | 2e-31 | ||
| 1tzs_A | 351 | Crystal Structure Of An Activation Intermediate Of | 4e-16 | ||
| 3vcm_A | 335 | Crystal Structure Of Human Prorenin Length = 335 | 3e-31 | ||
| 3vcm_A | 335 | Crystal Structure Of Human Prorenin Length = 335 | 9e-14 | ||
| 1smr_A | 335 | The 3-D Structure Of Mouse Submaxillary Renin Compl | 6e-28 | ||
| 1smr_A | 335 | The 3-D Structure Of Mouse Submaxillary Renin Compl | 4e-16 | ||
| 5pep_A | 326 | X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dim | 2e-26 | ||
| 5pep_A | 326 | X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dim | 2e-15 | ||
| 3psg_A | 370 | The High Resolution Crystal Structure Of Porcine Pe | 3e-26 | ||
| 3psg_A | 370 | The High Resolution Crystal Structure Of Porcine Pe | 4e-15 | ||
| 1psa_A | 326 | Structure Of A Pepsin(Slash)renin Inhibitor Complex | 3e-26 | ||
| 1psa_A | 326 | Structure Of A Pepsin(Slash)renin Inhibitor Complex | 3e-15 | ||
| 3pep_A | 326 | Revised 2.3 Angstroms Structure Of Porcine Pepsin. | 3e-26 | ||
| 3pep_A | 326 | Revised 2.3 Angstroms Structure Of Porcine Pepsin. | 4e-15 | ||
| 1f34_A | 326 | Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bou | 3e-26 | ||
| 1f34_A | 326 | Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bou | 3e-15 | ||
| 2psg_A | 370 | Refined Structure Of Porcine Pepsinogen At 1.8 Angs | 3e-26 | ||
| 2psg_A | 370 | Refined Structure Of Porcine Pepsinogen At 1.8 Angs | 4e-15 | ||
| 4pep_A | 326 | The Molecular And Crystal Structures Of Monoclinic | 3e-26 | ||
| 4pep_A | 326 | The Molecular And Crystal Structures Of Monoclinic | 4e-15 | ||
| 1b5f_B | 87 | Native Cardosin A From Cynara Cardunculus L. Length | 3e-25 | ||
| 1pso_E | 326 | The Crystal Structure Of Human Pepsin And Its Compl | 3e-25 | ||
| 1pso_E | 326 | The Crystal Structure Of Human Pepsin And Its Compl | 3e-13 | ||
| 1flh_A | 326 | Crystal Structure Of Human Uropepsin At 2.45 A Reso | 3e-25 | ||
| 1flh_A | 326 | Crystal Structure Of Human Uropepsin At 2.45 A Reso | 7e-13 | ||
| 1g0v_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 8e-25 | ||
| 1g0v_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 1e-09 | ||
| 1dp5_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 1e-24 | ||
| 1dp5_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 1e-09 | ||
| 2jxr_A | 329 | Structure Of Yeast Proteinase A Length = 329 | 1e-24 | ||
| 2jxr_A | 329 | Structure Of Yeast Proteinase A Length = 329 | 1e-09 | ||
| 1htr_B | 329 | Crystal And Molecular Structures Of Human Progastri | 2e-23 | ||
| 1htr_B | 329 | Crystal And Molecular Structures Of Human Progastri | 6e-11 | ||
| 1czi_E | 323 | Chymosin Complex With The Inhibitor Cp-113972 Lengt | 3e-23 | ||
| 1czi_E | 323 | Chymosin Complex With The Inhibitor Cp-113972 Lengt | 1e-09 | ||
| 3cms_A | 323 | Engineering Enzyme Sub-Site Specificity: Preparatio | 5e-23 | ||
| 3cms_A | 323 | Engineering Enzyme Sub-Site Specificity: Preparatio | 1e-09 | ||
| 4aa9_A | 320 | Camel Chymosin At 1.6a Resolution Length = 320 | 8e-23 | ||
| 4aa9_A | 320 | Camel Chymosin At 1.6a Resolution Length = 320 | 2e-09 | ||
| 1am5_A | 324 | The Crystal Structure And Proposed Amino Acid Seque | 2e-22 | ||
| 1am5_A | 324 | The Crystal Structure And Proposed Amino Acid Seque | 1e-10 | ||
| 3qrv_A | 336 | Crystal Structure Of Plasmepsin I (Pmi) From Plasmo | 5e-14 | ||
| 3qrv_A | 336 | Crystal Structure Of Plasmepsin I (Pmi) From Plasmo | 6e-05 | ||
| 3liz_A | 334 | Crystal Structure Of Bla G 2 Complexed With Fab 4c3 | 5e-14 | ||
| 3liz_A | 334 | Crystal Structure Of Bla G 2 Complexed With Fab 4c3 | 4e-07 | ||
| 1yg9_A | 330 | The Structure Of Mutant (N93q) Of Bla G 2 Length = | 5e-14 | ||
| 1yg9_A | 330 | The Structure Of Mutant (N93q) Of Bla G 2 Length = | 2e-07 | ||
| 3oad_B | 176 | Design And Optimization Of New Piperidines As Renin | 7e-14 | ||
| 3oad_A | 166 | Design And Optimization Of New Piperidines As Renin | 2e-13 | ||
| 2anl_A | 327 | X-Ray Crystal Structure Of The Aspartic Protease Pl | 7e-12 | ||
| 2anl_A | 327 | X-Ray Crystal Structure Of The Aspartic Protease Pl | 6e-04 | ||
| 1miq_A | 375 | Crystal Structure Of Proplasmepsin From The Human M | 8e-11 | ||
| 1miq_A | 375 | Crystal Structure Of Proplasmepsin From The Human M | 1e-04 | ||
| 3f9q_A | 329 | Re-Refinement Of Uncomplexed Plasmepsin Ii From Pla | 2e-10 | ||
| 3f9q_A | 329 | Re-Refinement Of Uncomplexed Plasmepsin Ii From Pla | 3e-04 | ||
| 1m43_A | 331 | Crystal Structure Of Pmii In Complex With Pepstatin | 2e-10 | ||
| 1m43_A | 331 | Crystal Structure Of Pmii In Complex With Pepstatin | 3e-04 | ||
| 1ls5_A | 328 | Crystal Structure Of Plasmepsin Iv From P. Falcipar | 3e-10 | ||
| 2bju_A | 453 | Plasmepsin Ii Complexed With A Highly Active Achira | 3e-10 | ||
| 2bju_A | 453 | Plasmepsin Ii Complexed With A Highly Active Achira | 3e-04 | ||
| 1qs8_B | 329 | Crystal Structure Of The P. Vivax Aspartic Proteina | 5e-10 | ||
| 1qs8_B | 329 | Crystal Structure Of The P. Vivax Aspartic Proteina | 1e-04 | ||
| 1pfz_A | 380 | Proplasmepsin Ii From Plasmodium Falciparum Length | 5e-10 | ||
| 1pfz_A | 380 | Proplasmepsin Ii From Plasmodium Falciparum Length | 3e-04 | ||
| 1sme_A | 329 | Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From P | 6e-10 | ||
| 1sme_A | 329 | Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From P | 3e-04 | ||
| 1lf3_A | 331 | Crystal Structure Of Plasmepsin Ii From P Falciparu | 6e-10 | ||
| 1lf3_A | 331 | Crystal Structure Of Plasmepsin Ii From P Falciparu | 3e-04 | ||
| 1uh7_A | 325 | Crystal Structure Of Rhizopuspepsin At Ph 4.6 Lengt | 8e-09 | ||
| 3apr_E | 325 | Binding Of A Reduced Peptide Inhibitor To The Aspar | 1e-08 | ||
| 1eag_A | 342 | Secreted Aspartic Proteinase (Sap2) From Candida Al | 2e-08 | ||
| 3qvc_A | 451 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 3e-08 | ||
| 3qvc_A | 451 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 3e-04 | ||
| 1zap_A | 342 | Secreted Aspartic Protease From C. Albicans Length | 4e-08 | ||
| 3fns_A | 332 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 4e-08 | ||
| 3fns_A | 332 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 2e-04 | ||
| 2ewy_A | 383 | Crystal Structure Of Human Bace2 In Complex With A | 4e-08 | ||
| 2h6s_A | 340 | Secreted Aspartic Proteinase (sap) 3 From Candida A | 1e-07 | ||
| 1j71_A | 334 | Structure Of The Extracellular Aspartic Proteinase | 2e-07 | ||
| 2qzw_A | 341 | Secreted Aspartic Proteinase (Sap) 1 From Candida A | 1e-06 | ||
| 1wkr_A | 340 | Crystal Structure Of Aspartic Proteinase From Irpex | 2e-06 | ||
| 2qzx_A | 342 | Secreted Aspartic Proteinase (Sap) 5 From Candida A | 3e-06 | ||
| 3fv3_A | 339 | Secreted Aspartic Protease 1 From Candida Parapsilo | 4e-06 | ||
| 3bra_A | 409 | Bace-1 Complexed With Compound 1 Length = 409 | 3e-05 | ||
| 4ewo_A | 386 | Design And Synthesis Of Potent Hydroxyethylamine (H | 4e-05 | ||
| 3cib_A | 390 | Structure Of Bace Bound To Sch727596 Length = 390 | 4e-05 | ||
| 2wjo_A | 412 | Human Bace (Beta Secretase) In Complex With Cyclohe | 4e-05 | ||
| 4dpf_A | 391 | Bace-1 In Complex With A Hea-Macrocyclic Type Inhib | 4e-05 | ||
| 2fdp_A | 388 | Crystal Structure Of Beta-Secretase Complexed With | 4e-05 | ||
| 1fkn_A | 391 | Structure Of Beta-Secretase Complexed With Inhibito | 4e-05 | ||
| 2zjk_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 4e-05 | ||
| 2zji_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 4e-05 | ||
| 1sgz_A | 389 | Crystal Structure Of Unbound Beta-Secretase Catalyt | 4e-05 | ||
| 3udh_A | 404 | Crystal Structure Of Bace With Compound 1 Length = | 4e-05 | ||
| 4b1d_A | 388 | New Aminoimidazoles As Bace-1 Inhibitors: From Rati | 4e-05 | ||
| 2hm1_A | 406 | Crystal Structure Of Human Beta-Secretase (Bace) In | 4e-05 | ||
| 3u6a_A | 390 | Rational Design And Synthesis Of Aminopiperazinones | 4e-05 | ||
| 1tqf_A | 405 | Crystal Structure Of Human Beta Secretase Complexed | 4e-05 | ||
| 3l58_A | 414 | Structure Of Bace Bound To Sch589432 Length = 414 | 4e-05 | ||
| 2zjh_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 4e-05 | ||
| 3exo_A | 413 | Crystal Structure Of Bace1 Bound To Inhibitor Lengt | 4e-05 | ||
| 2zhr_A | 411 | Crystal Structure Of Bace1 In Complex With Om99-2 A | 4e-05 | ||
| 3vv6_A | 416 | Crystal Structure Of Beta Secetase In Complex With | 4e-05 | ||
| 3ixk_A | 405 | Potent Beta-Secretase 1 Inhibitor Length = 405 | 4e-05 | ||
| 3kmx_A | 395 | Structure Of Bace Bound To Sch346572 Length = 395 | 4e-05 | ||
| 2of0_A | 402 | X-Ray Crystal Structure Of Beta Secretase Complexed | 4e-05 | ||
| 2qzl_A | 411 | Crystal Structure Of Human Beta Secretase Complexed | 5e-05 | ||
| 2zjn_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 5e-05 | ||
| 2qk5_A | 395 | Structure Of Bace1 Bound To Sch626485 Length = 395 | 5e-05 | ||
| 3dm6_A | 406 | Beta-Secretase 1 Complexed With Statine-Based Inhib | 5e-05 | ||
| 1ym2_A | 402 | Crystal Structure Of Human Beta Secretase Complexed | 5e-05 | ||
| 3r1g_B | 402 | Structure Basis Of Allosteric Inhibition Of Bace1 B | 5e-05 | ||
| 3ckp_A | 412 | Crystal Structure Of Bace-1 In Complex With Inhibit | 5e-05 | ||
| 1w50_A | 411 | Apo Structure Of Bace (beta Secretase) Length = 411 | 5e-05 | ||
| 3hvg_A | 411 | Structure Of Bace (Beta Secretase) In Complex With | 5e-05 | ||
| 3qi1_A | 408 | Design And Synthesis Of Hydroxyethylamine (Hea) Bac | 5e-05 | ||
| 3tpr_A | 433 | Crystal Structure Of Bace1 Complexed With An Inhibi | 5e-05 | ||
| 3tpj_A | 433 | Apo Structure Of Bace1 Length = 433 | 5e-05 | ||
| 2qu2_A | 415 | Bace1 With Compound 1 Length = 415 | 5e-05 | ||
| 1ym4_A | 408 | Crystal Structure Of Human Beta Secretase Complexed | 5e-05 | ||
| 2q15_A | 385 | Structure Of Bace Complexed To Compound 3a Length = | 6e-05 | ||
| 2q11_A | 388 | Structure Of Bace Complexed To Compound 1 Length = | 6e-05 | ||
| 2vie_A | 392 | Human Bace-1 In Complex With N-((1s,2r)-1-Benzyl-2- | 6e-05 | ||
| 2va5_A | 455 | X-Ray Crystal Structure Of Beta Secretase Complexed | 7e-05 | ||
| 3lpi_A | 455 | Structure Of Bace Bound To Sch745132 Length = 455 | 8e-05 | ||
| 2hiz_A | 455 | Crystal Structure Of Human Beta-Secretase (Bace) In | 8e-05 | ||
| 2zjj_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 2e-04 | ||
| 2rmp_A | 361 | Rmp-Pepstatin A Complex Length = 361 | 5e-04 |
| >pdb|1QDM|A Chain A, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley Vacuolar Aspartic Proteinase. Length = 478 | Back alignment and structure |
|
| >pdb|1B5F|A Chain A, Native Cardosin A From Cynara Cardunculus L. Length = 239 | Back alignment and structure |
| >pdb|1LYA|B Chain B, Crystal Structures Of Native And Inhibited Forms Of Human Cathepsin D: Implications For Lysosomal Targeting And Drug Design Length = 241 | Back alignment and structure |
| >pdb|1LYA|B Chain B, Crystal Structures Of Native And Inhibited Forms Of Human Cathepsin D: Implications For Lysosomal Targeting And Drug Design Length = 241 | Back alignment and structure |
| >pdb|3RFI|A Chain A, Crystal Structure Of The Saposin-Like Domain Of Plant Aspartic Protease From Solanum Tuberosum Length = 108 | Back alignment and structure |
| >pdb|2X0B|A Chain A, Crystal Structure Of Human Angiotensinogen Complexed With Renin Length = 383 | Back alignment and structure |
| >pdb|2X0B|A Chain A, Crystal Structure Of Human Angiotensinogen Complexed With Renin Length = 383 | Back alignment and structure |
| >pdb|2BKS|A Chain A, Crystal Structure Of Renin-Pf00074777 Complex Length = 340 | Back alignment and structure |
| >pdb|2BKS|A Chain A, Crystal Structure Of Renin-Pf00074777 Complex Length = 340 | Back alignment and structure |
| >pdb|3D91|A Chain A, Human Renin In Complex With Remikiren Length = 341 | Back alignment and structure |
| >pdb|3D91|A Chain A, Human Renin In Complex With Remikiren Length = 341 | Back alignment and structure |
| >pdb|2G24|A Chain A, Ketopiperazine-Based Renin Inhibitors: Optimization Of The "c" Ring Length = 333 | Back alignment and structure |
| >pdb|2G24|A Chain A, Ketopiperazine-Based Renin Inhibitors: Optimization Of The "c" Ring Length = 333 | Back alignment and structure |
| >pdb|2I4Q|A Chain A, Human ReninPF02342674 COMPLEX Length = 336 | Back alignment and structure |
| >pdb|2I4Q|A Chain A, Human ReninPF02342674 COMPLEX Length = 336 | Back alignment and structure |
| >pdb|1HRN|A Chain A, High Resolution Crystal Structures Of Recombinant Human Renin In Complex With Polyhydroxymonoamide Inhibitors Length = 337 | Back alignment and structure |
| >pdb|1HRN|A Chain A, High Resolution Crystal Structures Of Recombinant Human Renin In Complex With Polyhydroxymonoamide Inhibitors Length = 337 | Back alignment and structure |
| >pdb|1TZS|A Chain A, Crystal Structure Of An Activation Intermediate Of Cathepsin E Length = 351 | Back alignment and structure |
| >pdb|1TZS|A Chain A, Crystal Structure Of An Activation Intermediate Of Cathepsin E Length = 351 | Back alignment and structure |
| >pdb|3VCM|A Chain A, Crystal Structure Of Human Prorenin Length = 335 | Back alignment and structure |
| >pdb|3VCM|A Chain A, Crystal Structure Of Human Prorenin Length = 335 | Back alignment and structure |
| >pdb|1SMR|A Chain A, The 3-D Structure Of Mouse Submaxillary Renin Complexed With A Decapeptide Inhibitor Ch-66 Based On The 4-16 Fragment Of Rat Angiotensinogen Length = 335 | Back alignment and structure |
| >pdb|1SMR|A Chain A, The 3-D Structure Of Mouse Submaxillary Renin Complexed With A Decapeptide Inhibitor Ch-66 Based On The 4-16 Fragment Of Rat Angiotensinogen Length = 335 | Back alignment and structure |
| >pdb|5PEP|A Chain A, X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dimensional Structure Of The Hexagonal Crystal Form Of Porcine Pepsin At 2.3 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|5PEP|A Chain A, X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dimensional Structure Of The Hexagonal Crystal Form Of Porcine Pepsin At 2.3 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|3PSG|A Chain A, The High Resolution Crystal Structure Of Porcine Pepsinogen Length = 370 | Back alignment and structure |
| >pdb|3PSG|A Chain A, The High Resolution Crystal Structure Of Porcine Pepsinogen Length = 370 | Back alignment and structure |
| >pdb|1PSA|A Chain A, Structure Of A Pepsin(Slash)renin Inhibitor Complex Reveals A Novel Crystal Packing Induced By Minor Chemical Alterations In The Inhibitor Length = 326 | Back alignment and structure |
| >pdb|1PSA|A Chain A, Structure Of A Pepsin(Slash)renin Inhibitor Complex Reveals A Novel Crystal Packing Induced By Minor Chemical Alterations In The Inhibitor Length = 326 | Back alignment and structure |
| >pdb|3PEP|A Chain A, Revised 2.3 Angstroms Structure Of Porcine Pepsin. Evidence For A Flexible Subdomain Length = 326 | Back alignment and structure |
| >pdb|3PEP|A Chain A, Revised 2.3 Angstroms Structure Of Porcine Pepsin. Evidence For A Flexible Subdomain Length = 326 | Back alignment and structure |
| >pdb|1F34|A Chain A, Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bound To Porcine Pepsin Length = 326 | Back alignment and structure |
| >pdb|1F34|A Chain A, Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bound To Porcine Pepsin Length = 326 | Back alignment and structure |
| >pdb|2PSG|A Chain A, Refined Structure Of Porcine Pepsinogen At 1.8 Angstroms Resolution Length = 370 | Back alignment and structure |
| >pdb|2PSG|A Chain A, Refined Structure Of Porcine Pepsinogen At 1.8 Angstroms Resolution Length = 370 | Back alignment and structure |
| >pdb|4PEP|A Chain A, The Molecular And Crystal Structures Of Monoclinic Porcine Pepsin Refined At 1.8 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|4PEP|A Chain A, The Molecular And Crystal Structures Of Monoclinic Porcine Pepsin Refined At 1.8 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|1B5F|B Chain B, Native Cardosin A From Cynara Cardunculus L. Length = 87 | Back alignment and structure |
| >pdb|1PSO|E Chain E, The Crystal Structure Of Human Pepsin And Its Complex With Pepstatin Length = 326 | Back alignment and structure |
| >pdb|1PSO|E Chain E, The Crystal Structure Of Human Pepsin And Its Complex With Pepstatin Length = 326 | Back alignment and structure |
| >pdb|1FLH|A Chain A, Crystal Structure Of Human Uropepsin At 2.45 A Resolution Length = 326 | Back alignment and structure |
| >pdb|1FLH|A Chain A, Crystal Structure Of Human Uropepsin At 2.45 A Resolution Length = 326 | Back alignment and structure |
| >pdb|1G0V|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant, Mvv Length = 329 | Back alignment and structure |
| >pdb|1G0V|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant, Mvv Length = 329 | Back alignment and structure |
| >pdb|1DP5|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant Inhibitor Length = 329 | Back alignment and structure |
| >pdb|1DP5|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant Inhibitor Length = 329 | Back alignment and structure |
| >pdb|2JXR|A Chain A, Structure Of Yeast Proteinase A Length = 329 | Back alignment and structure |
| >pdb|2JXR|A Chain A, Structure Of Yeast Proteinase A Length = 329 | Back alignment and structure |
| >pdb|1HTR|B Chain B, Crystal And Molecular Structures Of Human Progastricsin At 1.62 Angstroms Resolution Length = 329 | Back alignment and structure |
| >pdb|1HTR|B Chain B, Crystal And Molecular Structures Of Human Progastricsin At 1.62 Angstroms Resolution Length = 329 | Back alignment and structure |
| >pdb|1CZI|E Chain E, Chymosin Complex With The Inhibitor Cp-113972 Length = 323 | Back alignment and structure |
| >pdb|1CZI|E Chain E, Chymosin Complex With The Inhibitor Cp-113972 Length = 323 | Back alignment and structure |
| >pdb|3CMS|A Chain A, Engineering Enzyme Sub-Site Specificity: Preparation, Kinetic Characterization And X-Ray Analysis At 2.0-Angstroms Resolution Of Val111phe Site-Mutated Calf Chymosin Length = 323 | Back alignment and structure |
| >pdb|3CMS|A Chain A, Engineering Enzyme Sub-Site Specificity: Preparation, Kinetic Characterization And X-Ray Analysis At 2.0-Angstroms Resolution Of Val111phe Site-Mutated Calf Chymosin Length = 323 | Back alignment and structure |
| >pdb|4AA9|A Chain A, Camel Chymosin At 1.6a Resolution Length = 320 | Back alignment and structure |
| >pdb|4AA9|A Chain A, Camel Chymosin At 1.6a Resolution Length = 320 | Back alignment and structure |
| >pdb|1AM5|A Chain A, The Crystal Structure And Proposed Amino Acid Sequence Of A Pepsin From Atlantic Cod (Gadus Morhua) Length = 324 | Back alignment and structure |
| >pdb|1AM5|A Chain A, The Crystal Structure And Proposed Amino Acid Sequence Of A Pepsin From Atlantic Cod (Gadus Morhua) Length = 324 | Back alignment and structure |
| >pdb|3QRV|A Chain A, Crystal Structure Of Plasmepsin I (Pmi) From Plasmodium Falciparum Length = 336 | Back alignment and structure |
| >pdb|3QRV|A Chain A, Crystal Structure Of Plasmepsin I (Pmi) From Plasmodium Falciparum Length = 336 | Back alignment and structure |
| >pdb|3LIZ|A Chain A, Crystal Structure Of Bla G 2 Complexed With Fab 4c3 Length = 334 | Back alignment and structure |
| >pdb|3LIZ|A Chain A, Crystal Structure Of Bla G 2 Complexed With Fab 4c3 Length = 334 | Back alignment and structure |
| >pdb|1YG9|A Chain A, The Structure Of Mutant (N93q) Of Bla G 2 Length = 330 | Back alignment and structure |
| >pdb|1YG9|A Chain A, The Structure Of Mutant (N93q) Of Bla G 2 Length = 330 | Back alignment and structure |
| >pdb|3OAD|B Chain B, Design And Optimization Of New Piperidines As Renin Inhibitors Length = 176 | Back alignment and structure |
| >pdb|3OAD|A Chain A, Design And Optimization Of New Piperidines As Renin Inhibitors Length = 166 | Back alignment and structure |
| >pdb|2ANL|A Chain A, X-Ray Crystal Structure Of The Aspartic Protease Plasmepsin 4 From The Malarial Parasite Plasmodium Malariae Bound To An Allophenylnorstatine Based Inhibitor Length = 327 | Back alignment and structure |
| >pdb|2ANL|A Chain A, X-Ray Crystal Structure Of The Aspartic Protease Plasmepsin 4 From The Malarial Parasite Plasmodium Malariae Bound To An Allophenylnorstatine Based Inhibitor Length = 327 | Back alignment and structure |
| >pdb|1MIQ|A Chain A, Crystal Structure Of Proplasmepsin From The Human Malarial Pathogen Plasmodium Vivax Length = 375 | Back alignment and structure |
| >pdb|1MIQ|A Chain A, Crystal Structure Of Proplasmepsin From The Human Malarial Pathogen Plasmodium Vivax Length = 375 | Back alignment and structure |
| >pdb|3F9Q|A Chain A, Re-Refinement Of Uncomplexed Plasmepsin Ii From Plasmodium Falciparum Length = 329 | Back alignment and structure |
| >pdb|3F9Q|A Chain A, Re-Refinement Of Uncomplexed Plasmepsin Ii From Plasmodium Falciparum Length = 329 | Back alignment and structure |
| >pdb|1M43|A Chain A, Crystal Structure Of Pmii In Complex With Pepstatin A To 2.4 A Length = 331 | Back alignment and structure |
| >pdb|1M43|A Chain A, Crystal Structure Of Pmii In Complex With Pepstatin A To 2.4 A Length = 331 | Back alignment and structure |
| >pdb|1LS5|A Chain A, Crystal Structure Of Plasmepsin Iv From P. Falciparum In Complex With Pepstatin A Length = 328 | Back alignment and structure |
| >pdb|2BJU|A Chain A, Plasmepsin Ii Complexed With A Highly Active Achiral Inhibitor Length = 453 | Back alignment and structure |
| >pdb|2BJU|A Chain A, Plasmepsin Ii Complexed With A Highly Active Achiral Inhibitor Length = 453 | Back alignment and structure |
| >pdb|1PFZ|A Chain A, Proplasmepsin Ii From Plasmodium Falciparum Length = 380 | Back alignment and structure |
| >pdb|1PFZ|A Chain A, Proplasmepsin Ii From Plasmodium Falciparum Length = 380 | Back alignment and structure |
| >pdb|1SME|A Chain A, Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From Plasmodium Falciparum, In Complex With Pepstatin A Length = 329 | Back alignment and structure |
| >pdb|1SME|A Chain A, Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From Plasmodium Falciparum, In Complex With Pepstatin A Length = 329 | Back alignment and structure |
| >pdb|1LF3|A Chain A, Crystal Structure Of Plasmepsin Ii From P Falciparum In Complex With Inhibitor Eh58 Length = 331 | Back alignment and structure |
| >pdb|1LF3|A Chain A, Crystal Structure Of Plasmepsin Ii From P Falciparum In Complex With Inhibitor Eh58 Length = 331 | Back alignment and structure |
| >pdb|1UH7|A Chain A, Crystal Structure Of Rhizopuspepsin At Ph 4.6 Length = 325 | Back alignment and structure |
| >pdb|3APR|E Chain E, Binding Of A Reduced Peptide Inhibitor To The Aspartic Proteinase From Rhizopus Chinensis. Implications For A Mechanism Of Action Length = 325 | Back alignment and structure |
| >pdb|1EAG|A Chain A, Secreted Aspartic Proteinase (Sap2) From Candida Albicans Complexed With A70450 Length = 342 | Back alignment and structure |
| >pdb|3QVC|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) Zymogen From Plasmodium Falciparum Length = 451 | Back alignment and structure |
| >pdb|3QVC|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) Zymogen From Plasmodium Falciparum Length = 451 | Back alignment and structure |
| >pdb|1ZAP|A Chain A, Secreted Aspartic Protease From C. Albicans Length = 342 | Back alignment and structure |
| >pdb|3FNS|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) From Plasmodium Falciparum Length = 332 | Back alignment and structure |
| >pdb|3FNS|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) From Plasmodium Falciparum Length = 332 | Back alignment and structure |
| >pdb|2EWY|A Chain A, Crystal Structure Of Human Bace2 In Complex With A Hydroxyethylenamine Transition-State Inhibitor Length = 383 | Back alignment and structure |
| >pdb|2H6S|A Chain A, Secreted Aspartic Proteinase (sap) 3 From Candida Albicans Length = 340 | Back alignment and structure |
| >pdb|1J71|A Chain A, Structure Of The Extracellular Aspartic Proteinase From Candida Tropicalis Yeast Length = 334 | Back alignment and structure |
| >pdb|2QZW|A Chain A, Secreted Aspartic Proteinase (Sap) 1 From Candida Albicans Length = 341 | Back alignment and structure |
| >pdb|1WKR|A Chain A, Crystal Structure Of Aspartic Proteinase From Irpex Lacteus Length = 340 | Back alignment and structure |
| >pdb|2QZX|A Chain A, Secreted Aspartic Proteinase (Sap) 5 From Candida Albicans Length = 342 | Back alignment and structure |
| >pdb|3FV3|A Chain A, Secreted Aspartic Protease 1 From Candida Parapsilosis In Complex With Pepstatin A Length = 339 | Back alignment and structure |
| >pdb|3BRA|A Chain A, Bace-1 Complexed With Compound 1 Length = 409 | Back alignment and structure |
| >pdb|4EWO|A Chain A, Design And Synthesis Of Potent Hydroxyethylamine (Hea) Bace-1 Inhibitors Length = 386 | Back alignment and structure |
| >pdb|3CIB|A Chain A, Structure Of Bace Bound To Sch727596 Length = 390 | Back alignment and structure |
| >pdb|2WJO|A Chain A, Human Bace (Beta Secretase) In Complex With Cyclohexanecarboxylic Acid (2-(2-Am Ino-6-Phenoxy-4h- Quinazolin-3-Yl)-2-Cyclohexyl-Ethyl)-Amide Length = 412 | Back alignment and structure |
| >pdb|4DPF|A Chain A, Bace-1 In Complex With A Hea-Macrocyclic Type Inhibitor Length = 391 | Back alignment and structure |
| >pdb|2FDP|A Chain A, Crystal Structure Of Beta-Secretase Complexed With An Amino- Ethylene Inhibitor Length = 388 | Back alignment and structure |
| >pdb|1FKN|A Chain A, Structure Of Beta-Secretase Complexed With Inhibitor Length = 391 | Back alignment and structure |
| >pdb|2ZJK|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With 4-(4-Fluoro-Benzyl)-Piperazine-2-Carboxylic Acid(3-Mercapto-Propyl)-Amide Length = 405 | Back alignment and structure |
| >pdb|2ZJI|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With N-[1-(2, 6-Dimethoxy-Benzyl)-Piperidin-4-Yl]-4-Mercapto- Butyramide Length = 405 | Back alignment and structure |
| >pdb|1SGZ|A Chain A, Crystal Structure Of Unbound Beta-Secretase Catalytic Domain. Length = 389 | Back alignment and structure |
| >pdb|3UDH|A Chain A, Crystal Structure Of Bace With Compound 1 Length = 404 | Back alignment and structure |
| >pdb|4B1D|A Chain A, New Aminoimidazoles As Bace-1 Inhibitors: From Rational Design To Ab-Lowering In Brain Length = 388 | Back alignment and structure |
| >pdb|2HM1|A Chain A, Crystal Structure Of Human Beta-Secretase (Bace) In The Presence Of An Inhibitor (2) Length = 406 | Back alignment and structure |
| >pdb|3U6A|A Chain A, Rational Design And Synthesis Of Aminopiperazinones As Beta Secretase (Bace) Inhibitors Length = 390 | Back alignment and structure |
| >pdb|1TQF|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Inhibitor Length = 405 | Back alignment and structure |
| >pdb|3L58|A Chain A, Structure Of Bace Bound To Sch589432 Length = 414 | Back alignment and structure |
| >pdb|2ZJH|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With N-(1-Benzyl-Piperidin-4-Yl)-4-Mercapto-Butyramide Length = 405 | Back alignment and structure |
| >pdb|3EXO|A Chain A, Crystal Structure Of Bace1 Bound To Inhibitor Length = 413 | Back alignment and structure |
| >pdb|2ZHR|A Chain A, Crystal Structure Of Bace1 In Complex With Om99-2 At Ph 5.0 Length = 411 | Back alignment and structure |
| >pdb|3VV6|A Chain A, Crystal Structure Of Beta Secetase In Complex With 2-Amino-3-Methyl-6- ((1s, 2r)-2-Phenylcyclopropyl)pyrimidin-4(3h)-One Length = 416 | Back alignment and structure |
| >pdb|3IXK|A Chain A, Potent Beta-Secretase 1 Inhibitor Length = 405 | Back alignment and structure |
| >pdb|3KMX|A Chain A, Structure Of Bace Bound To Sch346572 Length = 395 | Back alignment and structure |
| >pdb|2OF0|A Chain A, X-Ray Crystal Structure Of Beta Secretase Complexed With Compound 5 Length = 402 | Back alignment and structure |
| >pdb|2QZL|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Ixs Length = 411 | Back alignment and structure |
| >pdb|2ZJN|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With N-[1-(5-Chloro-2-Isopropoxy-3-Methoxy-Benzyl)- Piperidin-4-Yl]-2-(2-Methyl-4-Sulfamoyl-Phenoxy)- Acetamide Length = 405 | Back alignment and structure |
| >pdb|2QK5|A Chain A, Structure Of Bace1 Bound To Sch626485 Length = 395 | Back alignment and structure |
| >pdb|3DM6|A Chain A, Beta-Secretase 1 Complexed With Statine-Based Inhibitor Length = 406 | Back alignment and structure |
| >pdb|1YM2|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Nvp-Aur200 Length = 402 | Back alignment and structure |
| >pdb|3R1G|B Chain B, Structure Basis Of Allosteric Inhibition Of Bace1 By An Exosite- Binding Antibody Length = 402 | Back alignment and structure |
| >pdb|3CKP|A Chain A, Crystal Structure Of Bace-1 In Complex With Inhibitor Length = 412 | Back alignment and structure |
| >pdb|1W50|A Chain A, Apo Structure Of Bace (beta Secretase) Length = 411 | Back alignment and structure |
| >pdb|3HVG|A Chain A, Structure Of Bace (Beta Secretase) In Complex With Ev0 Length = 411 | Back alignment and structure |
| >pdb|3QI1|A Chain A, Design And Synthesis Of Hydroxyethylamine (Hea) Bace-1 Inhibitors: Prime Side Chromane-Containing Inhibitors Length = 408 | Back alignment and structure |
| >pdb|3TPR|A Chain A, Crystal Structure Of Bace1 Complexed With An Inhibitor Length = 433 | Back alignment and structure |
| >pdb|3TPJ|A Chain A, Apo Structure Of Bace1 Length = 433 | Back alignment and structure |
| >pdb|2QU2|A Chain A, Bace1 With Compound 1 Length = 415 | Back alignment and structure |
| >pdb|1YM4|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Nvp-Amk640 Length = 408 | Back alignment and structure |
| >pdb|2Q15|A Chain A, Structure Of Bace Complexed To Compound 3a Length = 385 | Back alignment and structure |
| >pdb|2Q11|A Chain A, Structure Of Bace Complexed To Compound 1 Length = 388 | Back alignment and structure |
| >pdb|2VIE|A Chain A, Human Bace-1 In Complex With N-((1s,2r)-1-Benzyl-2-Hydroxy- 3-((1,1, 5-Trimethylhexyl)amino)propyl)-3-(Ethylamino)-5-(2- Oxopyrrolidin-1-Yl)benzamide Length = 392 | Back alignment and structure |
| >pdb|2VA5|A Chain A, X-Ray Crystal Structure Of Beta Secretase Complexed With Compound 8c Length = 455 | Back alignment and structure |
| >pdb|3LPI|A Chain A, Structure Of Bace Bound To Sch745132 Length = 455 | Back alignment and structure |
| >pdb|2HIZ|A Chain A, Crystal Structure Of Human Beta-Secretase (Bace) In The Presence Of An Inhibitor Length = 455 | Back alignment and structure |
| >pdb|2ZJJ|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With 4-(4-Fluoro-Benzyl)-Piperazine-2-Carboxylic Acid (2-Mercapto-Ethyl)- Amide Length = 405 | Back alignment and structure |
| >pdb|2RMP|A Chain A, Rmp-Pepstatin A Complex Length = 361 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 388 | |||
| 1qdm_A | 478 | Prophytepsin; aspartic proteinases, saposin-like d | 1e-145 | |
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 5e-74 | |
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 8e-40 | |
| 1b5f_A | 239 | Protein (cardosin A); hydrolase, aspartic proteina | 2e-73 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 6e-71 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 9e-37 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 8e-71 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 3e-37 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 4e-68 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 2e-36 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 8e-68 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 7e-38 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 1e-67 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 1e-29 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 9e-67 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 1e-37 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 2e-65 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 6e-35 | |
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 2e-65 | |
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 2e-38 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 4e-64 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 2e-30 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 1e-61 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 3e-27 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 5e-61 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 1e-26 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 1e-60 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 2e-33 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 2e-60 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 2e-31 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 3e-60 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 3e-35 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 8e-60 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 3e-23 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 5e-58 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 1e-23 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 1e-57 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 3e-30 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 7e-57 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 2e-23 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 9e-56 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 2e-25 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 1e-55 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 3e-25 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 4e-55 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 2e-27 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 1e-54 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 2e-23 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 4e-54 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 2e-19 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 1e-51 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 2e-25 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 3e-51 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 1e-25 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 9e-51 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 4e-26 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 3e-49 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 4e-24 | |
| 1b5f_B | 87 | Protein (cardosin A); hydrolase, aspartic proteina | 5e-41 | |
| 3rfi_A | 108 | Asp; PSI, saposin, hydrolase; 1.90A {Solanum tuber | 2e-40 | |
| 2qyp_A | 91 | Proactivator polypeptide; saposin, activator prote | 3e-13 | |
| 2qyp_A | 91 | Proactivator polypeptide; saposin, activator prote | 4e-08 | |
| 3bqp_A | 80 | Proactivator polypeptide; saposin, sphingolipid ac | 4e-13 | |
| 3bqp_A | 80 | Proactivator polypeptide; saposin, sphingolipid ac | 3e-08 | |
| 2gtg_A | 83 | Proactivator polypeptide; saposin, sphingolipid ac | 1e-12 | |
| 2gtg_A | 83 | Proactivator polypeptide; saposin, sphingolipid ac | 6e-08 | |
| 4ddj_A | 83 | Saposin-A, protein A; saposin fold, sphingolipid a | 5e-08 | |
| 4ddj_A | 83 | Saposin-A, protein A; saposin fold, sphingolipid a | 2e-06 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 4e-07 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 5e-07 | |
| 3vla_A | 413 | EDGP; extracellular, inhibitor, plant protein; HET | 5e-07 | |
| 1nkl_A | 78 | NK-lysin; saposin fold, antibacterial peptide, tum | 6e-07 | |
| 1t6e_X | 381 | Xylanase inhibitor; two beta-barrel domain structu | 3e-06 | |
| 1n69_A | 81 | Saposin B; lipid binding protein, glycosphingolipi | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 2js9_A | 99 | Saposin-like protein family protein 5; caenopore-5 | 2e-04 |
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Length = 478 | Back alignment and structure |
|---|
Score = 420 bits (1081), Expect = e-145
Identities = 220/339 (64%), Positives = 271/339 (79%), Gaps = 3/339 (0%)
Query: 53 QVFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLVSEEVFSFWLNRD 112
Q FIEAT+E +TFL+A+FDGI+GLGF+EI+VG AVPVW M+EQGLVS+ VFSFWLNR
Sbjct: 140 QEFIEATKEPGITFLVAKFDGILGLGFKEISVGKAVPVWYKMIEQGLVSDPVFSFWLNRH 199
Query: 113 PDAEEGGEIVFGGVDPKHFKGKHTYVPVTKKGYWQFELGDILIGNQSTGVCEGGCAAIVD 172
D EGGEI+FGG+DPKH+ G+HTYVPVT+KGYWQF++GD+L+G +STG C GGCAAI D
Sbjct: 200 VDEGEGGEIIFGGMDPKHYVGEHTYVPVTQKGYWQFDMGDVLVGGKSTGFCAGGCAAIAD 259
Query: 173 SGTSLLAGPTPVVTEINHAIGGEGVVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGL 232
SGTSLLAGPT ++TEIN IG GVVS ECK +VSQYG I DLL++ P+K+C Q+GL
Sbjct: 260 SGTSLLAGPTAIITEINEKIGAAGVVSQECKTIVSQYGQQILDLLLAETQPKKICSQVGL 319
Query: 233 CAFNGAEYVSTGIKTVVEK---ENVSAGDSAVCSACEMAVVWVQNQLKQKQTKEKVLSYI 289
C F+G VS GI++VV+ ++ +CSACEMAVVW+QNQL Q +T++ +L Y+
Sbjct: 320 CTFDGTRGVSAGIRSVVDDEPVKSNGLRADPMCSACEMAVVWMQNQLAQNKTQDLILDYV 379
Query: 290 NELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPEQYILKTGEGIAEVCISGFM 349
N+LC+ LP+PMGES +DC + +MP++ FTIG K F L PE+YILK GEG A CISGF
Sbjct: 380 NQLCNRLPSPMGESAVDCGSLGSMPDIEFTIGGKKFALKPEEYILKVGEGAAAQCISGFT 439
Query: 350 AFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAEAA 388
A D+PPPRGPLWILGDVFMG YHTVFD GKLRIGFA+AA
Sbjct: 440 AMDIPPPRGPLWILGDVFMGPYHTVFDYGKLRIGFAKAA 478
|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Length = 241 | Back alignment and structure |
|---|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Length = 241 | Back alignment and structure |
|---|
| >1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Length = 239 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Length = 329 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Length = 329 | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Length = 351 | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Length = 351 | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Length = 329 | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Length = 329 | Back alignment and structure |
|---|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Length = 323 | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Length = 323 | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Length = 341 | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Length = 341 | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Length = 324 | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Length = 324 | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Length = 370 | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Length = 370 | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Length = 330 | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Length = 330 | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Length = 325 | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Length = 325 | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Length = 361 | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Length = 361 | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Length = 375 | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Length = 375 | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Length = 451 | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Length = 451 | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Length = 453 | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Length = 453 | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Length = 455 | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Length = 455 | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Length = 340 | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Length = 340 | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Length = 395 | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Length = 395 | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Length = 329 | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Length = 329 | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Length = 342 | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Length = 342 | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Length = 342 | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Length = 342 | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Length = 329 | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Length = 329 | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Length = 334 | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Length = 334 | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} PDB: 3tne_A* Length = 339 | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} PDB: 3tne_A* Length = 339 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Length = 323 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Length = 323 | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Length = 325 | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Length = 325 | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Length = 323 | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Length = 323 | Back alignment and structure |
|---|
| >1b5f_B Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Length = 87 | Back alignment and structure |
|---|
| >3rfi_A Asp; PSI, saposin, hydrolase; 1.90A {Solanum tuberosum} Length = 108 | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A Length = 91 | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A Length = 91 | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A Length = 80 | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A Length = 80 | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A Length = 83 | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A Length = 83 | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* Length = 83 | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* Length = 83 | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Length = 403 | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Length = 403 | Back alignment and structure |
|---|
| >3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A Length = 413 | Back alignment and structure |
|---|
| >1nkl_A NK-lysin; saposin fold, antibacterial peptide, tumourolytic peptide; NMR {Sus scrofa} SCOP: a.64.1.1 Length = 78 | Back alignment and structure |
|---|
| >1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A Length = 381 | Back alignment and structure |
|---|
| >1n69_A Saposin B; lipid binding protein, glycosphingolipid activator protein; HET: PEH; 2.20A {Homo sapiens} SCOP: a.64.1.3 Length = 81 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2js9_A Saposin-like protein family protein 5; caenopore-5, saposin-like fold, antimicrobial protein; NMR {Caenorhabditis elegans} PDB: 2jsa_A Length = 99 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 388 | |||
| 1qdm_A | 478 | Prophytepsin; aspartic proteinases, saposin-like d | 100.0 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 100.0 | |
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 100.0 | |
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 100.0 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 100.0 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 100.0 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 100.0 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 100.0 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 100.0 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 100.0 | |
| 4aa9_A | 320 | Chymosin; hydrolase, aspartic peptidase, rennet; H | 100.0 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 100.0 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 100.0 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 100.0 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 100.0 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 100.0 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 100.0 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 100.0 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 100.0 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 100.0 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 100.0 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 100.0 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 100.0 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 100.0 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 100.0 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 100.0 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 100.0 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 100.0 | |
| 3vf3_A | 402 | Beta-secretase 1; structure-based drug design, hyd | 100.0 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 100.0 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 100.0 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 100.0 | |
| 3vla_A | 413 | EDGP; extracellular, inhibitor, plant protein; HET | 100.0 | |
| 1t6e_X | 381 | Xylanase inhibitor; two beta-barrel domain structu | 100.0 | |
| 1b5f_A | 239 | Protein (cardosin A); hydrolase, aspartic proteina | 99.96 | |
| 1b5f_B | 87 | Protein (cardosin A); hydrolase, aspartic proteina | 99.84 | |
| 3rfi_A | 108 | Asp; PSI, saposin, hydrolase; 1.90A {Solanum tuber | 99.79 | |
| 2qyp_A | 91 | Proactivator polypeptide; saposin, activator prote | 97.56 | |
| 3bqp_A | 80 | Proactivator polypeptide; saposin, sphingolipid ac | 97.4 | |
| 2gtg_A | 83 | Proactivator polypeptide; saposin, sphingolipid ac | 97.35 | |
| 2qyp_A | 91 | Proactivator polypeptide; saposin, activator prote | 97.29 | |
| 4ddj_A | 83 | Saposin-A, protein A; saposin fold, sphingolipid a | 97.27 | |
| 2js9_A | 99 | Saposin-like protein family protein 5; caenopore-5 | 97.23 | |
| 1nkl_A | 78 | NK-lysin; saposin fold, antibacterial peptide, tum | 97.22 | |
| 3bqp_A | 80 | Proactivator polypeptide; saposin, sphingolipid ac | 97.21 | |
| 1of9_A | 77 | Pore-forming peptide ameobapore A; toxin, saplip, | 97.15 | |
| 2gtg_A | 83 | Proactivator polypeptide; saposin, sphingolipid ac | 97.1 | |
| 1l9l_A | 74 | Granulysin; saposin fold, membrane-lytic, antimicr | 97.1 | |
| 1of9_A | 77 | Pore-forming peptide ameobapore A; toxin, saplip, | 97.06 | |
| 4ddj_A | 83 | Saposin-A, protein A; saposin fold, sphingolipid a | 96.98 | |
| 1n69_A | 81 | Saposin B; lipid binding protein, glycosphingolipi | 96.88 | |
| 1nkl_A | 78 | NK-lysin; saposin fold, antibacterial peptide, tum | 96.81 | |
| 1n69_A | 81 | Saposin B; lipid binding protein, glycosphingolipi | 96.79 | |
| 1l9l_A | 74 | Granulysin; saposin fold, membrane-lytic, antimicr | 96.42 | |
| 2js9_A | 99 | Saposin-like protein family protein 5; caenopore-5 | 96.36 | |
| 3s64_A | 87 | AC-SLP-1, saposin-like protein 1; lipid-binding, l | 95.52 | |
| 2i1a_A | 148 | DNA damage-inducible protein DDI1; acid protease f | 91.21 |
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.6e-67 Score=544.94 Aligned_cols=363 Identities=62% Similarity=1.115 Sum_probs=314.8
Q ss_pred eEEeeeeEEEEEEEeeeEEeecccceEeeCcEEEEEEeeCCccccccCccEEEeeccCccccCCCCchhhhhhhcCCCCc
Q 016530 23 RIRCVLVLIVHFLNWCPFTWQCACLQIFLLQVFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLVSE 102 (388)
Q Consensus 23 ~~~~~~~~~~g~~~~d~~~~~~~~~~~v~~~~Fg~~~~~~~~~f~~~~~dGIlGLg~~~~s~~~~~~~~~~L~~qg~i~~ 102 (388)
.|+|+.+.++|+++.|+|+++ ++++++|.||+++.+.+..|...++|||||||++.++..+..|+|++|++||+|++
T Consensus 113 ~i~Yg~Gs~~G~~~~Dtv~ig---~~~v~~~~Fg~a~~~~~~~f~~~~~dGIlGLg~~~~s~~~~~p~~~~l~~qg~i~~ 189 (478)
T 1qdm_A 113 AIQYGTGSIAGYFSEDSVTVG---DLVVKDQEFIEATKEPGITFLVAKFDGILGLGFKEISVGKAVPVWYKMIEQGLVSD 189 (478)
T ss_dssp EEEETTEEEEEEEEEEEEEET---TEEEEEEEEEEEEECCBSHHHHCSSSEEEECSCGGGCGGGCCCHHHHHTTTTCCSS
T ss_pred EEEcCCCCeEEEEEEEEEEEC---CeEECCEEEEEEEecCCcccccccccceecccccccccCCCCcHHHHHHHCCCCCC
Confidence 588988889999999999999 89999999999998877667777889999999999987778899999999999999
Q ss_pred ceEEEEecCCCCCCCCcEEEECCCCCCceecceeEeeecccceeEEEEccEEEcCeeeceecCCceEEEcCCCcCcccCH
Q 016530 103 EVFSFWLNRDPDAEEGGEIVFGGVDPKHFKGKHTYVPVTKKGYWQFELGDILIGNQSTGVCEGGCAAIVDSGTSLLAGPT 182 (388)
Q Consensus 103 ~~FSl~L~~~~~~~~~G~L~fGgid~~~~~g~l~~~pv~~~~~w~v~l~~i~vgg~~~~~~~~~~~aivDSGTs~i~lP~ 182 (388)
++||+||+++++...+|+|+|||+|++++.|++.|+|+.+.+||.+.+++|+++++.+.++..+..+++||||+++++|+
T Consensus 190 ~~FS~~L~~~~~~~~~G~l~fGg~d~~~~~G~l~~~pv~~~~~w~v~l~~i~v~g~~~~~~~~~~~aiiDTGTs~~~lP~ 269 (478)
T 1qdm_A 190 PVFSFWLNRHVDEGEGGEIIFGGMDPKHYVGEHTYVPVTQKGYWQFDMGDVLVGGKSTGFCAGGCAAIADSGTSLLAGPT 269 (478)
T ss_dssp SEEEEECCCC-----CEEEEETCCCTTSEEEEEEEEEEEEETTEEEEECCEEETTEECSTTTTCEEEEECSSCCSEEECH
T ss_pred CEEEEEeecCCCCCCCeEEEeCCcCHhhcCCCceEEeccCCCeEEEEEeEEEECCEEEeecCCCceEEEcCCCCceeCCH
Confidence 99999999864334589999999999999999999999999999999999999999877666788999999999999999
Q ss_pred HHHHHHHHHhCCcceeecchhhhhhhhhhhHHHHHhhCCCchhhhhhccccccCCcccccccceeeeecc---cccCCCC
Q 016530 183 PVVTEINHAIGGEGVVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKE---NVSAGDS 259 (388)
Q Consensus 183 ~~~~~i~~~i~~~~~~~~~~~~~~~~y~~~i~~~l~~~~~p~~~c~~~~~c~~~~~~~~~~~~~~~~~~~---~~~~~~~ 259 (388)
+++++|.+++++.++++.+|+++|++|++.|+++|.+++.|+++|+++++|.+++.+.++.+++.|++++ +.+..+.
T Consensus 270 ~~~~~i~~~i~a~~~~s~~Ck~~v~~yg~~ii~~l~~~~~p~~vC~~iglC~~~~~~~~~~~~~~v~~~~~~~~~~~~~~ 349 (478)
T 1qdm_A 270 AIITEINEKIGAAGVVSQECKTIVSQYGQQILDLLLAETQPKKICSQVGLCTFDGTRGVSAGIRSVVDDEPVKSNGLRAD 349 (478)
T ss_dssp HHHHHHHHHHTCCCBCCHHHHHHHHHTHHHHHHHHHTTCCHHHHHHHTTCC---------------------------CH
T ss_pred HHHHHHHHHhCccccccccccchhhhhhhHHHHhhhhccChhhhhccccccccCcccccccccccccccccccccccccc
Confidence 9999999999999999999999999999999999999999999999999999999988888888888875 3345677
Q ss_pred cccchhhhhHHHHHHHhhhchhHHHHHHHhhhhccCCCCCCCceeecCCCCCCCCcEEEEECCEEEEeCcccceeeeccC
Q 016530 260 AVCSACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPEQYILKTGEG 339 (388)
Q Consensus 260 ~~~~~~~~~~~~~~~~~~~~~t~~~i~~~~~~~c~~~p~~~~~~~v~C~~~~~lP~i~f~~gg~~~~l~p~~yi~~~~~~ 339 (388)
..|.+|||||.|++++|++|+|+++|+.+++++|.++|...|.|.++|+.+.++|+|+|+|+|+.|+|+|++|+++..++
T Consensus 350 ~~C~~Ce~~v~~~~~~l~~n~t~~~I~~~~~~~C~~~~~~~g~~~v~C~~~~~lP~i~f~~gg~~~~l~p~~yi~~~~~~ 429 (478)
T 1qdm_A 350 PMCSACEMAVVWMQNQLAQNKTQDLILDYVNQLCNRLPSPMGESAVDCGSLGSMPDIEFTIGGKKFALKPEEYILKVGEG 429 (478)
T ss_dssp HHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHTTCBCCSSSCCEECGGGGTTCCCEEEEETTEEEEECHHHHEEECSCG
T ss_pred ccchHHHHHHHHHHHHHhccccHHHHHHHHHHHhhccCCCCCeEEeecccccccccEEEEECCEEEEEChHHhEEEccCC
Confidence 89999999999999999999999999999999999999999999999998889999999999999999999999987654
Q ss_pred cccceeEeeEeccCCCCCCCceEEcHhhhcceEEEEeCCCCeEEEEecC
Q 016530 340 IAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAEAA 388 (388)
Q Consensus 340 ~~~~C~~~i~~~d~~~~~~~~~ILG~~Flr~~y~VfD~~~~rIGfA~~~ 388 (388)
....|+++|+..+.+++.++.||||++|||++|+|||++++|||||++|
T Consensus 430 ~~~~C~~~~~~~~~~~~~~~~~ILGd~fl~~~y~vfD~~~~rIGfA~a~ 478 (478)
T 1qdm_A 430 AAAQCISGFTAMDIPPPRGPLWILGDVFMGPYHTVFDYGKLRIGFAKAA 478 (478)
T ss_dssp GGCCEEESEEECCCCTTSCSEEEECHHHHTTEEEEEETTTTEEEEEEEC
T ss_pred CCCeEEEEEEeccCCCCCCCcEEECHHHhccEEEEEECCCCEEEEEeCC
Confidence 4568999999888766667899999999999999999999999999986
|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A | Back alignment and structure |
|---|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3vf3_A Beta-secretase 1; structure-based drug design, hydrolase-hydrolase inhibitor C; HET: 0GS; 1.48A {Homo sapiens} PDB: 2f3e_A* 2f3f_A* 1ym2_A* 3dv1_A* 3dv5_A* 3k5c_A* 3k5f_A* 3k5g_A* 3pi5_A* 3qbh_A* 3duy_A* 3veu_A* 3vg1_A* 4d83_A* 4d88_A* 4d89_A* 4d8c_A* 3msk_A* 3k5d_A* 1ym4_A* ... | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 4fse_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... | Back alignment and structure |
|---|
| >3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A | Back alignment and structure |
|---|
| >1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A | Back alignment and structure |
|---|
| >1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1b5f_B Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >3rfi_A Asp; PSI, saposin, hydrolase; 1.90A {Solanum tuberosum} | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* | Back alignment and structure |
|---|
| >2js9_A Saposin-like protein family protein 5; caenopore-5, saposin-like fold, antimicrobial protein; NMR {Caenorhabditis elegans} PDB: 2jsa_A | Back alignment and structure |
|---|
| >1nkl_A NK-lysin; saposin fold, antibacterial peptide, tumourolytic peptide; NMR {Sus scrofa} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A | Back alignment and structure |
|---|
| >1of9_A Pore-forming peptide ameobapore A; toxin, saplip, amoebapore A; NMR {Entamoeba histolytica} SCOP: a.64.1.4 | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A | Back alignment and structure |
|---|
| >1l9l_A Granulysin; saposin fold, membrane-lytic, antimicrobial protein; HET: MPO; 0.92A {Homo sapiens} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >1of9_A Pore-forming peptide ameobapore A; toxin, saplip, amoebapore A; NMR {Entamoeba histolytica} SCOP: a.64.1.4 | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* | Back alignment and structure |
|---|
| >1n69_A Saposin B; lipid binding protein, glycosphingolipid activator protein; HET: PEH; 2.20A {Homo sapiens} SCOP: a.64.1.3 | Back alignment and structure |
|---|
| >1nkl_A NK-lysin; saposin fold, antibacterial peptide, tumourolytic peptide; NMR {Sus scrofa} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >1n69_A Saposin B; lipid binding protein, glycosphingolipid activator protein; HET: PEH; 2.20A {Homo sapiens} SCOP: a.64.1.3 | Back alignment and structure |
|---|
| >1l9l_A Granulysin; saposin fold, membrane-lytic, antimicrobial protein; HET: MPO; 0.92A {Homo sapiens} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >2js9_A Saposin-like protein family protein 5; caenopore-5, saposin-like fold, antimicrobial protein; NMR {Caenorhabditis elegans} PDB: 2jsa_A | Back alignment and structure |
|---|
| >3s64_A AC-SLP-1, saposin-like protein 1; lipid-binding, lipid binding protein; HET: CIT EPE; 2.30A {Ancylostoma caninum} | Back alignment and structure |
|---|
| >2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 388 | ||||
| d1qdma1 | 104 | a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Horde | 4e-34 | |
| d1qdma2 | 337 | b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase | 2e-29 | |
| d1qdma2 | 337 | b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase | 2e-25 | |
| d1smra_ | 335 | b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mu | 2e-28 | |
| d1smra_ | 335 | b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mu | 3e-27 | |
| d3psga_ | 370 | b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxI | 4e-28 | |
| d3psga_ | 370 | b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxI | 3e-24 | |
| g1lya.1 | 338 | b.50.1.2 (A:,B:) Cathepsin D {Human (Homo sapiens) | 7e-27 | |
| g1lya.1 | 338 | b.50.1.2 (A:,B:) Cathepsin D {Human (Homo sapiens) | 1e-24 | |
| g1htr.1 | 372 | b.50.1.2 (P:,B:) Pepsin(ogen) {Human (Homo sapiens | 1e-26 | |
| g1htr.1 | 372 | b.50.1.2 (P:,B:) Pepsin(ogen) {Human (Homo sapiens | 7e-26 | |
| d1hrna_ | 337 | b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Ho | 2e-26 | |
| d1hrna_ | 337 | b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Ho | 2e-25 | |
| g1b5f.1 | 326 | b.50.1.2 (A:,B:) Plant acid proteinase, phytepsin | 4e-26 | |
| g1b5f.1 | 326 | b.50.1.2 (A:,B:) Plant acid proteinase, phytepsin | 5e-26 | |
| d1dpja_ | 329 | b.50.1.2 (A:) Acid protease {Baker's yeast (Saccha | 5e-26 | |
| d1dpja_ | 329 | b.50.1.2 (A:) Acid protease {Baker's yeast (Saccha | 2e-24 | |
| d1miqa_ | 373 | b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading e | 9e-24 | |
| d1miqa_ | 373 | b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading e | 3e-16 | |
| d1am5a_ | 324 | b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus mo | 1e-23 | |
| d1am5a_ | 324 | b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus mo | 4e-23 | |
| d2qp8a1 | 387 | b.50.1.2 (A:60-446) beta-secretase (memapsin) {Hum | 6e-23 | |
| d2qp8a1 | 387 | b.50.1.2 (A:60-446) beta-secretase (memapsin) {Hum | 8e-15 | |
| d2bjua1 | 329 | b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrad | 6e-22 | |
| d2bjua1 | 329 | b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrad | 9e-19 | |
| d1mppa_ | 357 | b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840] | 6e-22 | |
| d1mppa_ | 357 | b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840] | 9e-16 | |
| d3cmsa_ | 323 | b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos | 2e-20 | |
| d3cmsa_ | 323 | b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos | 3e-20 | |
| d1eaga_ | 342 | b.50.1.2 (A:) Acid protease {Yeast (Candida albica | 4e-20 | |
| d1eaga_ | 342 | b.50.1.2 (A:) Acid protease {Yeast (Candida albica | 6e-15 | |
| d2apra_ | 325 | b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus | 4e-20 | |
| d2apra_ | 325 | b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus | 9e-19 | |
| d1j71a_ | 334 | b.50.1.2 (A:) Acid protease {Yeast (Candida tropic | 4e-20 | |
| d1j71a_ | 334 | b.50.1.2 (A:) Acid protease {Yeast (Candida tropic | 2e-14 | |
| d1wkra_ | 340 | b.50.1.2 (A:) Acid protease {Irpex lacteus (Polypo | 9e-20 | |
| d1wkra_ | 340 | b.50.1.2 (A:) Acid protease {Irpex lacteus (Polypo | 1e-19 | |
| d1t6ex_ | 381 | b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Tr | 1e-18 | |
| d1t6ex_ | 381 | b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Tr | 7e-13 | |
| d1izea_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Aspergillus o | 2e-18 | |
| d1izea_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Aspergillus o | 9e-18 | |
| d1bxoa_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Penicillium j | 8e-18 | |
| d1bxoa_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Penicillium j | 1e-11 | |
| d1oewa_ | 330 | b.50.1.2 (A:) Endothiapepsin {Chestnut blight fung | 3e-17 | |
| d1oewa_ | 330 | b.50.1.2 (A:) Endothiapepsin {Chestnut blight fung | 3e-16 | |
| d1of9a_ | 77 | a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica | 6e-12 | |
| d1of9a_ | 77 | a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica | 0.003 | |
| d2gtga1 | 78 | a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) | 2e-11 | |
| d2gtga1 | 78 | a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) | 2e-08 | |
| d1nkla_ | 78 | a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [Tax | 9e-11 | |
| d1nkla_ | 78 | a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [Tax | 4e-05 | |
| d1n69a_ | 78 | a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [Tax | 1e-06 | |
| d1n69a_ | 78 | a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [Tax | 0.001 | |
| d1l9la_ | 74 | a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Hom | 7e-06 |
| >d1qdma1 a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 104 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Saposin-like superfamily: Saposin family: Swaposin domain: (Pro)phytepsin species: Barley (Hordeum vulgare) [TaxId: 4513]
Score = 120 bits (301), Expect = 4e-34
Identities = 55/104 (52%), Positives = 75/104 (72%), Gaps = 3/104 (2%)
Query: 197 VVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENVSA 256
VVS ECK +VSQYG I DLL++ P+K+C Q+GLC F+G VS GI++VV+ E V +
Sbjct: 1 VVSQECKTIVSQYGQQILDLLLAETQPKKICSQVGLCTFDGTRGVSAGIRSVVDDEPVKS 60
Query: 257 ---GDSAVCSACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLP 297
+CSACEMAVVW+QNQL Q +T++ +L Y+N+LC+ LP
Sbjct: 61 NGLRADPMCSACEMAVVWMQNQLAQNKTQDLILDYVNQLCNRLP 104
|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 337 | Back information, alignment and structure |
|---|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 337 | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Length = 335 | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Length = 335 | Back information, alignment and structure |
|---|
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Length = 370 | Back information, alignment and structure |
|---|
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Length = 370 | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Length = 329 | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Length = 329 | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Length = 373 | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Length = 373 | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Length = 324 | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Length = 324 | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Length = 387 | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Length = 387 | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Length = 329 | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Length = 329 | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Length = 357 | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Length = 357 | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Length = 323 | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Length = 323 | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Length = 342 | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Length = 342 | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Length = 325 | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Length = 325 | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 334 | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 334 | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Length = 340 | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Length = 340 | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 381 | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 381 | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Length = 323 | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Length = 323 | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Length = 323 | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Length = 323 | Back information, alignment and structure |
|---|
| >d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Length = 330 | Back information, alignment and structure |
|---|
| >d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Length = 330 | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} Length = 77 | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} Length = 77 | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 388 | |||
| g1htr.1 | 372 | Pepsin(ogen) {Human (Homo sapiens), progastricsin | 100.0 | |
| d3psga_ | 370 | Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1dpja_ | 329 | Acid protease {Baker's yeast (Saccharomyces cerevi | 100.0 | |
| d1smra_ | 335 | Chymosin (synonym: renin) {Mouse (Mus musculus) [T | 100.0 | |
| d2apra_ | 325 | Acid protease {Bread mold (Rhizopus chinensis) [Ta | 100.0 | |
| d1am5a_ | 324 | Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: | 100.0 | |
| d1hrna_ | 337 | Chymosin (synonym: renin) {Human (Homo sapiens) [T | 100.0 | |
| d1miqa_ | 373 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 100.0 | |
| d1oewa_ | 330 | Endothiapepsin {Chestnut blight fungus (Endothia p | 100.0 | |
| d1j71a_ | 334 | Acid protease {Yeast (Candida tropicalis) [TaxId: | 100.0 | |
| g1lya.1 | 338 | Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1izea_ | 323 | Acid protease {Fungus (Aspergillus oryzae) [TaxId: | 100.0 | |
| d1qdma2 | 337 | Plant acid proteinase, phytepsin {Barley (Hordeum | 100.0 | |
| g1b5f.1 | 326 | Plant acid proteinase, phytepsin {Cynara carduncul | 100.0 | |
| d1wkra_ | 340 | Acid protease {Irpex lacteus (Polyporus tulipifera | 100.0 | |
| d1eaga_ | 342 | Acid protease {Yeast (Candida albicans) [TaxId: 54 | 100.0 | |
| d1mppa_ | 357 | Pepsin {Mucor pusillus [TaxId: 4840]} | 100.0 | |
| d1bxoa_ | 323 | Acid protease {Fungus (Penicillium janthinellum), | 100.0 | |
| d2bjua1 | 329 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 100.0 | |
| d3cmsa_ | 323 | Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId | 100.0 | |
| d2qp8a1 | 387 | beta-secretase (memapsin) {Human (Homo sapiens) [T | 99.98 | |
| d1t6ex_ | 381 | Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu | 99.96 | |
| d1qdma1 | 104 | (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4 | 99.66 | |
| d1nkla_ | 78 | NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | 97.18 | |
| d1of9a_ | 77 | Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | 97.08 | |
| d2gtga1 | 78 | Saposin C {Human (Homo sapiens) [TaxId: 9606]} | 96.83 | |
| d1n69a_ | 78 | Saposin B {Human (Homo sapiens) [TaxId: 9606]} | 96.72 | |
| d2gtga1 | 78 | Saposin C {Human (Homo sapiens) [TaxId: 9606]} | 96.68 | |
| d1of9a_ | 77 | Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | 96.6 | |
| d1nkla_ | 78 | NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | 96.14 | |
| d1n69a_ | 78 | Saposin B {Human (Homo sapiens) [TaxId: 9606]} | 95.95 | |
| d1l9la_ | 74 | Granulysin, NKG5 protein {Human (Homo sapiens) [Ta | 95.9 | |
| d1l9la_ | 74 | Granulysin, NKG5 protein {Human (Homo sapiens) [Ta | 95.59 |
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} | Back information, alignment and structure |
|---|
| >d1qdma1 a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|