Citrus Sinensis ID: 016535

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39

MAPYGILIWAVITAVLASILILASHVHNARRNRTTSVAFFHPNTNDGGGGERVLWCAVKAIQEESPDLDCIVYTGDHDAFPDSLLARAVDRFGVELLHPPKVVHLYRRKWIEESTYPRFTMIGQSFGSVYLSWEALCKFTPLYYFDTSGYAFTYPLARIFGCRVICYTHYPTISLDMISRVREGSSMYNNNASIAQSNWLSQCKIVYYTFFSWMYGLVGSCADLAMVNSSWTQSHIEKLWGIPDRIKRVYPPCDTSGLQVLPLERSTEYPAIISVAQFRPEKAHPLQLEAFSVALRKLDADLPRPRLQFVGSCRNKSDEERLQSLKDKSIELKVDGNVEFYKNLLYRDLVKLLGGAVVGIHSMIDEHFGISVVEYMAAGAIPIGKHFK

cccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHcccccccccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccHHHHcccccccEEEEEcccccHHHHHHHHccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHcccccccEEcccccccccccccccccccccEEEEEEccccccccHHHHHHHHHHHHHccccccccEEEEEccccccccHHHHHHHHHHHHHccccccEEEcccccHHHHHHHHccccEEEEccccccccHHHHHHHcccccEEECccc

*APYGILIWAVITAVLASILILASHVHNARRNRTTSVAFFHPNTNDGGGGERVLWCAVKAIQEESPDLDCIVYTGDHDAFPDSLLARAVDRFGVELLHPPKVVHLYRRKWIEESTYPRFTMIGQSFGSVYLSWEALCKFTPLYYFDTSGYAFTYPLARIFGCRVICYTHYPTISLDMISRVREGSSMYNNNASIAQSNWLSQCKIVYYTFFSWMYGLVGSCADLAMVNSSWTQSHIEKLWGIPDRIKRVYPPCDTSGLQVLPLERSTEYPAIISVAQFRPEKAHPLQLEAFSVALRKLDADLPRPRLQFVGSCRNKSDEERLQSLKDKSIELKVDGNVEFYKNLLYRDLVKLLGGAVVGIHSMIDEHFGISVVEYMAAGAIPIGKHFK

xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase	Required for N-linked oligosaccharide assembly. Has a role in the last step of the synthesis of the Man(5)GlcNAc(2)-PP-dolichol core oligosaccharide on the cytoplasmic face of the endoplasmic reticulum.	confident	Q9XEE9

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S28, chain A
Confidence level:very confident
Coverage over the Query: 30-178,195-388
View the alignment between query and template
View the model in PyMOL

Template: 1RZU, chain A
Confidence level:confident
Coverage over the Query: 35-387
View the alignment between query and template
View the model in PyMOL