Citrus Sinensis ID: 016550


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------
MGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPVQSAKKPTQSKEPAKPKAQAEPKKEAAKETAKPKVEDAGEEEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK
cccccccHHHHHccccccccEEEccccEEEEEHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccHHHHcccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHccccccccHHHHcHHHHcccccccEEEEEEEcccccccEEEEEEEcHHHHHHHHccccccccEEEEEEcccccccEEEEEEEEcccccccccccccccccEEEEEcccccHHHHHHHHHHHccccccccEEcccccccc
ccccHHcHHHHcccccccccEEEEccEEEEcHHHHHHHHHHHHcHHHHccccHHHHHHHHHHHHHcccHccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEccHEcHHHHHHHHHHHHHHHHHccHHHHcccccHHHHHHHHHccHHHHHHHcccHHHHcccccccHHHHHHcccccccccccccccccccccccccccHHHHcccccccccccHHHcccccccHHHHHHHcccccccccccHHHHHHHHccccccEEEEEEEcccHHccEEEEccccHHHHHHHHHHHHHHHHEEEEEEEccccccEEEEEEEEcccccccccccccccccEEEEEcccccHHHHHHHHHHHHccccccccEcccccEcc
mgvtnktpeflkmnpigkvpvletpdgpifesNAIARYVARLKadnpllgsslidsaHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRIlsksftsefphiERYFWTMVNIPNFRKILGEIkqaesvppvqsakkptqskepakpkaqaepkkeAAKEtakpkvedageeeapkpkpknpldllppskmiLDEWKRLYSNTKTNFREVAIKGfwdmydpegyslwfcdykyndentVSFVTLNKVGGFLQRMDLARKYAFGKMliigseppfkvkglwlfrgqeipqfimdecydmelydwkkvdindEAQKERVSQMIedhepfegealldakcfk
mgvtnktpeflkmnpigkvPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAEsvppvqsakkptqskepakpkaqaepkkeaaketakpkvedageeeapkpkpknpldllppSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEdhepfegealldakcfk
MGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEaaiaslkralaalNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPVQSAKKPTQSkepakpkaqaepkkeaaketakpkVEDAGeeeapkpkpknpldllppSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK
***************IGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEI*******************************************************************MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDIN******************************
*G*TNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESV******************************************************DLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK
MGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAE***************************************************PKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK
***TNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPVQSAKKP*****************************************KNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPVQSAKKPTQSKEPAKPKAQAEPKKEAAKETAKPKVEDAGEEEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query387 2.2.26 [Sep-21-2011]
Q9FUM1422 Elongation factor 1-gamma N/A no 1.0 0.917 0.793 0.0
Q6YW46418 Elongation factor 1-gamma yes no 0.984 0.911 0.796 1e-179
Q5Z627416 Elongation factor 1-gamma no no 0.984 0.915 0.785 1e-177
Q9ZRI7418 Elongation factor 1-gamma no no 0.979 0.906 0.754 1e-173
O04487414 Probable elongation facto yes no 0.979 0.915 0.767 1e-172
Q9FVT2413 Probable elongation facto no no 0.976 0.915 0.757 1e-170
Q9D8N0437 Elongation factor 1-gamma yes no 0.984 0.871 0.373 3e-67
P29694437 Elongation factor 1-gamma yes no 0.984 0.871 0.368 1e-66
Q68FR6437 Elongation factor 1-gamma yes no 0.984 0.871 0.368 2e-66
A2Q127437 Elongation factor 1-gamma yes no 0.984 0.871 0.366 4e-66
>sp|Q9FUM1|EF1G_PRUAV Elongation factor 1-gamma OS=Prunus avium PE=2 SV=1 Back     alignment and function desciption
 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/387 (79%), Positives = 341/387 (88%)

Query: 1   MGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIE 60
           MGVTNKTPE+LK+NPIGKVP+LETPDGPIFESNAIARYVARLKADNPL+GSSLID AHIE
Sbjct: 36  MGVTNKTPEYLKLNPIGKVPLLETPDGPIFESNAIARYVARLKADNPLIGSSLIDYAHIE 95

Query: 61  QWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHS 120
           QWIDF SLEID NI+ WF PR G+AVYLP AEEAAI++LKRAL ALNTHLASNTYLVGH 
Sbjct: 96  QWIDFGSLEIDANIISWFRPRFGYAVYLPPAEEAAISALKRALGALNTHLASNTYLVGHF 155

Query: 121 VTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPV 180
           VTLADII+TCNL  GF++++ KSFTSEFPH+ERYFWT+VN P F+K+LG++KQ ESVPPV
Sbjct: 156 VTLADIIVTCNLFFGFTKLMIKSFTSEFPHVERYFWTLVNQPKFKKVLGDVKQTESVPPV 215

Query: 181 QSAKKPTQSKEPAKPKAQAEPKKEAAKETAKPKVEDAGEEEAPKPKPKNPLDLLPPSKMI 240
            SAKKP+Q KE      +   K+   +            EEAPKPKPKNPLDLLPPS M+
Sbjct: 216 PSAKKPSQPKETKSKAKEEPKKEAKKEPAKPKAEAAEEVEEAPKPKPKNPLDLLPPSNMV 275

Query: 241 LDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQ 300
           LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVTLNKVGGFLQ
Sbjct: 276 LDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVGGFLQ 335

Query: 301 RMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEA 360
           RMDLARKYAFGKML+IGSEPPFKVKGLWLFRGQEIP F+M+ECYDMELY+W KVD++DE 
Sbjct: 336 RMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPPFVMEECYDMELYNWTKVDLSDEN 395

Query: 361 QKERVSQMIEDHEPFEGEALLDAKCFK 387
           QKERV+Q+IED EPFEGEALLDAKCFK
Sbjct: 396 QKERVNQVIEDQEPFEGEALLDAKCFK 422




Probably plays a role in anchoring the complex to other cellular components.
Prunus avium (taxid: 42229)
>sp|Q6YW46|EF1G2_ORYSJ Elongation factor 1-gamma 2 OS=Oryza sativa subsp. japonica GN=Os02g0220500 PE=2 SV=2 Back     alignment and function description
>sp|Q5Z627|EF1G3_ORYSJ Elongation factor 1-gamma 3 OS=Oryza sativa subsp. japonica GN=Os06g0571400 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZRI7|EF1G1_ORYSJ Elongation factor 1-gamma 1 OS=Oryza sativa subsp. japonica GN=Os02g0220600 PE=2 SV=1 Back     alignment and function description
>sp|O04487|EF1G1_ARATH Probable elongation factor 1-gamma 1 OS=Arabidopsis thaliana GN=At1g09640 PE=2 SV=1 Back     alignment and function description
>sp|Q9FVT2|EF1G2_ARATH Probable elongation factor 1-gamma 2 OS=Arabidopsis thaliana GN=At1g57720 PE=2 SV=1 Back     alignment and function description
>sp|Q9D8N0|EF1G_MOUSE Elongation factor 1-gamma OS=Mus musculus GN=Eef1g PE=1 SV=3 Back     alignment and function description
>sp|P29694|EF1G_RABIT Elongation factor 1-gamma OS=Oryctolagus cuniculus GN=EEF1G PE=2 SV=3 Back     alignment and function description
>sp|Q68FR6|EF1G_RAT Elongation factor 1-gamma OS=Rattus norvegicus GN=Eef1g PE=1 SV=3 Back     alignment and function description
>sp|A2Q127|EF1G_HORSE Elongation factor 1-gamma OS=Equus caballus GN=EEF1G PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query387
225465198423 PREDICTED: elongation factor 1-gamma-lik 1.0 0.914 0.855 0.0
147789055423 hypothetical protein VITISV_021574 [Viti 1.0 0.914 0.850 0.0
359493457424 PREDICTED: elongation factor 1-gamma-lik 0.997 0.910 0.843 0.0
224145107426 predicted protein [Populus trichocarpa] 0.992 0.901 0.840 0.0
363808162420 uncharacterized protein LOC100810452 [Gl 0.992 0.914 0.826 0.0
13626392422 RecName: Full=Elongation factor 1-gamma; 1.0 0.917 0.793 0.0
413926103414 elongation factor 1-gamma 2 [Zea mays] g 0.974 0.910 0.776 0.0
242096224417 hypothetical protein SORBIDRAFT_10g02257 0.984 0.913 0.783 0.0
356543373418 PREDICTED: elongation factor 1-gamma-lik 0.989 0.916 0.803 1e-180
226530767414 elongation factor 1-gamma 2 [Zea mays] g 0.974 0.910 0.771 1e-179
>gi|225465198|ref|XP_002264400.1| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/388 (85%), Positives = 353/388 (90%), Gaps = 1/388 (0%)

Query: 1   MGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIE 60
           MGV+NKTPEFLKMNPIGKVPVLETPDGP+FESNAIARYV RLKADNPL GSS I+  HIE
Sbjct: 36  MGVSNKTPEFLKMNPIGKVPVLETPDGPVFESNAIARYVTRLKADNPLYGSSPIEYGHIE 95

Query: 61  QWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHS 120
           QWIDF+SLEID NI  WF PR+G AVYLP  EEAAIA+LKRAL ALNTHLASNT+LVGHS
Sbjct: 96  QWIDFASLEIDANIGHWFRPRIGRAVYLPPFEEAAIAALKRALGALNTHLASNTFLVGHS 155

Query: 121 VTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPV 180
           VTLADI+MTCNL +GFS++++KSFTSEFPH+ERYFWTMVN PNF KILGE+KQ  SVPPV
Sbjct: 156 VTLADIVMTCNLYMGFSKLMTKSFTSEFPHVERYFWTMVNQPNFSKILGEVKQTASVPPV 215

Query: 181 QSAKKPTQSKEPAKPKAQAEPKKEAAKETAKPKVEDAG-EEEAPKPKPKNPLDLLPPSKM 239
            SAKKP   KE AKPK + EPKKE  KE AKPK    G EEEAPKPKPKNPLDLLPPSKM
Sbjct: 216 SSAKKPALPKEHAKPKHKDEPKKEVKKEPAKPKEAPVGEEEEAPKPKPKNPLDLLPPSKM 275

Query: 240 ILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFL 299
           ILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFL
Sbjct: 276 ILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFL 335

Query: 300 QRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDE 359
           QRMDLARKYAFGKML+IGSE PFKVKGLWLFRGQEIPQFI+DECYDMELY+WKKVDI+DE
Sbjct: 336 QRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFIIDECYDMELYEWKKVDISDE 395

Query: 360 AQKERVSQMIEDHEPFEGEALLDAKCFK 387
           AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct: 396 AQKERVNQMIEDQEPFEGEALLDAKCFK 423




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147789055|emb|CAN75785.1| hypothetical protein VITISV_021574 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493457|ref|XP_002278756.2| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224145107|ref|XP_002325529.1| predicted protein [Populus trichocarpa] gi|222862404|gb|EEE99910.1| predicted protein [Populus trichocarpa] gi|283136134|gb|ADB11386.1| gamma class glutathione transferase EF1Bgamma1 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|363808162|ref|NP_001242737.1| uncharacterized protein LOC100810452 [Glycine max] gi|255635419|gb|ACU18062.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|13626392|sp|Q9FUM1.1|EF1G_PRUAV RecName: Full=Elongation factor 1-gamma; Short=EF-1-gamma; AltName: Full=eEF-1B gamma gi|10444415|gb|AAG17901.1|AF297712_1 translation elongation factor 1-gamma [Prunus avium] Back     alignment and taxonomy information
>gi|413926103|gb|AFW66035.1| elongation factor 1-gamma 2 [Zea mays] gi|413926104|gb|AFW66036.1| elongation factor 1-gamma 2 [Zea mays] Back     alignment and taxonomy information
>gi|242096224|ref|XP_002438602.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor] gi|241916825|gb|EER89969.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|356543373|ref|XP_003540135.1| PREDICTED: elongation factor 1-gamma-like [Glycine max] Back     alignment and taxonomy information
>gi|226530767|ref|NP_001151229.1| elongation factor 1-gamma 2 [Zea mays] gi|195645182|gb|ACG42059.1| elongation factor 1-gamma 2 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query387
TAIR|locus:2206535413 AT1G57720 [Arabidopsis thalian 0.390 0.365 0.900 2.3e-144
TAIR|locus:2024311414 AT1G09640 [Arabidopsis thalian 0.390 0.364 0.900 8.9e-143
MGI|MGI:1914410437 Eef1g "eukaryotic translation 0.472 0.418 0.402 3.8e-56
RGD|1302939437 Eef1g "eukaryotic translation 0.472 0.418 0.402 7.8e-56
UNIPROTKB|F1MG05440 EEF1G "Elongation factor 1-gam 0.472 0.415 0.391 2.6e-55
UNIPROTKB|Q29387432 EEF1G "Elongation factor 1-gam 0.472 0.423 0.396 3.3e-55
UNIPROTKB|E2R574437 EEF1G "Uncharacterized protein 0.472 0.418 0.391 4.2e-55
UNIPROTKB|Q3SZV3440 EEF1G "Elongation factor 1-gam 0.472 0.415 0.391 8.8e-55
DICTYBASE|DDB_G0282979410 efa1G "elongation factor 1 gam 0.467 0.441 0.344 1.1e-54
UNIPROTKB|P26641437 EEF1G "Elongation factor 1-gam 0.462 0.409 0.380 1.8e-54
TAIR|locus:2206535 AT1G57720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 744 (267.0 bits), Expect = 2.3e-144, Sum P(2) = 2.3e-144
 Identities = 136/151 (90%), Positives = 143/151 (94%)

Query:   237 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG 296
             S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVTLNKVG
Sbjct:   263 SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG 322

Query:   297 GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDI 356
             GFLQRMDLARKY+FGKMLI GSE PFKVKGLWLFRG EIP+FIMDE YDMELY+W KVDI
Sbjct:   323 GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI 382

Query:   357 NDEAQKERVSQMIEDHEPFEGEALLDAKCFK 387
             +DEAQKERVSQMIED EPFEGEALLDAKCFK
Sbjct:   383 SDEAQKERVSQMIEDAEPFEGEALLDAKCFK 413


GO:0003746 "translation elongation factor activity" evidence=IEA;ISS
GO:0005853 "eukaryotic translation elongation factor 1 complex" evidence=IEA
GO:0006414 "translational elongation" evidence=IEA
GO:0005773 "vacuole" evidence=IDA
GO:0005618 "cell wall" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005507 "copper ion binding" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0010043 "response to zinc ion" evidence=IEP
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
TAIR|locus:2024311 AT1G09640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1914410 Eef1g "eukaryotic translation elongation factor 1 gamma" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1302939 Eef1g "eukaryotic translation elongation factor 1 gamma" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MG05 EEF1G "Elongation factor 1-gamma" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q29387 EEF1G "Elongation factor 1-gamma" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R574 EEF1G "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZV3 EEF1G "Elongation factor 1-gamma" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282979 efa1G "elongation factor 1 gamma" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|P26641 EEF1G "Elongation factor 1-gamma" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9NJH0EF1G_DROMENo assigned EC number0.32550.92500.8306yesno
Q6YW46EF1G2_ORYSJNo assigned EC number0.79690.98440.9114yesno
Q6PE25EF1G_DANRENo assigned EC number0.33740.92240.8076yesno
P26641EF1G_HUMANNo assigned EC number0.36130.98440.8718yesno
P40921EF1G_SCHPONo assigned EC number0.33240.92760.8777yesno
Q9ZRI7EF1G1_ORYSJNo assigned EC number0.75440.97930.9066nono
P29694EF1G_RABITNo assigned EC number0.36880.98440.8718yesno
P36008EF1G2_YEASTNo assigned EC number0.31880.95090.8932yesno
Q29387EF1G_PIGNo assigned EC number0.36630.98440.8819yesno
Q68FR6EF1G_RATNo assigned EC number0.36880.98440.8718yesno
Q3SZV3EF1G_BOVINNo assigned EC number0.36110.98440.8659yesno
Q9FUM1EF1G_PRUAVNo assigned EC number0.79321.00.9170N/Ano
Q5Z627EF1G3_ORYSJNo assigned EC number0.78550.98440.9158nono
Q9FVT2EF1G2_ARATHNo assigned EC number0.75710.97670.9152nono
Q9D8N0EF1G_MOUSENo assigned EC number0.37370.98440.8718yesno
A2Q127EF1G_HORSENo assigned EC number0.36630.98440.8718yesno
O04487EF1G1_ARATHNo assigned EC number0.76740.97930.9154yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pm.C_LG_XIX0193
hypothetical protein (427 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query387
pfam00647105 pfam00647, EF1G, Elongation factor 1 gamma, conser 7e-55
cd03181123 cd03181, GST_C_EF1Bgamma_like, Glutathione S-trans 6e-48
COG0625211 COG0625, Gst, Glutathione S-transferase [Posttrans 2e-26
cd10294123 cd10294, GST_C_ValRS_N, Glutathione S-transferase 5e-20
cd0304475 cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subu 7e-16
PLN02907 722 PLN02907, PLN02907, glutamate-tRNA ligase 2e-14
PLN02395215 PLN02395, PLN02395, glutathione S-transferase 2e-13
PLN02473214 PLN02473, PLN02473, glutathione S-transferase 4e-13
cd00299100 cd00299, GST_C_family, C-terminal, alpha helical d 2e-10
cd1028982 cd10289, GST_C_AaRS_like, Glutathione S-transferas 5e-10
pfam0279874 pfam02798, GST_N, Glutathione S-transferase, N-ter 6e-10
cd10305101 cd10305, GST_C_AIMP3, Glutathione S-transferase C- 6e-10
cd0057071 cd00570, GST_N_family, Glutathione S-transferase ( 6e-10
cd0305376 cd03053, GST_N_Phi, GST_N family, Class Phi subfam 9e-10
cd0305673 cd03056, GST_N_4, GST_N family, unknown subfamily 3e-09
cd0304773 cd03047, GST_N_2, GST_N family, unknown subfamily 4e-09
cd03189123 cd03189, GST_C_GTT1_like, C-terminal, alpha helica 4e-08
cd0305777 cd03057, GST_N_Beta, GST_N family, Class Beta subf 8e-08
pfam1340968 pfam13409, GST_N_2, Glutathione S-transferase, N-t 8e-08
pfam0004392 pfam00043, GST_C, Glutathione S-transferase, C-ter 9e-08
cd1030981 cd10309, GST_C_GluProRS_N, Glutathione S-transfera 1e-07
cd0305174 cd03051, GST_N_GTT2_like, GST_N family, Saccharomy 2e-07
cd0304881 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-lik 3e-07
cd0304676 cd03046, GST_N_GTT1_like, GST_N family, Saccharomy 3e-07
cd03207101 cd03207, GST_C_8, C-terminal, alpha helical domain 3e-07
pfam1341069 pfam13410, GST_C_2, Glutathione S-transferase, C-t 5e-07
cd0305076 cd03050, GST_N_Theta, GST_N family, Class Theta su 5e-07
PRK10542201 PRK10542, PRK10542, glutathionine S-transferase; P 5e-07
pfam1341775 pfam13417, GST_N_3, Glutathione S-transferase, N-t 1e-06
cd0304973 cd03049, GST_N_3, GST_N family, unknown subfamily 1e-06
TIGR01262210 TIGR01262, maiA, maleylacetoacetate isomerase 8e-06
cd03180110 cd03180, GST_C_2, C-terminal, alpha helical domain 8e-06
cd1030882 cd10308, GST_C_eEF1b_like, Glutathione S-transfera 4e-05
PLN02378213 PLN02378, PLN02378, glutathione S-transferase DHAR 4e-05
cd0304373 cd03043, GST_N_1, GST_N family, unknown subfamily 4e-05
cd0304574 cd03045, GST_N_Delta_Epsilon, GST_N family, Class 6e-05
cd1030687 cd10306, GST_C_GluRS_N, Glutathione S-transferase 9e-05
cd03182116 cd03182, GST_C_GTT2_like, C-terminal, alpha helica 1e-04
cd03206100 cd03206, GST_C_7, C-terminal, alpha helical domain 1e-04
cd03178110 cd03178, GST_C_Ure2p_like, C-terminal, alpha helic 3e-04
cd0304273 cd03042, GST_N_Zeta, GST_N family, Class Zeta subf 3e-04
PRK10357202 PRK10357, PRK10357, putative glutathione S-transfe 3e-04
cd0305874 cd03058, GST_N_Tau, GST_N family, Class Tau subfam 4e-04
cd0305589 cd03055, GST_N_Omega, GST_N family, Class Omega su 4e-04
PRK11752264 PRK11752, PRK11752, putative S-transferase; Provis 5e-04
cd03198119 cd03198, GST_C_CLIC, C-terminal, alpha helical dom 6e-04
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 6e-04
cd03188113 cd03188, GST_C_Beta, C-terminal, alpha helical dom 7e-04
cd03190142 cd03190, GST_C_Omega_like, C-terminal, alpha helic 8e-04
cd03177117 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha he 0.002
PRK05996423 PRK05996, motB, flagellar motor protein MotB; Vali 0.002
>gnl|CDD|201369 pfam00647, EF1G, Elongation factor 1 gamma, conserved domain Back     alignment and domain information
 Score =  175 bits (447), Expect = 7e-55
 Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 2/107 (1%)

Query: 228 KNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTV 287
           KNPLD LP S   LDEWKR YSN  T  R VA+  FW+ +DPEGYS+W+ +YKYNDE  +
Sbjct: 1   KNPLDALPKSTFNLDEWKRQYSNEDT--RTVALPYFWEHFDPEGYSIWYVEYKYNDELKL 58

Query: 288 SFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQE 334
            F+T N +GGF QR++ +RKYAFG + + G +    + G+W+FRGQE
Sbjct: 59  VFMTCNLIGGFFQRLEKSRKYAFGSVSVYGEDNNSDISGVWVFRGQE 105


Length = 105

>gnl|CDD|198290 cd03181, GST_C_EF1Bgamma_like, Glutathione S-transferase C-terminal-like, alpha helical domain of the Gamma subunit of Elongation Factor 1B and similar proteins Back     alignment and domain information
>gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|198327 cd10294, GST_C_ValRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of vertebrate Valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|239342 cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>gnl|CDD|215492 PLN02907, PLN02907, glutamate-tRNA ligase Back     alignment and domain information
>gnl|CDD|166036 PLN02395, PLN02395, glutathione S-transferase Back     alignment and domain information
>gnl|CDD|166114 PLN02473, PLN02473, glutathione S-transferase Back     alignment and domain information
>gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family Back     alignment and domain information
>gnl|CDD|198322 cd10289, GST_C_AaRS_like, Glutathione S-transferase C-terminal-like, alpha helical domain of various Aminoacyl-tRNA synthetases and similar domains Back     alignment and domain information
>gnl|CDD|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|198338 cd10305, GST_C_AIMP3, Glutathione S-transferase C-terminal-like, alpha helical domain of Aminoacyl tRNA synthetase complex-Interacting Multifunctional Protein 3 Back     alignment and domain information
>gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>gnl|CDD|239345 cd03047, GST_N_2, GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>gnl|CDD|198298 cd03189, GST_C_GTT1_like, C-terminal, alpha helical domain of GTT1-like Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|239355 cd03057, GST_N_Beta, GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|198342 cd10309, GST_C_GluProRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of bifunctional Glutamyl-Prolyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|239349 cd03051, GST_N_GTT2_like, GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>gnl|CDD|239346 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>gnl|CDD|198316 cd03207, GST_C_8, C-terminal, alpha helical domain of an unknown subfamily 8 of Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>gnl|CDD|182533 PRK10542, PRK10542, glutathionine S-transferase; Provisional Back     alignment and domain information
>gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|239347 cd03049, GST_N_3, GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase Back     alignment and domain information
>gnl|CDD|198289 cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|198341 cd10308, GST_C_eEF1b_like, Glutathione S-transferase C-terminal-like, alpha helical domain of eukaryotic translation Elongation Factor 1 beta Back     alignment and domain information
>gnl|CDD|166019 PLN02378, PLN02378, glutathione S-transferase DHAR1 Back     alignment and domain information
>gnl|CDD|239341 cd03043, GST_N_1, GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>gnl|CDD|239343 cd03045, GST_N_Delta_Epsilon, GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|198339 cd10306, GST_C_GluRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of Glutamyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|198291 cd03182, GST_C_GTT2_like, C-terminal, alpha helical domain of GTT2-like Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|198315 cd03206, GST_C_7, C-terminal, alpha helical domain of an unknown subfamily 7 of Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|198288 cd03178, GST_C_Ure2p_like, C-terminal, alpha helical domain of Ure2p and related Glutathione S-transferase-like proteins Back     alignment and domain information
>gnl|CDD|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|182405 PRK10357, PRK10357, putative glutathione S-transferase; Provisional Back     alignment and domain information
>gnl|CDD|239356 cd03058, GST_N_Tau, GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|239353 cd03055, GST_N_Omega, GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|183298 PRK11752, PRK11752, putative S-transferase; Provisional Back     alignment and domain information
>gnl|CDD|198307 cd03198, GST_C_CLIC, C-terminal, alpha helical domain of Chloride Intracellular Channels Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|198297 cd03188, GST_C_Beta, C-terminal, alpha helical domain of Class Beta Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|198299 cd03190, GST_C_Omega_like, C-terminal, alpha helical domain of Class Omega-like Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|198287 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha helical domain of Class Delta and Epsilon Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|235665 PRK05996, motB, flagellar motor protein MotB; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 387
KOG1627160 consensus Translation elongation factor EF-1 gamma 100.0
PF00647107 EF1G: Elongation factor 1 gamma, conserved domain; 100.0
PLN02395215 glutathione S-transferase 99.94
PLN02473214 glutathione S-transferase 99.93
PRK10542201 glutathionine S-transferase; Provisional 99.93
PRK09481211 sspA stringent starvation protein A; Provisional 99.92
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 99.92
PRK10357202 putative glutathione S-transferase; Provisional 99.92
KOG0867226 consensus Glutathione S-transferase [Posttranslati 99.92
COG0625211 Gst Glutathione S-transferase [Posttranslational m 99.91
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 99.91
PRK15113214 glutathione S-transferase; Provisional 99.91
PRK11752264 putative S-transferase; Provisional 99.9
KOG0406231 consensus Glutathione S-transferase [Posttranslati 99.86
PLN02378213 glutathione S-transferase DHAR1 99.85
KOG0868217 consensus Glutathione S-transferase [Posttranslati 99.83
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 99.81
PLN02817265 glutathione dehydrogenase (ascorbate) 99.81
PTZ00057205 glutathione s-transferase; Provisional 99.8
PLN02907 722 glutamate-tRNA ligase 99.79
PRK10387210 glutaredoxin 2; Provisional 99.78
KOG1695206 consensus Glutathione S-transferase [Posttranslati 99.74
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 99.68
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 99.66
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 99.59
KOG4420325 consensus Uncharacterized conserved protein (Gangl 99.59
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 99.57
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 99.56
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 99.55
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 99.54
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 99.52
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 99.5
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 99.5
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 99.49
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GST 99.48
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 99.48
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 99.44
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 99.43
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 99.41
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 99.37
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 99.36
KOG1422221 consensus Intracellular Cl- channel CLIC, contains 99.34
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; compose 99.33
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 99.29
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 99.29
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 99.28
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 99.24
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; compose 99.24
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 99.21
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 99.21
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 99.2
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 99.17
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 99.17
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 99.14
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 99.12
cd03192104 GST_C_Sigma_like GST_C family, Class Sigma_like; c 99.08
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; compose 99.04
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 99.02
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; compose 99.01
KOG4244281 consensus Failed axon connections (fax) protein/gl 98.98
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 98.91
KOG3027257 consensus Mitochondrial outer membrane protein Met 98.91
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 98.89
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 98.73
KOG2903319 consensus Predicted glutathione S-transferase [Pos 98.72
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 98.65
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 98.62
KOG3028313 consensus Translocase of outer mitochondrial membr 98.57
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 98.53
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 98.53
cd03211126 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me 98.49
cd03212137 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, 98.48
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 98.46
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 98.45
KOG1147 712 consensus Glutamyl-tRNA synthetase [Translation, r 98.44
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 98.43
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 98.43
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 98.43
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 98.37
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 98.37
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 98.34
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 98.34
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 98.33
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 98.27
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 98.21
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 98.21
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 98.21
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 98.19
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 98.17
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandi 98.16
KOG3029370 consensus Glutathione S-transferase-related protei 98.15
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 98.14
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 98.14
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 98.09
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 98.06
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 98.0
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 97.97
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modificatio 97.94
PF14834117 GST_C_4: Glutathione S-transferase, C-terminal dom 97.94
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 97.91
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 97.85
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 97.71
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 97.63
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 97.49
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 97.33
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 97.3
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 97.16
PF04399132 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain 95.59
KOG1668231 consensus Elongation factor 1 beta/delta chain [Tr 95.25
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 95.19
cd03199128 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub 94.39
PF1056872 Tom37: Outer mitochondrial membrane transport comp 90.63
>KOG1627 consensus Translation elongation factor EF-1 gamma [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
Probab=100.00  E-value=5e-79  Score=509.85  Aligned_cols=156  Identities=51%  Similarity=0.943  Sum_probs=151.5

Q ss_pred             CCCCCCCCCCCchhHHHHHhcCCCccchhhhhhhhhhccCCCCceEEEEeeecCCCCceeEEecchhhHHHHhhHhhhhh
Q 016550          229 NPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKY  308 (387)
Q Consensus       229 ~P~~~lp~~~f~ld~~Kr~ysn~~~~~~~~a~~~fw~~~d~~~~s~w~~~yky~~el~~~fms~nli~g~~qrl~~~rk~  308 (387)
                      |||++||+|+|+||||||+|||+||  +.+|||||||||||||||||+|+||||+||+++||||||||||||||+++|||
T Consensus         1 ~pl~~lp~~~Fvldd~kr~ySn~dt--~~~a~P~f~e~~d~e~ys~w~~~Yky~eeL~~~fms~nli~g~~qrl~~~rk~   78 (160)
T KOG1627|consen    1 DPLDLLPKSTFVLDDWKRKYSNEDT--REVALPWFWEHFDPEGYSLWKVDYKYNEELTLTFMSCNLIGGFFQRLDKSRKY   78 (160)
T ss_pred             CchhhCCCCccchhhhhhhhccccc--ccccchHHHHHhCcccceeeeccccCchHHHHHHHHhhhhhHHHHHHHHHHHh
Confidence            7999999999999999999999999  77999999999999999999999999999999999999999999999999999


Q ss_pred             hceeEEEeecCCCceeEEEEEEeCCCCCcccc--ccCCCcCceeeeecCCCCHHHHHHHHHHHccCCCC--CCeeccccc
Q 016550          309 AFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIM--DECYDMELYDWKKVDINDEAQKERVSQMIEDHEPF--EGEALLDAK  384 (387)
Q Consensus       309 ~f~~~~v~g~~~~~~i~g~~~~rg~~~~~~~~--~~~~d~e~y~~~kld~~~~~~k~~~~~~~~~~~~~--~g~~~~~~k  384 (387)
                      +||||+|+|+|++++|+|+|+|||||+.+ .|  |++||||||+||||||+++|+|++|++||+|++++  +||.|+|||
T Consensus        79 ~f~~~~~~g~~~~~~i~g~~~~rg~ela~-~~spDwq~D~EsY~~tKLD~~see~k~~V~ey~sWeg~f~~~Gkaf~qgK  157 (160)
T KOG1627|consen   79 AFGSMVLFGENGNSTISGAWVFRGQELAP-AFSPDWQPDYESYTWTKLDPGSEETKELVNEYFSWEGPFEGNGKAFNDGK  157 (160)
T ss_pred             hheeEEEeccCCCCcceEEEEEecccccc-ccCccccccccceeeeecCCCCHHHHHHHHHHHhhcccccccchhhhccc
Confidence            99999999999999999999999999855 77  99999999999999999999999999999999975  469999999


Q ss_pred             ccC
Q 016550          385 CFK  387 (387)
Q Consensus       385 ~~k  387 (387)
                      |||
T Consensus       158 i~K  160 (160)
T KOG1627|consen  158 IFK  160 (160)
T ss_pred             ccC
Confidence            998



>PF00647 EF1G: Elongation factor 1 gamma, conserved domain; InterPro: IPR001662 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown] Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>KOG1668 consensus Elongation factor 1 beta/delta chain [Transcription] Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query387
1pbu_A162 Solution Structure Of The C-Terminal Domain Of The 5e-21
1aw9_A216 Structure Of Glutathione S-Transferase Iii In Apo F 4e-10
1bye_A213 Glutathione S-Transferase I From Mais In Complex Wi 2e-07
4iel_A229 Crystal Structure Of A Glutathione S-Transferase Fa 2e-07
3erf_A233 Crystal Structure Of Gtt2 From Saccharomyces Cerevi 3e-07
1axd_A209 Structure Of Glutathione S-transferase-i Bound With 3e-07
3m8n_A225 Crystal Structure Of A Possible Gutathione S-Tranfe 3e-07
1nhy_A219 Crystal Structure Of The Gst-Like Domain Of Elongat 1e-06
2uz8_A174 The Crystal Structure Of P18, Human Translation Elo 3e-05
3f6f_A210 Crystal Structure Of Glutathione Transferase Dmgstd 4e-05
3lxz_A229 Structure Of Probable Glutathione S-Transferase(Pp0 7e-05
4iq1_A231 Crystal Structure Of Glutathione S-transferase Mha_ 1e-04
2x64_A207 Glutathione-S-Transferase From Xylella Fastidiosa L 2e-04
2pmt_A203 Glutathione Transferase From Proteus Mirabilis Leng 2e-04
1jlv_A209 Anopheles Dirus Species B Glutathione S-transferase 3e-04
2vo4_A219 Glutathione Transferase From Glycine Max Length = 2 3e-04
3uap_A227 Crystal Structure Of Glutathione Transferase (Targe 5e-04
3vwx_A222 Structural Analysis Of An Epsilon-class Glutathione 8e-04
4hi7_A228 Crystal Structure Of Glutathione Transferase Homolo 9e-04
>pdb|1PBU|A Chain A, Solution Structure Of The C-Terminal Domain Of The Human Eef1bgamma Subunit Length = 162 Back     alignment and structure

Iteration: 1

Score = 98.6 bits (244), Expect = 5e-21, Method: Compositional matrix adjust. Identities = 55/154 (35%), Positives = 85/154 (55%), Gaps = 5/154 (3%) Query: 237 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG 296 S LDE+KR YSN T VA+ FW+ +D +G+SLW+ +Y++ +E T +F++ N + Sbjct: 11 STFALDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLIT 68 Query: 297 GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIP-QFIMDECYDMELYDWKKVD 355 G QR+D RK AF +++ G+ + G+W+FRGQE+ D D E Y W+K+D Sbjct: 69 GMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLD 128 Query: 356 INDEAQKERVSQMIEDHEPFE--GEALLDAKCFK 387 E + V + F+ G+A K FK Sbjct: 129 PGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK 162
>pdb|1AW9|A Chain A, Structure Of Glutathione S-Transferase Iii In Apo Form Length = 216 Back     alignment and structure
>pdb|1BYE|A Chain A, Glutathione S-Transferase I From Mais In Complex With Atrazine Glutathione Conjugate Length = 213 Back     alignment and structure
>pdb|4IEL|A Chain A, Crystal Structure Of A Glutathione S-Transferase Family Protein From Burkholderia Ambifaria, Target Efi-507141, With Bound Glutathione Length = 229 Back     alignment and structure
>pdb|3ERF|A Chain A, Crystal Structure Of Gtt2 From Saccharomyces Cerevisiae Length = 233 Back     alignment and structure
>pdb|1AXD|A Chain A, Structure Of Glutathione S-transferase-i Bound With The Ligand Lactoylglutathione Length = 209 Back     alignment and structure
>pdb|3M8N|A Chain A, Crystal Structure Of A Possible Gutathione S-Tranferase From Rhodopseudomonas Palustris Length = 225 Back     alignment and structure
>pdb|1NHY|A Chain A, Crystal Structure Of The Gst-Like Domain Of Elongation Factor 1-Gamma From Saccharomyces Cerevisiae Length = 219 Back     alignment and structure
>pdb|2UZ8|A Chain A, The Crystal Structure Of P18, Human Translation Elongation Factor 1 Epsilon 1 Length = 174 Back     alignment and structure
>pdb|3F6F|A Chain A, Crystal Structure Of Glutathione Transferase Dmgstd10 From Drosophila Melanogaster Length = 210 Back     alignment and structure
>pdb|3LXZ|A Chain A, Structure Of Probable Glutathione S-Transferase(Pp0183) From Pseudomonas Putida Length = 229 Back     alignment and structure
>pdb|4IQ1|A Chain A, Crystal Structure Of Glutathione S-transferase Mha_0454 (target Efi- 507015) From Mannheimia Haemolytica, Substrate-free Length = 231 Back     alignment and structure
>pdb|2X64|A Chain A, Glutathione-S-Transferase From Xylella Fastidiosa Length = 207 Back     alignment and structure
>pdb|2PMT|A Chain A, Glutathione Transferase From Proteus Mirabilis Length = 203 Back     alignment and structure
>pdb|1JLV|A Chain A, Anopheles Dirus Species B Glutathione S-transferases 1-3 Length = 209 Back     alignment and structure
>pdb|2VO4|A Chain A, Glutathione Transferase From Glycine Max Length = 219 Back     alignment and structure
>pdb|3UAP|A Chain A, Crystal Structure Of Glutathione Transferase (Target Efi-501774) From Methylococcus Capsulatus Str. Bath Length = 227 Back     alignment and structure
>pdb|3VWX|A Chain A, Structural Analysis Of An Epsilon-class Glutathione S-transferase From Housefly, Musca Domestica Length = 222 Back     alignment and structure
>pdb|4HI7|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Drosophilia Mojavensis, Target Efi-501819, With Bound Glutathione Length = 228 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query387
1pbu_A162 Elongation factor 1-gamma; alpha/beta, translation 6e-73
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 4e-61
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 4e-51
3lxz_A229 Glutathione S-transferase family protein; structur 8e-51
1axd_A209 Glutathione S-transferase I; transferase, herbicid 3e-41
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 1e-39
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 3e-35
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 7e-33
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 3e-32
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 4e-31
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 2e-30
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 5e-30
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 6e-30
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 1e-28
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 1e-28
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 2e-28
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 5e-28
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 7e-28
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 8e-28
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 1e-27
4g9h_A211 Glutathione S-transferase; GST, enzyme function in 2e-27
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 2e-27
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 9e-27
3tou_A226 Glutathione S-transferase protein; GSH binding sit 1e-26
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 1e-26
1r5a_A218 Glutathione transferase; glutathione S-transferase 7e-26
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 1e-25
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 2e-25
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 2e-24
1f2e_A201 Glutathione S-transferase; GST complexed with glut 2e-24
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 3e-24
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 7e-24
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 1e-23
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 7e-23
3niv_A222 Glutathione S-transferase; structural genomics, PS 1e-22
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 2e-22
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 2e-22
3lyp_A215 Stringent starvation protein A; structural genomic 2e-22
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 3e-22
4exj_A238 Uncharacterized protein; transferase-like protein, 4e-22
3n5o_A235 Glutathione transferase; seattle structural genomi 2e-21
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 2e-21
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 2e-20
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 4e-20
3lyk_A216 Stringent starvation protein A homolog; structural 1e-19
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 1e-18
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 3e-18
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 8e-18
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 4e-17
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 5e-17
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 9e-17
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 2e-16
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 1e-16
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 1e-16
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 2e-16
4dej_A231 Glutathione S-transferase related protein; transfe 1e-15
2fhe_A216 GST, glutathione S-transferase; transferase-substr 2e-15
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 2e-15
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 3e-15
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 3e-15
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 5e-15
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 6e-15
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 6e-15
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 6e-15
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 1e-14
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 1e-14
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 1e-14
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 2e-14
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 2e-14
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 3e-14
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 3e-14
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 6e-14
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 7e-14
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 7e-14
2ahe_A267 Chloride intracellular channel protein 4; glutathi 8e-14
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 1e-13
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 1e-13
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 1e-13
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 3e-13
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 3e-13
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 3e-13
4ecj_A244 Glutathione S-transferase; transferase-like protei 5e-13
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 6e-13
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 1e-12
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 2e-12
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 2e-12
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 6e-12
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 6e-12
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 2e-11
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 2e-11
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 2e-11
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 3e-11
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 5e-11
2r4v_A247 XAP121, chloride intracellular channel protein 2; 1e-10
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 8e-10
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 1e-08
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 2e-06
3r3e_A328 Uncharacterized protein YQJG; thioredoxin domain, 4e-06
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>1pbu_A Elongation factor 1-gamma; alpha/beta, translation; NMR {Homo sapiens} SCOP: d.58.46.1 Length = 162 Back     alignment and structure
 Score =  223 bits (570), Expect = 6e-73
 Identities = 59/163 (36%), Positives = 90/163 (55%), Gaps = 5/163 (3%)

Query: 228 KNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTV 287
           K+P   LP S   LDE+KR YSN  T    VA+  FW+ +D +G+SLW+ +Y++ +E T 
Sbjct: 2   KDPFAHLPKSTFALDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQ 59

Query: 288 SFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIP-QFIMDECYDM 346
           +F++ N + G  QR+D  RK AF  +++ G+     + G+W+FRGQE+      D   D 
Sbjct: 60  TFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDY 119

Query: 347 ELYDWKKVDINDEAQKERVSQMIEDHEPFE--GEALLDAKCFK 387
           E Y W+K+D   E  +  V +       F+  G+A    K FK
Sbjct: 120 ESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK 162


>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 Back     alignment and structure
>4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Length = 209 Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206 Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204 Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208 Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Length = 248 Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Length = 215 Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206 Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208 Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225 Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252 Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207 Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Length = 288 Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Length = 244 Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229 Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Length = 211 Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Length = 211 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Length = 211 Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Length = 260 Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Length = 362 Back     alignment and structure
>3r3e_A Uncharacterized protein YQJG; thioredoxin domain, GST, glutathione transferase, glutathion disulfide bond reductase, transferase; HET: GSH; 2.21A {Escherichia coli} Length = 328 Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Length = 352 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query387
1pbu_A162 Elongation factor 1-gamma; alpha/beta, translation 100.0
4glt_A225 Glutathione S-transferase-like protein; structural 99.96
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 99.96
3lxz_A229 Glutathione S-transferase family protein; structur 99.95
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 99.95
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 99.95
3tou_A226 Glutathione S-transferase protein; GSH binding sit 99.95
4gci_A211 Glutathione S-transferase; GST, enzyme function in 99.95
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 99.95
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 99.94
1f2e_A201 Glutathione S-transferase; GST complexed with glut 99.94
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 99.94
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 99.94
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 99.94
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 99.94
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 99.94
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 99.94
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 99.94
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 99.94
1axd_A209 Glutathione S-transferase I; transferase, herbicid 99.94
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 99.94
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 99.94
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 99.94
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 99.94
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 99.94
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 99.94
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 99.94
3lyp_A215 Stringent starvation protein A; structural genomic 99.94
3lyk_A216 Stringent starvation protein A homolog; structural 99.94
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 99.94
4exj_A238 Uncharacterized protein; transferase-like protein, 99.94
3niv_A222 Glutathione S-transferase; structural genomics, PS 99.93
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 99.93
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 99.93
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 99.93
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 99.93
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 99.93
4ikh_A244 Glutathione S-transferase; enzyme function initiat 99.93
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 99.93
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 99.93
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 99.93
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 99.93
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 99.93
3n5o_A235 Glutathione transferase; seattle structural genomi 99.93
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 99.93
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 99.93
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 99.93
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 99.93
1r5a_A218 Glutathione transferase; glutathione S-transferase 99.93
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 99.93
4ecj_A244 Glutathione S-transferase; transferase-like protei 99.93
4dej_A231 Glutathione S-transferase related protein; transfe 99.93
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 99.93
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 99.92
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 99.92
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 99.92
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 99.92
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 99.92
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 99.92
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 99.92
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 99.92
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 99.92
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 99.92
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 99.92
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 99.92
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 99.92
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 99.92
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 99.91
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 99.91
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 99.91
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 99.91
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 99.91
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 99.91
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 99.91
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 99.91
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 99.91
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 99.91
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 99.91
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 99.9
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 99.9
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 99.9
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 99.9
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 99.9
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 99.9
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 99.9
2fhe_A216 GST, glutathione S-transferase; transferase-substr 99.9
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 99.89
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 99.89
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 99.89
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 99.89
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 99.89
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 99.88
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 99.88
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 99.88
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.88
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 99.87
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.86
2r4v_A247 XAP121, chloride intracellular channel protein 2; 99.85
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 99.85
2ahe_A267 Chloride intracellular channel protein 4; glutathi 99.85
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 99.84
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 99.84
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 99.84
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 99.83
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 99.83
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 99.82
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 99.81
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 99.79
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.79
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 99.78
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 99.76
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 99.73
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 99.71
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 99.68
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 99.57
2hqt_A124 GU4 nucleic-binding protein 1; GST-fold, biosynthe 99.47
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 90.17
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 80.94
>1pbu_A Elongation factor 1-gamma; alpha/beta, translation; NMR {Homo sapiens} SCOP: d.58.46.1 Back     alignment and structure
Probab=100.00  E-value=3.5e-84  Score=557.86  Aligned_cols=158  Identities=37%  Similarity=0.734  Sum_probs=152.7

Q ss_pred             CCCCCCCCCCCCCchhHHHHHhcCCCccchhhhhhhhhhccCCCCceEEEEeeecCCCCceeEEecchhhHHHHhhHhhh
Q 016550          227 PKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLAR  306 (387)
Q Consensus       227 ~k~P~~~lp~~~f~ld~~Kr~ysn~~~~~~~~a~~~fw~~~d~~~~s~w~~~yky~~el~~~fms~nli~g~~qrl~~~r  306 (387)
                      +||||++||||+|+||+|||+|||+||  +++||||||||||+||||||+|+||||||||++|||||||||||||||++|
T Consensus         1 ~k~Pl~~Lp~s~f~lD~wKR~YSN~dt--~~~a~p~Fwe~fD~egySlw~~~Yky~del~~~FMs~NLI~GffQRle~~r   78 (162)
T 1pbu_A            1 AKDPFAHLPKSTFALDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLR   78 (162)
T ss_dssp             CCCGGGSSCCCCSCHHHHHHHHHHSCG--GGTHHHHHHSSCCTTTCEEEEECCSCGGGCCCSTTHHHHHHHHHHHGGGTG
T ss_pred             CcChHHhCCCCCCCHHHHhhhccCCCc--hhhHHHHHHHhCCcccceEEEEEecCcccccceEEEechhhhHHHHHHHhh
Confidence            589999999999999999999999999  899999999999999999999999999999999999999999999999999


Q ss_pred             hhhceeEEEeecCCCceeEEEEEEeCCCCCcccccc--CCCcCceeeeecCCCCHHHHHHHHHHHccCCC--CCCeeccc
Q 016550          307 KYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDE--CYDMELYDWKKVDINDEAQKERVSQMIEDHEP--FEGEALLD  382 (387)
Q Consensus       307 k~~f~~~~v~g~~~~~~i~g~~~~rg~~~~~~~~~~--~~d~e~y~~~kld~~~~~~k~~~~~~~~~~~~--~~g~~~~~  382 (387)
                      ||+||||+||||+|++.|+||||||||++ +|.++.  ++|||||+|+|||++++|||++|++||||+++  ++||+++|
T Consensus        79 KyaFg~~~v~Ge~~~~~I~Gvwv~RGq~~-~f~l~~d~~~D~esy~w~KLD~~~~e~k~~v~~y~~w~~~~~~~Gk~~~d  157 (162)
T 1pbu_A           79 KNAFASVILFGTNNSSSISGVWVFRGQEL-AFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQ  157 (162)
T ss_dssp             GGEEECCEEESCSTTCEEEEEEEESSSSC-SGGGCGGGCSSGGGSCCEECCTTSSHHHHHHHHHHHSCSCCTTTCSCCCE
T ss_pred             heeeEEEEEEecCCCceEEEEEEEecCcc-eeeecccccccccceEEEEcCCCCHHHHHHHHHHhhcCCCcccCCEEccc
Confidence            99999999999999999999999999999 547754  67889999999999999999999999999997  89999999


Q ss_pred             ccccC
Q 016550          383 AKCFK  387 (387)
Q Consensus       383 ~k~~k  387 (387)
                      |||||
T Consensus       158 gKvfK  162 (162)
T 1pbu_A          158 GKIFK  162 (162)
T ss_dssp             ECCCC
T ss_pred             ccccC
Confidence            99998



>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 387
d1pbua_162 d.58.46.1 (A:) Elongation factor 1-gamma C-termina 9e-74
d1nhya1144 a.45.1.1 (A:76-219) GST-like domain of elongation 1e-19
d1pmta1121 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabi 2e-13
d1axda1129 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays 6e-13
d1aw9a1135 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays 2e-12
d1f2ea1121 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas p 1e-11
d1n2aa1121 a.45.1.1 (A:81-201) Class beta GST {Escherichia co 1e-11
d1v2aa1125 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano 1e-11
d1gnwa1126 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress 1e-11
d1jlva1123 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Ano 3e-11
d1jlwa1127 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Ano 4e-11
d1gsua1133 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus 6e-10
d1r5aa1129 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Ano 8e-10
d2gsqa1127 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommast 9e-10
d2gsta1133 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norv 3e-09
d1b48a1143 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus mu 6e-09
d2hrkb1118 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, 7e-09
d2c4ja1133 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapi 7e-09
d1tw9a1129 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoid 1e-08
d2a2ra1132 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapi 1e-08
d1gula1140 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s 3e-08
d1k0da1151 a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni 5e-08
d2cvda1124 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo s 5e-08
d1nhya275 c.47.1.5 (A:1-75) GST-like domain of elongation fa 7e-08
d1k3ya1142 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo s 1e-07
d1e6ba1133 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cres 2e-07
d3gtub1140 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapi 4e-07
d2cvda274 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sap 5e-07
d1m0ua1127 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (D 7e-07
d1g7oa275 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli 9e-07
d1r5aa285 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph 2e-06
d2fhea1136 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepa 3e-06
d1tu7a277 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulu 3e-06
d1fw1a283 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi 3e-06
d2c4ja284 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapien 3e-06
d2fnoa287 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752 4e-06
d1b48a278 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musc 8e-06
d1axda280 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), 1e-05
d1jlva284 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph 1e-05
d1duga1140 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma j 2e-05
d1m0ua276 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Dr 2e-05
d2a2ra277 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien 2e-05
d1tw9a277 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides 4e-05
d1k3ya279 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sap 5e-05
d1gula277 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap 6e-05
d1tu7a1131 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvu 9e-05
d1f2ea280 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas pau 1e-04
d1aw9a281 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), 1e-04
d1e6ba280 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress 2e-04
d1n2aa280 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli 2e-04
d1oe8a281 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Sc 2e-04
d1eema298 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa 3e-04
d1pmta280 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabili 3e-04
d2gsqa275 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastre 4e-04
d1oyja1145 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sat 4e-04
d1oyja284 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ 5e-04
d1okta285 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasm 8e-04
d1ljra279 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap 0.001
d1okta1126 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Pla 0.001
d1oe8a1123 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke ( 0.003
d1gnwa284 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( 0.003
d1duga280 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma jap 0.003
>d1pbua_ d.58.46.1 (A:) Elongation factor 1-gamma C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: eEF1-gamma domain
family: eEF1-gamma domain
domain: Elongation factor 1-gamma C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  224 bits (573), Expect = 9e-74
 Identities = 59/163 (36%), Positives = 90/163 (55%), Gaps = 5/163 (3%)

Query: 228 KNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTV 287
           K+P   LP S   LDE+KR YSN  T    VA+  FW+ +D +G+SLW+ +Y++ +E T 
Sbjct: 2   KDPFAHLPKSTFALDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQ 59

Query: 288 SFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQ-FIMDECYDM 346
           +F++ N + G  QR+D  RK AF  +++ G+     + G+W+FRGQE+      D   D 
Sbjct: 60  TFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDY 119

Query: 347 ELYDWKKVDINDEAQKERVSQMIEDHEPFE--GEALLDAKCFK 387
           E Y W+K+D   E  +  V +       F+  G+A    K FK
Sbjct: 120 ESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK 162


>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 144 Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 121 Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 129 Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 135 Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 121 Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 126 Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 123 Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Length = 127 Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 129 Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 127 Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 143 Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 118 Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 129 Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 132 Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 142 Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 133 Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 127 Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 136 Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 77 Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Length = 87 Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 140 Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 131 Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 80 Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 81 Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 80 Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 75 Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 145 Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 85 Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 126 Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 123 Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query387
d1pbua_162 Elongation factor 1-gamma C-terminal domain {Human 100.0
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 99.86
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.77
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.77
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 99.74
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 99.73
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.72
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 99.72
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.72
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 99.71
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 99.7
d2gsqa1127 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.69
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 99.68
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 99.67
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 99.67
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.65
d1fw1a1125 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.65
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 99.64
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.64
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 99.63
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.63
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 99.62
d2a2ra1132 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1m0ua1127 Class sigma GST {Fruit fly (Drosophila melanogaste 99.61
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.58
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.58
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.58
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.56
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.55
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.54
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.54
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.53
d1okta1126 Pf GST {Malarial parasite (Plasmodium falciparum) 99.47
d1tu7a1131 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.41
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 99.31
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 98.99
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 98.95
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 98.93
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 98.91
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 98.9
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 98.88
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 98.86
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 98.85
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 98.84
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 98.83
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 98.82
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 98.8
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 98.72
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 98.7
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 98.61
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 98.53
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 98.51
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 98.49
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 98.48
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 98.44
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 98.38
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 98.36
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 98.35
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 98.33
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 98.3
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 98.29
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 98.29
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 98.28
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 98.28
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 98.23
d1z9ha1161 Microsomal prostaglandin E synthase-2 {Crab-eating 98.1
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 98.05
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 98.05
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 97.9
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 97.84
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 97.2
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 97.15
d2fnoa1149 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 96.25
d1g7oa1140 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 94.85
>d1pbua_ d.58.46.1 (A:) Elongation factor 1-gamma C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: eEF1-gamma domain
family: eEF1-gamma domain
domain: Elongation factor 1-gamma C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.4e-86  Score=568.47  Aligned_cols=158  Identities=37%  Similarity=0.730  Sum_probs=153.9

Q ss_pred             CCCCCCCCCCCCCchhHHHHHhcCCCccchhhhhhhhhhccCCCCceEEEEeeecCCCCceeEEecchhhHHHHhhHhhh
Q 016550          227 PKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLAR  306 (387)
Q Consensus       227 ~k~P~~~lp~~~f~ld~~Kr~ysn~~~~~~~~a~~~fw~~~d~~~~s~w~~~yky~~el~~~fms~nli~g~~qrl~~~r  306 (387)
                      +|||||+||||+|+||+|||+|||+||  |++|||||||||||||||||+|+||||+||+++|||||||||||||||++|
T Consensus         1 aK~Pld~Lp~s~f~lD~wKR~YSN~dt--~~~a~p~Fwe~fD~egySiw~~~Yky~~el~~~fmt~Nli~Gf~QRle~~r   78 (162)
T d1pbua_           1 AKDPFAHLPKSTFALDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLR   78 (162)
T ss_dssp             CCCGGGSSCCCCSCHHHHHHHHHHSCG--GGTHHHHHHSSCCTTTCEEEEECCSCGGGCCCSTTHHHHHHHHHHHGGGTG
T ss_pred             CcChHHHCCCCCCCHHHHHHhhccCCc--HHHHHHHHHHhCCcccceEEEEEEecCccCccEEEEecchhHHHHHHHHHh
Confidence            589999999999999999999999999  999999999999999999999999999999999999999999999999999


Q ss_pred             hhhceeEEEeecCCCceeEEEEEEeCCCCCcccc--ccCCCcCceeeeecCCCCHHHHHHHHHHHccCCCC--CCeeccc
Q 016550          307 KYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIM--DECYDMELYDWKKVDINDEAQKERVSQMIEDHEPF--EGEALLD  382 (387)
Q Consensus       307 k~~f~~~~v~g~~~~~~i~g~~~~rg~~~~~~~~--~~~~d~e~y~~~kld~~~~~~k~~~~~~~~~~~~~--~g~~~~~  382 (387)
                      |||||+|+||||+|++.|+||||||||++|+ ++  +++||||||+|+|||++++|||++|++||||++++  +||+++|
T Consensus        79 KyaFg~~~v~Ge~~~~~I~G~wv~RG~~~~~-~~~~d~~~D~Esy~~~KLD~~~~edk~~v~dy~~we~~~~~~gk~~~d  157 (162)
T d1pbua_          79 KNAFASVILFGTNNSSSISGVWVFRGQELAF-PLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQ  157 (162)
T ss_dssp             GGEEECCEEESCSTTCEEEEEEEESSSSCSG-GGCGGGCSSGGGSCCEECCTTSSHHHHHHHHHHHSCSCCTTTCSCCCE
T ss_pred             hhheeeEEEEeecCCceeEEEEEEcCCCCCc-cccccccCCccceEEEEcCCCCHHHHHHHHHHHccCCCcccCCeEccc
Confidence            9999999999999999999999999999976 65  89999999999999999999999999999999984  5999999


Q ss_pred             ccccC
Q 016550          383 AKCFK  387 (387)
Q Consensus       383 ~k~~k  387 (387)
                      |||||
T Consensus       158 gkvfK  162 (162)
T d1pbua_         158 GKIFK  162 (162)
T ss_dssp             ECCCC
T ss_pred             ccccC
Confidence            99998



>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure