Citrus Sinensis ID: 016550
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 387 | ||||||
| 225465198 | 423 | PREDICTED: elongation factor 1-gamma-lik | 1.0 | 0.914 | 0.855 | 0.0 | |
| 147789055 | 423 | hypothetical protein VITISV_021574 [Viti | 1.0 | 0.914 | 0.850 | 0.0 | |
| 359493457 | 424 | PREDICTED: elongation factor 1-gamma-lik | 0.997 | 0.910 | 0.843 | 0.0 | |
| 224145107 | 426 | predicted protein [Populus trichocarpa] | 0.992 | 0.901 | 0.840 | 0.0 | |
| 363808162 | 420 | uncharacterized protein LOC100810452 [Gl | 0.992 | 0.914 | 0.826 | 0.0 | |
| 13626392 | 422 | RecName: Full=Elongation factor 1-gamma; | 1.0 | 0.917 | 0.793 | 0.0 | |
| 413926103 | 414 | elongation factor 1-gamma 2 [Zea mays] g | 0.974 | 0.910 | 0.776 | 0.0 | |
| 242096224 | 417 | hypothetical protein SORBIDRAFT_10g02257 | 0.984 | 0.913 | 0.783 | 0.0 | |
| 356543373 | 418 | PREDICTED: elongation factor 1-gamma-lik | 0.989 | 0.916 | 0.803 | 1e-180 | |
| 226530767 | 414 | elongation factor 1-gamma 2 [Zea mays] g | 0.974 | 0.910 | 0.771 | 1e-179 |
| >gi|225465198|ref|XP_002264400.1| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 692 bits (1786), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 332/388 (85%), Positives = 353/388 (90%), Gaps = 1/388 (0%)
Query: 1 MGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIE 60
MGV+NKTPEFLKMNPIGKVPVLETPDGP+FESNAIARYV RLKADNPL GSS I+ HIE
Sbjct: 36 MGVSNKTPEFLKMNPIGKVPVLETPDGPVFESNAIARYVTRLKADNPLYGSSPIEYGHIE 95
Query: 61 QWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHS 120
QWIDF+SLEID NI WF PR+G AVYLP EEAAIA+LKRAL ALNTHLASNT+LVGHS
Sbjct: 96 QWIDFASLEIDANIGHWFRPRIGRAVYLPPFEEAAIAALKRALGALNTHLASNTFLVGHS 155
Query: 121 VTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPV 180
VTLADI+MTCNL +GFS++++KSFTSEFPH+ERYFWTMVN PNF KILGE+KQ SVPPV
Sbjct: 156 VTLADIVMTCNLYMGFSKLMTKSFTSEFPHVERYFWTMVNQPNFSKILGEVKQTASVPPV 215
Query: 181 QSAKKPTQSKEPAKPKAQAEPKKEAAKETAKPKVEDAG-EEEAPKPKPKNPLDLLPPSKM 239
SAKKP KE AKPK + EPKKE KE AKPK G EEEAPKPKPKNPLDLLPPSKM
Sbjct: 216 SSAKKPALPKEHAKPKHKDEPKKEVKKEPAKPKEAPVGEEEEAPKPKPKNPLDLLPPSKM 275
Query: 240 ILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFL 299
ILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFL
Sbjct: 276 ILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFL 335
Query: 300 QRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDE 359
QRMDLARKYAFGKML+IGSE PFKVKGLWLFRGQEIPQFI+DECYDMELY+WKKVDI+DE
Sbjct: 336 QRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFIIDECYDMELYEWKKVDISDE 395
Query: 360 AQKERVSQMIEDHEPFEGEALLDAKCFK 387
AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct: 396 AQKERVNQMIEDQEPFEGEALLDAKCFK 423
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147789055|emb|CAN75785.1| hypothetical protein VITISV_021574 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359493457|ref|XP_002278756.2| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224145107|ref|XP_002325529.1| predicted protein [Populus trichocarpa] gi|222862404|gb|EEE99910.1| predicted protein [Populus trichocarpa] gi|283136134|gb|ADB11386.1| gamma class glutathione transferase EF1Bgamma1 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|363808162|ref|NP_001242737.1| uncharacterized protein LOC100810452 [Glycine max] gi|255635419|gb|ACU18062.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|13626392|sp|Q9FUM1.1|EF1G_PRUAV RecName: Full=Elongation factor 1-gamma; Short=EF-1-gamma; AltName: Full=eEF-1B gamma gi|10444415|gb|AAG17901.1|AF297712_1 translation elongation factor 1-gamma [Prunus avium] | Back alignment and taxonomy information |
|---|
| >gi|413926103|gb|AFW66035.1| elongation factor 1-gamma 2 [Zea mays] gi|413926104|gb|AFW66036.1| elongation factor 1-gamma 2 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|242096224|ref|XP_002438602.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor] gi|241916825|gb|EER89969.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|356543373|ref|XP_003540135.1| PREDICTED: elongation factor 1-gamma-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|226530767|ref|NP_001151229.1| elongation factor 1-gamma 2 [Zea mays] gi|195645182|gb|ACG42059.1| elongation factor 1-gamma 2 [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 387 | ||||||
| TAIR|locus:2206535 | 413 | AT1G57720 [Arabidopsis thalian | 0.390 | 0.365 | 0.900 | 2.3e-144 | |
| TAIR|locus:2024311 | 414 | AT1G09640 [Arabidopsis thalian | 0.390 | 0.364 | 0.900 | 8.9e-143 | |
| MGI|MGI:1914410 | 437 | Eef1g "eukaryotic translation | 0.472 | 0.418 | 0.402 | 3.8e-56 | |
| RGD|1302939 | 437 | Eef1g "eukaryotic translation | 0.472 | 0.418 | 0.402 | 7.8e-56 | |
| UNIPROTKB|F1MG05 | 440 | EEF1G "Elongation factor 1-gam | 0.472 | 0.415 | 0.391 | 2.6e-55 | |
| UNIPROTKB|Q29387 | 432 | EEF1G "Elongation factor 1-gam | 0.472 | 0.423 | 0.396 | 3.3e-55 | |
| UNIPROTKB|E2R574 | 437 | EEF1G "Uncharacterized protein | 0.472 | 0.418 | 0.391 | 4.2e-55 | |
| UNIPROTKB|Q3SZV3 | 440 | EEF1G "Elongation factor 1-gam | 0.472 | 0.415 | 0.391 | 8.8e-55 | |
| DICTYBASE|DDB_G0282979 | 410 | efa1G "elongation factor 1 gam | 0.467 | 0.441 | 0.344 | 1.1e-54 | |
| UNIPROTKB|P26641 | 437 | EEF1G "Elongation factor 1-gam | 0.462 | 0.409 | 0.380 | 1.8e-54 |
| TAIR|locus:2206535 AT1G57720 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 744 (267.0 bits), Expect = 2.3e-144, Sum P(2) = 2.3e-144
Identities = 136/151 (90%), Positives = 143/151 (94%)
Query: 237 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG 296
S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVTLNKVG
Sbjct: 263 SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG 322
Query: 297 GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDI 356
GFLQRMDLARKY+FGKMLI GSE PFKVKGLWLFRG EIP+FIMDE YDMELY+W KVDI
Sbjct: 323 GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI 382
Query: 357 NDEAQKERVSQMIEDHEPFEGEALLDAKCFK 387
+DEAQKERVSQMIED EPFEGEALLDAKCFK
Sbjct: 383 SDEAQKERVSQMIEDAEPFEGEALLDAKCFK 413
|
|
| TAIR|locus:2024311 AT1G09640 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914410 Eef1g "eukaryotic translation elongation factor 1 gamma" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1302939 Eef1g "eukaryotic translation elongation factor 1 gamma" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MG05 EEF1G "Elongation factor 1-gamma" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q29387 EEF1G "Elongation factor 1-gamma" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R574 EEF1G "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3SZV3 EEF1G "Elongation factor 1-gamma" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0282979 efa1G "elongation factor 1 gamma" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P26641 EEF1G "Elongation factor 1-gamma" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pm.C_LG_XIX0193 | hypothetical protein (427 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 387 | |||
| pfam00647 | 105 | pfam00647, EF1G, Elongation factor 1 gamma, conser | 7e-55 | |
| cd03181 | 123 | cd03181, GST_C_EF1Bgamma_like, Glutathione S-trans | 6e-48 | |
| COG0625 | 211 | COG0625, Gst, Glutathione S-transferase [Posttrans | 2e-26 | |
| cd10294 | 123 | cd10294, GST_C_ValRS_N, Glutathione S-transferase | 5e-20 | |
| cd03044 | 75 | cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subu | 7e-16 | |
| PLN02907 | 722 | PLN02907, PLN02907, glutamate-tRNA ligase | 2e-14 | |
| PLN02395 | 215 | PLN02395, PLN02395, glutathione S-transferase | 2e-13 | |
| PLN02473 | 214 | PLN02473, PLN02473, glutathione S-transferase | 4e-13 | |
| cd00299 | 100 | cd00299, GST_C_family, C-terminal, alpha helical d | 2e-10 | |
| cd10289 | 82 | cd10289, GST_C_AaRS_like, Glutathione S-transferas | 5e-10 | |
| pfam02798 | 74 | pfam02798, GST_N, Glutathione S-transferase, N-ter | 6e-10 | |
| cd10305 | 101 | cd10305, GST_C_AIMP3, Glutathione S-transferase C- | 6e-10 | |
| cd00570 | 71 | cd00570, GST_N_family, Glutathione S-transferase ( | 6e-10 | |
| cd03053 | 76 | cd03053, GST_N_Phi, GST_N family, Class Phi subfam | 9e-10 | |
| cd03056 | 73 | cd03056, GST_N_4, GST_N family, unknown subfamily | 3e-09 | |
| cd03047 | 73 | cd03047, GST_N_2, GST_N family, unknown subfamily | 4e-09 | |
| cd03189 | 123 | cd03189, GST_C_GTT1_like, C-terminal, alpha helica | 4e-08 | |
| cd03057 | 77 | cd03057, GST_N_Beta, GST_N family, Class Beta subf | 8e-08 | |
| pfam13409 | 68 | pfam13409, GST_N_2, Glutathione S-transferase, N-t | 8e-08 | |
| pfam00043 | 92 | pfam00043, GST_C, Glutathione S-transferase, C-ter | 9e-08 | |
| cd10309 | 81 | cd10309, GST_C_GluProRS_N, Glutathione S-transfera | 1e-07 | |
| cd03051 | 74 | cd03051, GST_N_GTT2_like, GST_N family, Saccharomy | 2e-07 | |
| cd03048 | 81 | cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-lik | 3e-07 | |
| cd03046 | 76 | cd03046, GST_N_GTT1_like, GST_N family, Saccharomy | 3e-07 | |
| cd03207 | 101 | cd03207, GST_C_8, C-terminal, alpha helical domain | 3e-07 | |
| pfam13410 | 69 | pfam13410, GST_C_2, Glutathione S-transferase, C-t | 5e-07 | |
| cd03050 | 76 | cd03050, GST_N_Theta, GST_N family, Class Theta su | 5e-07 | |
| PRK10542 | 201 | PRK10542, PRK10542, glutathionine S-transferase; P | 5e-07 | |
| pfam13417 | 75 | pfam13417, GST_N_3, Glutathione S-transferase, N-t | 1e-06 | |
| cd03049 | 73 | cd03049, GST_N_3, GST_N family, unknown subfamily | 1e-06 | |
| TIGR01262 | 210 | TIGR01262, maiA, maleylacetoacetate isomerase | 8e-06 | |
| cd03180 | 110 | cd03180, GST_C_2, C-terminal, alpha helical domain | 8e-06 | |
| cd10308 | 82 | cd10308, GST_C_eEF1b_like, Glutathione S-transfera | 4e-05 | |
| PLN02378 | 213 | PLN02378, PLN02378, glutathione S-transferase DHAR | 4e-05 | |
| cd03043 | 73 | cd03043, GST_N_1, GST_N family, unknown subfamily | 4e-05 | |
| cd03045 | 74 | cd03045, GST_N_Delta_Epsilon, GST_N family, Class | 6e-05 | |
| cd10306 | 87 | cd10306, GST_C_GluRS_N, Glutathione S-transferase | 9e-05 | |
| cd03182 | 116 | cd03182, GST_C_GTT2_like, C-terminal, alpha helica | 1e-04 | |
| cd03206 | 100 | cd03206, GST_C_7, C-terminal, alpha helical domain | 1e-04 | |
| cd03178 | 110 | cd03178, GST_C_Ure2p_like, C-terminal, alpha helic | 3e-04 | |
| cd03042 | 73 | cd03042, GST_N_Zeta, GST_N family, Class Zeta subf | 3e-04 | |
| PRK10357 | 202 | PRK10357, PRK10357, putative glutathione S-transfe | 3e-04 | |
| cd03058 | 74 | cd03058, GST_N_Tau, GST_N family, Class Tau subfam | 4e-04 | |
| cd03055 | 89 | cd03055, GST_N_Omega, GST_N family, Class Omega su | 4e-04 | |
| PRK11752 | 264 | PRK11752, PRK11752, putative S-transferase; Provis | 5e-04 | |
| cd03198 | 119 | cd03198, GST_C_CLIC, C-terminal, alpha helical dom | 6e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 6e-04 | |
| cd03188 | 113 | cd03188, GST_C_Beta, C-terminal, alpha helical dom | 7e-04 | |
| cd03190 | 142 | cd03190, GST_C_Omega_like, C-terminal, alpha helic | 8e-04 | |
| cd03177 | 117 | cd03177, GST_C_Delta_Epsilon, C-terminal, alpha he | 0.002 | |
| PRK05996 | 423 | PRK05996, motB, flagellar motor protein MotB; Vali | 0.002 |
| >gnl|CDD|201369 pfam00647, EF1G, Elongation factor 1 gamma, conserved domain | Back alignment and domain information |
|---|
Score = 175 bits (447), Expect = 7e-55
Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 2/107 (1%)
Query: 228 KNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTV 287
KNPLD LP S LDEWKR YSN T R VA+ FW+ +DPEGYS+W+ +YKYNDE +
Sbjct: 1 KNPLDALPKSTFNLDEWKRQYSNEDT--RTVALPYFWEHFDPEGYSIWYVEYKYNDELKL 58
Query: 288 SFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQE 334
F+T N +GGF QR++ +RKYAFG + + G + + G+W+FRGQE
Sbjct: 59 VFMTCNLIGGFFQRLEKSRKYAFGSVSVYGEDNNSDISGVWVFRGQE 105
|
Length = 105 |
| >gnl|CDD|198290 cd03181, GST_C_EF1Bgamma_like, Glutathione S-transferase C-terminal-like, alpha helical domain of the Gamma subunit of Elongation Factor 1B and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|198327 cd10294, GST_C_ValRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of vertebrate Valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|239342 cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|215492 PLN02907, PLN02907, glutamate-tRNA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|166036 PLN02395, PLN02395, glutathione S-transferase | Back alignment and domain information |
|---|
| >gnl|CDD|166114 PLN02473, PLN02473, glutathione S-transferase | Back alignment and domain information |
|---|
| >gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family | Back alignment and domain information |
|---|
| >gnl|CDD|198322 cd10289, GST_C_AaRS_like, Glutathione S-transferase C-terminal-like, alpha helical domain of various Aminoacyl-tRNA synthetases and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|198338 cd10305, GST_C_AIMP3, Glutathione S-transferase C-terminal-like, alpha helical domain of Aminoacyl tRNA synthetase complex-Interacting Multifunctional Protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239345 cd03047, GST_N_2, GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|198298 cd03189, GST_C_GTT1_like, C-terminal, alpha helical domain of GTT1-like Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|239355 cd03057, GST_N_Beta, GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|198342 cd10309, GST_C_GluProRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of bifunctional Glutamyl-Prolyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|239349 cd03051, GST_N_GTT2_like, GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >gnl|CDD|239346 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >gnl|CDD|198316 cd03207, GST_C_8, C-terminal, alpha helical domain of an unknown subfamily 8 of Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >gnl|CDD|182533 PRK10542, PRK10542, glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239347 cd03049, GST_N_3, GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|198289 cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|198341 cd10308, GST_C_eEF1b_like, Glutathione S-transferase C-terminal-like, alpha helical domain of eukaryotic translation Elongation Factor 1 beta | Back alignment and domain information |
|---|
| >gnl|CDD|166019 PLN02378, PLN02378, glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >gnl|CDD|239341 cd03043, GST_N_1, GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239343 cd03045, GST_N_Delta_Epsilon, GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|198339 cd10306, GST_C_GluRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of Glutamyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|198291 cd03182, GST_C_GTT2_like, C-terminal, alpha helical domain of GTT2-like Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|198315 cd03206, GST_C_7, C-terminal, alpha helical domain of an unknown subfamily 7 of Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|198288 cd03178, GST_C_Ure2p_like, C-terminal, alpha helical domain of Ure2p and related Glutathione S-transferase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|182405 PRK10357, PRK10357, putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239356 cd03058, GST_N_Tau, GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|239353 cd03055, GST_N_Omega, GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|183298 PRK11752, PRK11752, putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|198307 cd03198, GST_C_CLIC, C-terminal, alpha helical domain of Chloride Intracellular Channels | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|198297 cd03188, GST_C_Beta, C-terminal, alpha helical domain of Class Beta Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|198299 cd03190, GST_C_Omega_like, C-terminal, alpha helical domain of Class Omega-like Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|198287 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha helical domain of Class Delta and Epsilon Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|235665 PRK05996, motB, flagellar motor protein MotB; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 387 | |||
| KOG1627 | 160 | consensus Translation elongation factor EF-1 gamma | 100.0 | |
| PF00647 | 107 | EF1G: Elongation factor 1 gamma, conserved domain; | 100.0 | |
| PLN02395 | 215 | glutathione S-transferase | 99.94 | |
| PLN02473 | 214 | glutathione S-transferase | 99.93 | |
| PRK10542 | 201 | glutathionine S-transferase; Provisional | 99.93 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 99.92 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 99.92 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 99.92 | |
| KOG0867 | 226 | consensus Glutathione S-transferase [Posttranslati | 99.92 | |
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 99.91 | |
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 99.91 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 99.91 | |
| PRK11752 | 264 | putative S-transferase; Provisional | 99.9 | |
| KOG0406 | 231 | consensus Glutathione S-transferase [Posttranslati | 99.86 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 99.85 | |
| KOG0868 | 217 | consensus Glutathione S-transferase [Posttranslati | 99.83 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 99.81 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 99.81 | |
| PTZ00057 | 205 | glutathione s-transferase; Provisional | 99.8 | |
| PLN02907 | 722 | glutamate-tRNA ligase | 99.79 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 99.78 | |
| KOG1695 | 206 | consensus Glutathione S-transferase [Posttranslati | 99.74 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 99.68 | |
| cd03181 | 123 | GST_C_EFB1gamma GST_C family, Gamma subunit of Elo | 99.66 | |
| cd03196 | 115 | GST_C_5 GST_C family, unknown subfamily 5; compose | 99.59 | |
| KOG4420 | 325 | consensus Uncharacterized conserved protein (Gangl | 99.59 | |
| cd03182 | 117 | GST_C_GTT2_like GST_C family, Saccharomyces cerevi | 99.57 | |
| cd03188 | 114 | GST_C_Beta GST_C family, Class Beta subfamily; GST | 99.56 | |
| cd03189 | 119 | GST_C_GTT1_like GST_C family, Saccharomyces cerevi | 99.55 | |
| cd03178 | 113 | GST_C_Ure2p_like GST_C family, Ure2p-like subfamil | 99.54 | |
| cd03187 | 118 | GST_C_Phi GST_C family, Class Phi subfamily; compo | 99.52 | |
| cd03185 | 126 | GST_C_Tau GST_C family, Class Tau subfamily; GSTs | 99.5 | |
| cd03186 | 107 | GST_C_SspA GST_N family, Stringent starvation prot | 99.5 | |
| cd03180 | 110 | GST_C_2 GST_C family, unknown subfamily 2; compose | 99.49 | |
| cd03191 | 121 | GST_C_Zeta GST_C family, Class Zeta subfamily; GST | 99.48 | |
| cd03177 | 118 | GST_C_Delta_Epsilon GST_C family, Class Delta and | 99.48 | |
| cd03190 | 142 | GST_C_ECM4_like GST_C family, ECM4-like subfamily; | 99.44 | |
| cd03183 | 126 | GST_C_Theta GST_C family, Class Theta subfamily; c | 99.43 | |
| cd03200 | 96 | GST_C_JTV1 GST_C family, JTV-1 subfamily; composed | 99.41 | |
| cd03206 | 100 | GST_C_7 GST_C family, unknown subfamily 7; compose | 99.37 | |
| cd03207 | 103 | GST_C_8 GST_C family, unknown subfamily 8; compose | 99.36 | |
| KOG1422 | 221 | consensus Intracellular Cl- channel CLIC, contains | 99.34 | |
| cd03179 | 105 | GST_C_1 GST_C family, unknown subfamily 1; compose | 99.33 | |
| cd03209 | 121 | GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar | 99.29 | |
| cd03184 | 124 | GST_C_Omega GST_C family, Class Omega subfamily; G | 99.29 | |
| cd03203 | 120 | GST_C_Lambda GST_C family, Class Lambda subfamily; | 99.28 | |
| PF00043 | 95 | GST_C: Glutathione S-transferase, C-terminal domai | 99.24 | |
| cd03195 | 114 | GST_C_4 GST_C family, unknown subfamily 4; compose | 99.24 | |
| cd03204 | 111 | GST_C_GDAP1 GST_C family, Ganglioside-induced diff | 99.21 | |
| cd03210 | 126 | GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar | 99.21 | |
| cd03198 | 134 | GST_C_CLIC GST_C family, Chloride Intracellular Ch | 99.2 | |
| PF14497 | 99 | GST_C_3: Glutathione S-transferase, C-terminal dom | 99.17 | |
| cd00299 | 100 | GST_C_family Glutathione S-transferase (GST) famil | 99.17 | |
| PF13410 | 69 | GST_C_2: Glutathione S-transferase, C-terminal dom | 99.14 | |
| cd03208 | 137 | GST_C_Alpha GST_C family, Class Alpha subfamily; G | 99.12 | |
| cd03192 | 104 | GST_C_Sigma_like GST_C family, Class Sigma_like; c | 99.08 | |
| cd03205 | 98 | GST_C_6 GST_C family, unknown subfamily 6; compose | 99.04 | |
| cd03201 | 121 | GST_C_DHAR GST_C family, Dehydroascorbate Reductas | 99.02 | |
| cd03194 | 114 | GST_C_3 GST_C family, unknown subfamily 3; compose | 99.01 | |
| KOG4244 | 281 | consensus Failed axon connections (fax) protein/gl | 98.98 | |
| COG0435 | 324 | ECM4 Predicted glutathione S-transferase [Posttran | 98.91 | |
| KOG3027 | 257 | consensus Mitochondrial outer membrane protein Met | 98.91 | |
| cd03193 | 88 | GST_C_Metaxin GST_C family, Metaxin subfamily; com | 98.89 | |
| cd03202 | 124 | GST_C_etherase_LigE GST_C family, Beta etherase Li | 98.73 | |
| KOG2903 | 319 | consensus Predicted glutathione S-transferase [Pos | 98.72 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 98.65 | |
| PF02798 | 76 | GST_N: Glutathione S-transferase, N-terminal domai | 98.62 | |
| KOG3028 | 313 | consensus Translocase of outer mitochondrial membr | 98.57 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 98.53 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 98.53 | |
| cd03211 | 126 | GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me | 98.49 | |
| cd03212 | 137 | GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, | 98.48 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 98.46 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 98.45 | |
| KOG1147 | 712 | consensus Glutamyl-tRNA synthetase [Translation, r | 98.44 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 98.43 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 98.43 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 98.43 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 98.37 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 98.37 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 98.34 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 98.34 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 98.33 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 98.27 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 98.21 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 98.21 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 98.21 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 98.19 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 98.17 | |
| cd03197 | 149 | GST_C_mPGES2 GST_C family; microsomal Prostaglandi | 98.16 | |
| KOG3029 | 370 | consensus Glutathione S-transferase-related protei | 98.15 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 98.14 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 98.14 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 98.09 | |
| cd03075 | 82 | GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar | 98.06 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 98.0 | |
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 97.97 | |
| COG2999 | 215 | GrxB Glutaredoxin 2 [Posttranslational modificatio | 97.94 | |
| PF14834 | 117 | GST_C_4: Glutathione S-transferase, C-terminal dom | 97.94 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 97.91 | |
| cd03077 | 79 | GST_N_Alpha GST_N family, Class Alpha subfamily; G | 97.85 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 97.71 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 97.63 | |
| cd03079 | 74 | GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me | 97.49 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 97.33 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 97.3 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 97.16 | |
| PF04399 | 132 | Glutaredoxin2_C: Glutaredoxin 2, C terminal domain | 95.59 | |
| KOG1668 | 231 | consensus Elongation factor 1 beta/delta chain [Tr | 95.25 | |
| cd03078 | 73 | GST_N_Metaxin1_like GST_N family, Metaxin subfamil | 95.19 | |
| cd03199 | 128 | GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub | 94.39 | |
| PF10568 | 72 | Tom37: Outer mitochondrial membrane transport comp | 90.63 |
| >KOG1627 consensus Translation elongation factor EF-1 gamma [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5e-79 Score=509.85 Aligned_cols=156 Identities=51% Similarity=0.943 Sum_probs=151.5
Q ss_pred CCCCCCCCCCCchhHHHHHhcCCCccchhhhhhhhhhccCCCCceEEEEeeecCCCCceeEEecchhhHHHHhhHhhhhh
Q 016550 229 NPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKY 308 (387)
Q Consensus 229 ~P~~~lp~~~f~ld~~Kr~ysn~~~~~~~~a~~~fw~~~d~~~~s~w~~~yky~~el~~~fms~nli~g~~qrl~~~rk~ 308 (387)
|||++||+|+|+||||||+|||+|| +.+|||||||||||||||||+|+||||+||+++||||||||||||||+++|||
T Consensus 1 ~pl~~lp~~~Fvldd~kr~ySn~dt--~~~a~P~f~e~~d~e~ys~w~~~Yky~eeL~~~fms~nli~g~~qrl~~~rk~ 78 (160)
T KOG1627|consen 1 DPLDLLPKSTFVLDDWKRKYSNEDT--REVALPWFWEHFDPEGYSLWKVDYKYNEELTLTFMSCNLIGGFFQRLDKSRKY 78 (160)
T ss_pred CchhhCCCCccchhhhhhhhccccc--ccccchHHHHHhCcccceeeeccccCchHHHHHHHHhhhhhHHHHHHHHHHHh
Confidence 7999999999999999999999999 77999999999999999999999999999999999999999999999999999
Q ss_pred hceeEEEeecCCCceeEEEEEEeCCCCCcccc--ccCCCcCceeeeecCCCCHHHHHHHHHHHccCCCC--CCeeccccc
Q 016550 309 AFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIM--DECYDMELYDWKKVDINDEAQKERVSQMIEDHEPF--EGEALLDAK 384 (387)
Q Consensus 309 ~f~~~~v~g~~~~~~i~g~~~~rg~~~~~~~~--~~~~d~e~y~~~kld~~~~~~k~~~~~~~~~~~~~--~g~~~~~~k 384 (387)
+||||+|+|+|++++|+|+|+|||||+.+ .| |++||||||+||||||+++|+|++|++||+|++++ +||.|+|||
T Consensus 79 ~f~~~~~~g~~~~~~i~g~~~~rg~ela~-~~spDwq~D~EsY~~tKLD~~see~k~~V~ey~sWeg~f~~~Gkaf~qgK 157 (160)
T KOG1627|consen 79 AFGSMVLFGENGNSTISGAWVFRGQELAP-AFSPDWQPDYESYTWTKLDPGSEETKELVNEYFSWEGPFEGNGKAFNDGK 157 (160)
T ss_pred hheeEEEeccCCCCcceEEEEEecccccc-ccCccccccccceeeeecCCCCHHHHHHHHHHHhhcccccccchhhhccc
Confidence 99999999999999999999999999855 77 99999999999999999999999999999999975 469999999
Q ss_pred ccC
Q 016550 385 CFK 387 (387)
Q Consensus 385 ~~k 387 (387)
|||
T Consensus 158 i~K 160 (160)
T KOG1627|consen 158 IFK 160 (160)
T ss_pred ccC
Confidence 998
|
|
| >PF00647 EF1G: Elongation factor 1 gamma, conserved domain; InterPro: IPR001662 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] | Back alignment and domain information |
|---|
| >PLN02395 glutathione S-transferase | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK10542 glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK11752 putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >PTZ00057 glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02907 glutamate-tRNA ligase | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown] | Back alignment and domain information |
|---|
| >cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 | Back alignment and domain information |
|---|
| >cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene | Back alignment and domain information |
|---|
| >cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs | Back alignment and domain information |
|---|
| >PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins | Back alignment and domain information |
|---|
| >PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B | Back alignment and domain information |
|---|
| >cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B | Back alignment and domain information |
|---|
| >cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha | Back alignment and domain information |
|---|
| >cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant | Back alignment and domain information |
|---|
| >cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >KOG1668 consensus Elongation factor 1 beta/delta chain [Transcription] | Back alignment and domain information |
|---|
| >cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi | Back alignment and domain information |
|---|
| >cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 387 | ||||
| 1pbu_A | 162 | Solution Structure Of The C-Terminal Domain Of The | 5e-21 | ||
| 1aw9_A | 216 | Structure Of Glutathione S-Transferase Iii In Apo F | 4e-10 | ||
| 1bye_A | 213 | Glutathione S-Transferase I From Mais In Complex Wi | 2e-07 | ||
| 4iel_A | 229 | Crystal Structure Of A Glutathione S-Transferase Fa | 2e-07 | ||
| 3erf_A | 233 | Crystal Structure Of Gtt2 From Saccharomyces Cerevi | 3e-07 | ||
| 1axd_A | 209 | Structure Of Glutathione S-transferase-i Bound With | 3e-07 | ||
| 3m8n_A | 225 | Crystal Structure Of A Possible Gutathione S-Tranfe | 3e-07 | ||
| 1nhy_A | 219 | Crystal Structure Of The Gst-Like Domain Of Elongat | 1e-06 | ||
| 2uz8_A | 174 | The Crystal Structure Of P18, Human Translation Elo | 3e-05 | ||
| 3f6f_A | 210 | Crystal Structure Of Glutathione Transferase Dmgstd | 4e-05 | ||
| 3lxz_A | 229 | Structure Of Probable Glutathione S-Transferase(Pp0 | 7e-05 | ||
| 4iq1_A | 231 | Crystal Structure Of Glutathione S-transferase Mha_ | 1e-04 | ||
| 2x64_A | 207 | Glutathione-S-Transferase From Xylella Fastidiosa L | 2e-04 | ||
| 2pmt_A | 203 | Glutathione Transferase From Proteus Mirabilis Leng | 2e-04 | ||
| 1jlv_A | 209 | Anopheles Dirus Species B Glutathione S-transferase | 3e-04 | ||
| 2vo4_A | 219 | Glutathione Transferase From Glycine Max Length = 2 | 3e-04 | ||
| 3uap_A | 227 | Crystal Structure Of Glutathione Transferase (Targe | 5e-04 | ||
| 3vwx_A | 222 | Structural Analysis Of An Epsilon-class Glutathione | 8e-04 | ||
| 4hi7_A | 228 | Crystal Structure Of Glutathione Transferase Homolo | 9e-04 |
| >pdb|1PBU|A Chain A, Solution Structure Of The C-Terminal Domain Of The Human Eef1bgamma Subunit Length = 162 | Back alignment and structure |
|
| >pdb|1AW9|A Chain A, Structure Of Glutathione S-Transferase Iii In Apo Form Length = 216 | Back alignment and structure |
| >pdb|1BYE|A Chain A, Glutathione S-Transferase I From Mais In Complex With Atrazine Glutathione Conjugate Length = 213 | Back alignment and structure |
| >pdb|4IEL|A Chain A, Crystal Structure Of A Glutathione S-Transferase Family Protein From Burkholderia Ambifaria, Target Efi-507141, With Bound Glutathione Length = 229 | Back alignment and structure |
| >pdb|3ERF|A Chain A, Crystal Structure Of Gtt2 From Saccharomyces Cerevisiae Length = 233 | Back alignment and structure |
| >pdb|1AXD|A Chain A, Structure Of Glutathione S-transferase-i Bound With The Ligand Lactoylglutathione Length = 209 | Back alignment and structure |
| >pdb|3M8N|A Chain A, Crystal Structure Of A Possible Gutathione S-Tranferase From Rhodopseudomonas Palustris Length = 225 | Back alignment and structure |
| >pdb|1NHY|A Chain A, Crystal Structure Of The Gst-Like Domain Of Elongation Factor 1-Gamma From Saccharomyces Cerevisiae Length = 219 | Back alignment and structure |
| >pdb|2UZ8|A Chain A, The Crystal Structure Of P18, Human Translation Elongation Factor 1 Epsilon 1 Length = 174 | Back alignment and structure |
| >pdb|3F6F|A Chain A, Crystal Structure Of Glutathione Transferase Dmgstd10 From Drosophila Melanogaster Length = 210 | Back alignment and structure |
| >pdb|3LXZ|A Chain A, Structure Of Probable Glutathione S-Transferase(Pp0183) From Pseudomonas Putida Length = 229 | Back alignment and structure |
| >pdb|4IQ1|A Chain A, Crystal Structure Of Glutathione S-transferase Mha_0454 (target Efi- 507015) From Mannheimia Haemolytica, Substrate-free Length = 231 | Back alignment and structure |
| >pdb|2X64|A Chain A, Glutathione-S-Transferase From Xylella Fastidiosa Length = 207 | Back alignment and structure |
| >pdb|2PMT|A Chain A, Glutathione Transferase From Proteus Mirabilis Length = 203 | Back alignment and structure |
| >pdb|1JLV|A Chain A, Anopheles Dirus Species B Glutathione S-transferases 1-3 Length = 209 | Back alignment and structure |
| >pdb|2VO4|A Chain A, Glutathione Transferase From Glycine Max Length = 219 | Back alignment and structure |
| >pdb|3UAP|A Chain A, Crystal Structure Of Glutathione Transferase (Target Efi-501774) From Methylococcus Capsulatus Str. Bath Length = 227 | Back alignment and structure |
| >pdb|3VWX|A Chain A, Structural Analysis Of An Epsilon-class Glutathione S-transferase From Housefly, Musca Domestica Length = 222 | Back alignment and structure |
| >pdb|4HI7|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Drosophilia Mojavensis, Target Efi-501819, With Bound Glutathione Length = 228 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 387 | |||
| 1pbu_A | 162 | Elongation factor 1-gamma; alpha/beta, translation | 6e-73 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 4e-61 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 4e-51 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 8e-51 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 3e-41 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 1e-39 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 3e-35 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 7e-33 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 3e-32 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 4e-31 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 2e-30 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 5e-30 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 6e-30 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 1e-28 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 1e-28 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 2e-28 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 5e-28 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 7e-28 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 8e-28 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 1e-27 | |
| 4g9h_A | 211 | Glutathione S-transferase; GST, enzyme function in | 2e-27 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 2e-27 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 9e-27 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 1e-26 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 1e-26 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 7e-26 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 1e-25 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 2e-25 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 2e-24 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 2e-24 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 3e-24 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 7e-24 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 1e-23 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 7e-23 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 1e-22 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 2e-22 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 2e-22 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 2e-22 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 3e-22 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 4e-22 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 2e-21 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 2e-21 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 2e-20 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 4e-20 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 1e-19 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 1e-18 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 3e-18 | |
| 2hra_A | 209 | Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l | 8e-18 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 4e-17 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 5e-17 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 9e-17 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 2e-16 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 1e-16 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 1e-16 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 2e-16 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 1e-15 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 2e-15 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 2e-15 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 3e-15 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 3e-15 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 5e-15 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 6e-15 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 6e-15 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 6e-15 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 1e-14 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 1e-14 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 1e-14 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 2e-14 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 2e-14 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 3e-14 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 3e-14 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 6e-14 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 7e-14 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 7e-14 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 8e-14 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 1e-13 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 1e-13 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 1e-13 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 3e-13 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 3e-13 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 3e-13 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 5e-13 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 6e-13 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 1e-12 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 2e-12 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 2e-12 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 6e-12 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 6e-12 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 2e-11 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 2e-11 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 2e-11 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 3e-11 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 5e-11 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 1e-10 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 8e-10 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 1e-08 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 2e-06 | |
| 3r3e_A | 328 | Uncharacterized protein YQJG; thioredoxin domain, | 4e-06 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 |
| >1pbu_A Elongation factor 1-gamma; alpha/beta, translation; NMR {Homo sapiens} SCOP: d.58.46.1 Length = 162 | Back alignment and structure |
|---|
Score = 223 bits (570), Expect = 6e-73
Identities = 59/163 (36%), Positives = 90/163 (55%), Gaps = 5/163 (3%)
Query: 228 KNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTV 287
K+P LP S LDE+KR YSN T VA+ FW+ +D +G+SLW+ +Y++ +E T
Sbjct: 2 KDPFAHLPKSTFALDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQ 59
Query: 288 SFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIP-QFIMDECYDM 346
+F++ N + G QR+D RK AF +++ G+ + G+W+FRGQE+ D D
Sbjct: 60 TFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDY 119
Query: 347 ELYDWKKVDINDEAQKERVSQMIEDHEPFE--GEALLDAKCFK 387
E Y W+K+D E + V + F+ G+A K FK
Sbjct: 120 ESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK 162
|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 | Back alignment and structure |
|---|
| >4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 | Back alignment and structure |
|---|
| >2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Length = 209 | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249 | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204 | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208 | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Length = 248 | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206 | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208 | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221 | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225 | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252 | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207 | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Length = 288 | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Length = 244 | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229 | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Length = 211 | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Length = 211 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Length = 211 | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Length = 260 | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Length = 362 | Back alignment and structure |
|---|
| >3r3e_A Uncharacterized protein YQJG; thioredoxin domain, GST, glutathione transferase, glutathion disulfide bond reductase, transferase; HET: GSH; 2.21A {Escherichia coli} Length = 328 | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Length = 352 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 387 | |||
| 1pbu_A | 162 | Elongation factor 1-gamma; alpha/beta, translation | 100.0 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 99.96 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 99.96 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 99.95 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 99.95 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 99.95 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 99.95 | |
| 4gci_A | 211 | Glutathione S-transferase; GST, enzyme function in | 99.95 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 99.95 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 99.94 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 99.94 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 99.94 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 99.94 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 99.94 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 99.94 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 99.94 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 99.94 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 99.94 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 99.94 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 99.94 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 99.94 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 99.94 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 99.94 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 99.94 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 99.94 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 99.94 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 99.94 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 99.94 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 99.94 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 99.94 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 99.94 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 99.93 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 99.93 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 99.93 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 99.93 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 99.93 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 99.93 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 99.93 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 99.93 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 99.93 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 99.93 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 99.93 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 99.93 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 99.93 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 99.93 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 99.93 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 99.93 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 99.93 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 99.93 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 99.93 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 99.93 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 99.93 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 99.93 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 99.92 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 99.92 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 99.92 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 99.92 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 99.92 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 99.92 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 99.92 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 99.92 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 99.92 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 99.92 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 99.92 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 99.92 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 99.92 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 99.92 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 99.91 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 99.91 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 99.91 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 99.91 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 99.91 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 99.91 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 99.91 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 99.91 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 99.91 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 99.91 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 99.91 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 99.9 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 99.9 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 99.9 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 99.9 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 99.9 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 99.9 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 99.9 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 99.9 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 99.89 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 99.89 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 99.89 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 99.89 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 99.89 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 99.88 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 99.88 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 99.88 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 99.88 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 99.87 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 99.86 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 99.85 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 99.85 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 99.85 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 99.84 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 99.84 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 99.84 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 99.83 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 99.83 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 99.82 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 99.81 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 99.79 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.79 | |
| 2hra_A | 209 | Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l | 99.78 | |
| 4fqu_A | 313 | Putative glutathione transferase; glutathionyl-hyd | 99.76 | |
| 4g0i_A | 328 | Protein YQJG; glutathionyl-hydroquinone reductase, | 99.73 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 99.71 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 99.68 | |
| 2hsn_A | 160 | Methionyl-tRNA synthetase, cytoplasmic; protein co | 99.57 | |
| 2hqt_A | 124 | GU4 nucleic-binding protein 1; GST-fold, biosynthe | 99.47 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 90.17 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 80.94 |
| >1pbu_A Elongation factor 1-gamma; alpha/beta, translation; NMR {Homo sapiens} SCOP: d.58.46.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=3.5e-84 Score=557.86 Aligned_cols=158 Identities=37% Similarity=0.734 Sum_probs=152.7
Q ss_pred CCCCCCCCCCCCCchhHHHHHhcCCCccchhhhhhhhhhccCCCCceEEEEeeecCCCCceeEEecchhhHHHHhhHhhh
Q 016550 227 PKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLAR 306 (387)
Q Consensus 227 ~k~P~~~lp~~~f~ld~~Kr~ysn~~~~~~~~a~~~fw~~~d~~~~s~w~~~yky~~el~~~fms~nli~g~~qrl~~~r 306 (387)
+||||++||||+|+||+|||+|||+|| +++||||||||||+||||||+|+||||||||++|||||||||||||||++|
T Consensus 1 ~k~Pl~~Lp~s~f~lD~wKR~YSN~dt--~~~a~p~Fwe~fD~egySlw~~~Yky~del~~~FMs~NLI~GffQRle~~r 78 (162)
T 1pbu_A 1 AKDPFAHLPKSTFALDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLR 78 (162)
T ss_dssp CCCGGGSSCCCCSCHHHHHHHHHHSCG--GGTHHHHHHSSCCTTTCEEEEECCSCGGGCCCSTTHHHHHHHHHHHGGGTG
T ss_pred CcChHHhCCCCCCCHHHHhhhccCCCc--hhhHHHHHHHhCCcccceEEEEEecCcccccceEEEechhhhHHHHHHHhh
Confidence 589999999999999999999999999 899999999999999999999999999999999999999999999999999
Q ss_pred hhhceeEEEeecCCCceeEEEEEEeCCCCCcccccc--CCCcCceeeeecCCCCHHHHHHHHHHHccCCC--CCCeeccc
Q 016550 307 KYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDE--CYDMELYDWKKVDINDEAQKERVSQMIEDHEP--FEGEALLD 382 (387)
Q Consensus 307 k~~f~~~~v~g~~~~~~i~g~~~~rg~~~~~~~~~~--~~d~e~y~~~kld~~~~~~k~~~~~~~~~~~~--~~g~~~~~ 382 (387)
||+||||+||||+|++.|+||||||||++ +|.++. ++|||||+|+|||++++|||++|++||||+++ ++||+++|
T Consensus 79 KyaFg~~~v~Ge~~~~~I~Gvwv~RGq~~-~f~l~~d~~~D~esy~w~KLD~~~~e~k~~v~~y~~w~~~~~~~Gk~~~d 157 (162)
T 1pbu_A 79 KNAFASVILFGTNNSSSISGVWVFRGQEL-AFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQ 157 (162)
T ss_dssp GGEEECCEEESCSTTCEEEEEEEESSSSC-SGGGCGGGCSSGGGSCCEECCTTSSHHHHHHHHHHHSCSCCTTTCSCCCE
T ss_pred heeeEEEEEEecCCCceEEEEEEEecCcc-eeeecccccccccceEEEEcCCCCHHHHHHHHHHhhcCCCcccCCEEccc
Confidence 99999999999999999999999999999 547754 67889999999999999999999999999997 89999999
Q ss_pred ccccC
Q 016550 383 AKCFK 387 (387)
Q Consensus 383 ~k~~k 387 (387)
|||||
T Consensus 158 gKvfK 162 (162)
T 1pbu_A 158 GKIFK 162 (162)
T ss_dssp ECCCC
T ss_pred ccccC
Confidence 99998
|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A | Back alignment and structure |
|---|
| >4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} | Back alignment and structure |
|---|
| >4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 387 | ||||
| d1pbua_ | 162 | d.58.46.1 (A:) Elongation factor 1-gamma C-termina | 9e-74 | |
| d1nhya1 | 144 | a.45.1.1 (A:76-219) GST-like domain of elongation | 1e-19 | |
| d1pmta1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Proteus mirabi | 2e-13 | |
| d1axda1 | 129 | a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays | 6e-13 | |
| d1aw9a1 | 135 | a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays | 2e-12 | |
| d1f2ea1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Sphingomonas p | 1e-11 | |
| d1n2aa1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Escherichia co | 1e-11 | |
| d1v2aa1 | 125 | a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano | 1e-11 | |
| d1gnwa1 | 126 | a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress | 1e-11 | |
| d1jlva1 | 123 | a.45.1.1 (A:85-207) Class delta GST {Mosquito (Ano | 3e-11 | |
| d1jlwa1 | 127 | a.45.1.1 (A:91-217) Class delta GST {Mosquito (Ano | 4e-11 | |
| d1gsua1 | 133 | a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus | 6e-10 | |
| d1r5aa1 | 129 | a.45.1.1 (A:87-215) Class delta GST {Mosquito (Ano | 8e-10 | |
| d2gsqa1 | 127 | a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommast | 9e-10 | |
| d2gsta1 | 133 | a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norv | 3e-09 | |
| d1b48a1 | 143 | a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus mu | 6e-09 | |
| d2hrkb1 | 118 | a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, | 7e-09 | |
| d2c4ja1 | 133 | a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapi | 7e-09 | |
| d1tw9a1 | 129 | a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoid | 1e-08 | |
| d2a2ra1 | 132 | a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapi | 1e-08 | |
| d1gula1 | 140 | a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s | 3e-08 | |
| d1k0da1 | 151 | a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni | 5e-08 | |
| d2cvda1 | 124 | a.45.1.1 (A:76-199) Class sigma GST {Human (Homo s | 5e-08 | |
| d1nhya2 | 75 | c.47.1.5 (A:1-75) GST-like domain of elongation fa | 7e-08 | |
| d1k3ya1 | 142 | a.45.1.1 (A:81-222) Class alpha GST {Human (Homo s | 1e-07 | |
| d1e6ba1 | 133 | a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cres | 2e-07 | |
| d3gtub1 | 140 | a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapi | 4e-07 | |
| d2cvda2 | 74 | c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sap | 5e-07 | |
| d1m0ua1 | 127 | a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (D | 7e-07 | |
| d1g7oa2 | 75 | c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli | 9e-07 | |
| d1r5aa2 | 85 | c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph | 2e-06 | |
| d2fhea1 | 136 | a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepa | 3e-06 | |
| d1tu7a2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulu | 3e-06 | |
| d1fw1a2 | 83 | c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi | 3e-06 | |
| d2c4ja2 | 84 | c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapien | 3e-06 | |
| d2fnoa2 | 87 | c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752 | 4e-06 | |
| d1b48a2 | 78 | c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musc | 8e-06 | |
| d1axda2 | 80 | c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), | 1e-05 | |
| d1jlva2 | 84 | c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph | 1e-05 | |
| d1duga1 | 140 | a.45.1.1 (A:81-220) Class alpha GST {Schistosoma j | 2e-05 | |
| d1m0ua2 | 76 | c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Dr | 2e-05 | |
| d2a2ra2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien | 2e-05 | |
| d1tw9a2 | 77 | c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides | 4e-05 | |
| d1k3ya2 | 79 | c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sap | 5e-05 | |
| d1gula2 | 77 | c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap | 6e-05 | |
| d1tu7a1 | 131 | a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvu | 9e-05 | |
| d1f2ea2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Sphingomonas pau | 1e-04 | |
| d1aw9a2 | 81 | c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), | 1e-04 | |
| d1e6ba2 | 80 | c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress | 2e-04 | |
| d1n2aa2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Escherichia coli | 2e-04 | |
| d1oe8a2 | 81 | c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Sc | 2e-04 | |
| d1eema2 | 98 | c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa | 3e-04 | |
| d1pmta2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Proteus mirabili | 3e-04 | |
| d2gsqa2 | 75 | c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastre | 4e-04 | |
| d1oyja1 | 145 | a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sat | 4e-04 | |
| d1oyja2 | 84 | c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ | 5e-04 | |
| d1okta2 | 85 | c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasm | 8e-04 | |
| d1ljra2 | 79 | c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap | 0.001 | |
| d1okta1 | 126 | a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Pla | 0.001 | |
| d1oe8a1 | 123 | a.45.1.1 (A:85-207) Class alpha GST {Blood fluke ( | 0.003 | |
| d1gnwa2 | 84 | c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( | 0.003 | |
| d1duga2 | 80 | c.47.1.5 (A:1-80) Class alpha GST {Schistosoma jap | 0.003 |
| >d1pbua_ d.58.46.1 (A:) Elongation factor 1-gamma C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: eEF1-gamma domain family: eEF1-gamma domain domain: Elongation factor 1-gamma C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 224 bits (573), Expect = 9e-74
Identities = 59/163 (36%), Positives = 90/163 (55%), Gaps = 5/163 (3%)
Query: 228 KNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTV 287
K+P LP S LDE+KR YSN T VA+ FW+ +D +G+SLW+ +Y++ +E T
Sbjct: 2 KDPFAHLPKSTFALDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQ 59
Query: 288 SFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQ-FIMDECYDM 346
+F++ N + G QR+D RK AF +++ G+ + G+W+FRGQE+ D D
Sbjct: 60 TFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDY 119
Query: 347 ELYDWKKVDINDEAQKERVSQMIEDHEPFE--GEALLDAKCFK 387
E Y W+K+D E + V + F+ G+A K FK
Sbjct: 120 ESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK 162
|
| >d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 144 | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 121 | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 129 | Back information, alignment and structure |
|---|
| >d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 135 | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 121 | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 | Back information, alignment and structure |
|---|
| >d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 126 | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 123 | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Length = 127 | Back information, alignment and structure |
|---|
| >d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 129 | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 127 | Back information, alignment and structure |
|---|
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 143 | Back information, alignment and structure |
|---|
| >d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 118 | Back information, alignment and structure |
|---|
| >d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 129 | Back information, alignment and structure |
|---|
| >d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 132 | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 133 | Back information, alignment and structure |
|---|
| >d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 127 | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 | Back information, alignment and structure |
|---|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 136 | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 77 | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Length = 87 | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 140 | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 131 | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 80 | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 81 | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 80 | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 75 | Back information, alignment and structure |
|---|
| >d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 145 | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 85 | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 126 | Back information, alignment and structure |
|---|
| >d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 123 | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 387 | |||
| d1pbua_ | 162 | Elongation factor 1-gamma C-terminal domain {Human | 100.0 | |
| d1nhya1 | 144 | GST-like domain of elongation factor 1-gamma {Bake | 99.86 | |
| d1axda1 | 129 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.77 | |
| d1f2ea1 | 121 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.77 | |
| d1aw9a1 | 135 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.74 | |
| d1v2aa1 | 125 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.73 | |
| d1pmta1 | 121 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.72 | |
| d1n2aa1 | 121 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.72 | |
| d1gnwa1 | 126 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.72 | |
| d1jlwa1 | 127 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.71 | |
| d1jlva1 | 123 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.7 | |
| d2gsqa1 | 127 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.69 | |
| d1gwca1 | 138 | Class tau GST {Aegilops tauschii, also known as Tr | 99.68 | |
| d3gtub1 | 140 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.68 | |
| d1k0da1 | 151 | Yeast prion protein ure2p, nitrogen regulation fra | 99.67 | |
| d1r5aa1 | 129 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.67 | |
| d2cvda1 | 124 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.65 | |
| d1fw1a1 | 125 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.65 | |
| d2gsta1 | 133 | Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 | 99.64 | |
| d1ljra1 | 165 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.64 | |
| d2c4ja1 | 133 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.63 | |
| d1gsua1 | 133 | Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 | 99.63 | |
| d1e6ba1 | 133 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.63 | |
| d2hrkb1 | 118 | GU4 nucleic-binding protein 1, Arc1p {Baker's yeas | 99.62 | |
| d2a2ra1 | 132 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1m0ua1 | 127 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.61 | |
| d1k3ya1 | 142 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.58 | |
| d1tw9a1 | 129 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.58 | |
| d1b48a1 | 143 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.58 | |
| d1duga1 | 140 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 99.56 | |
| d1gula1 | 140 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.55 | |
| d2fhea1 | 136 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 99.54 | |
| d1eema1 | 139 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.54 | |
| d1oyja1 | 145 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 99.53 | |
| d1okta1 | 126 | Pf GST {Malarial parasite (Plasmodium falciparum) | 99.47 | |
| d1tu7a1 | 131 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 99.41 | |
| d1oe8a1 | 123 | Class alpha GST {Blood fluke (Schistosoma haematob | 99.31 | |
| d1f2ea2 | 80 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 98.99 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 98.95 | |
| d1n2aa2 | 80 | Class beta GST {Escherichia coli [TaxId: 562]} | 98.93 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 98.91 | |
| d1pmta2 | 80 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 98.9 | |
| d1nhya2 | 75 | GST-like domain of elongation factor 1-gamma {Bake | 98.88 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 98.86 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 98.85 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 98.84 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 98.83 | |
| d1k0ma1 | 149 | Chloride intracellular channel 1 (clic1) {Human (H | 98.82 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 98.8 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 98.72 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 98.7 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 98.61 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 98.53 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 98.51 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 98.49 | |
| d1tu7a2 | 77 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 98.48 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 98.44 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 98.38 | |
| d2c4ja2 | 84 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 98.36 | |
| d1k3ya2 | 79 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 98.35 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 98.33 | |
| d1m0ua2 | 76 | Class sigma GST {Fruit fly (Drosophila melanogaste | 98.3 | |
| d1b48a2 | 78 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 98.29 | |
| d2gsqa2 | 75 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 98.29 | |
| d2fnoa2 | 87 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 98.28 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 98.28 | |
| d1tw9a2 | 77 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 98.23 | |
| d1z9ha1 | 161 | Microsomal prostaglandin E synthase-2 {Crab-eating | 98.1 | |
| d1duga2 | 80 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 98.05 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 98.05 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 97.9 | |
| d1fhea2 | 80 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 97.84 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 97.2 | |
| d1oe8a2 | 81 | Class alpha GST {Blood fluke (Schistosoma haematob | 97.15 | |
| d2fnoa1 | 149 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 96.25 | |
| d1g7oa1 | 140 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 94.85 |
| >d1pbua_ d.58.46.1 (A:) Elongation factor 1-gamma C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: eEF1-gamma domain family: eEF1-gamma domain domain: Elongation factor 1-gamma C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=2.4e-86 Score=568.47 Aligned_cols=158 Identities=37% Similarity=0.730 Sum_probs=153.9
Q ss_pred CCCCCCCCCCCCCchhHHHHHhcCCCccchhhhhhhhhhccCCCCceEEEEeeecCCCCceeEEecchhhHHHHhhHhhh
Q 016550 227 PKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLAR 306 (387)
Q Consensus 227 ~k~P~~~lp~~~f~ld~~Kr~ysn~~~~~~~~a~~~fw~~~d~~~~s~w~~~yky~~el~~~fms~nli~g~~qrl~~~r 306 (387)
+|||||+||||+|+||+|||+|||+|| |++|||||||||||||||||+|+||||+||+++|||||||||||||||++|
T Consensus 1 aK~Pld~Lp~s~f~lD~wKR~YSN~dt--~~~a~p~Fwe~fD~egySiw~~~Yky~~el~~~fmt~Nli~Gf~QRle~~r 78 (162)
T d1pbua_ 1 AKDPFAHLPKSTFALDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLR 78 (162)
T ss_dssp CCCGGGSSCCCCSCHHHHHHHHHHSCG--GGTHHHHHHSSCCTTTCEEEEECCSCGGGCCCSTTHHHHHHHHHHHGGGTG
T ss_pred CcChHHHCCCCCCCHHHHHHhhccCCc--HHHHHHHHHHhCCcccceEEEEEEecCccCccEEEEecchhHHHHHHHHHh
Confidence 589999999999999999999999999 999999999999999999999999999999999999999999999999999
Q ss_pred hhhceeEEEeecCCCceeEEEEEEeCCCCCcccc--ccCCCcCceeeeecCCCCHHHHHHHHHHHccCCCC--CCeeccc
Q 016550 307 KYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIM--DECYDMELYDWKKVDINDEAQKERVSQMIEDHEPF--EGEALLD 382 (387)
Q Consensus 307 k~~f~~~~v~g~~~~~~i~g~~~~rg~~~~~~~~--~~~~d~e~y~~~kld~~~~~~k~~~~~~~~~~~~~--~g~~~~~ 382 (387)
|||||+|+||||+|++.|+||||||||++|+ ++ +++||||||+|+|||++++|||++|++||||++++ +||+++|
T Consensus 79 KyaFg~~~v~Ge~~~~~I~G~wv~RG~~~~~-~~~~d~~~D~Esy~~~KLD~~~~edk~~v~dy~~we~~~~~~gk~~~d 157 (162)
T d1pbua_ 79 KNAFASVILFGTNNSSSISGVWVFRGQELAF-PLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQ 157 (162)
T ss_dssp GGEEECCEEESCSTTCEEEEEEEESSSSCSG-GGCGGGCSSGGGSCCEECCTTSSHHHHHHHHHHHSCSCCTTTCSCCCE
T ss_pred hhheeeEEEEeecCCceeEEEEEEcCCCCCc-cccccccCCccceEEEEcCCCCHHHHHHHHHHHccCCCcccCCeEccc
Confidence 9999999999999999999999999999976 65 89999999999999999999999999999999984 5999999
Q ss_pred ccccC
Q 016550 383 AKCFK 387 (387)
Q Consensus 383 ~k~~k 387 (387)
|||||
T Consensus 158 gkvfK 162 (162)
T d1pbua_ 158 GKIFK 162 (162)
T ss_dssp ECCCC
T ss_pred ccccC
Confidence 99998
|
| >d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|