Citrus Sinensis ID: 016550

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------

MGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPVQSAKKPTQSKEPAKPKAQAEPKKEAAKETAKPKVEDAGEEEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK

cccccccHHHHcccccccccEEEccccEEEEEHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccccHHHHccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccHHHHHHHHccccccccHHHHcHHHHcccccccEEEEEEEcccccccEEEEEEEcHHHHHHHHccccccccEEEEEEcccccccEEEEEEEEcccccccccccccccccEEEEEcccccHHHHHHHHHHHccccccccCEcccccccc

*G*TNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESV******************************************************DLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable elongation factor 1-gamma 1	Probably plays a role in anchoring the complex to other cellular components.	confident	O04487
Elongation factor 1-gamma 2	Probably plays a role in anchoring the complex to other cellular components.	confident	Q6YW46
Elongation factor 1-gamma	Probably plays a role in anchoring the complex to other cellular components.	probable	Q9FUM1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PBU, chain A
Confidence level:very confident
Coverage over the Query: 227-387
View the alignment between query and template
View the model in PyMOL

Template: 1NHY, chain A
Confidence level:very confident
Coverage over the Query: 5-177
View the alignment between query and template
View the model in PyMOL