Citrus Sinensis ID: 016610


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380------
MGNNEDGKSFKSEKPSSPPPSDQGNIHMYTDWAAMQAYYGPRVAIPPYYNSPIASGHAPQPYMWGPAQPMMPPYGAPYAAIYSTGGVYAHPAVPLGSHAHNHGVPTSPAAVTPLNTEAPTKSSGNADRGLAKKLKGLDGLAMSIGNASAESAEGGAEQRPSQSEADGSTDGSDGNTVRAGQSRKKRSREGTPIAGKPVGPVLSPGMPTKLELRNAPGMNVKASPTSVPQPCAVLPPETWIQNERELKRERRKQSNRESARRSRLRKQAEAEELSRKVDSLIDENASLKSEINQLSENSEKLRQENAALLEKLKSAQLGNKQEIVLNEDKRVTPVSTENLLSRVNNSGTVDRNMEEGGHLFEKNSNSGAKLHQLLDASPRTDAVAAG
cccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccccccccccHHHHHHHccccccccccccccccccccccccccHHHccccccccccccccc
*************************IHMYTDWAAMQAYYGPRVAIPPYYNSPIASGHAPQPYMWGPAQPMMPPYGAPYAAIYSTGGVYAHPAVPL*******************************************************************************************************************************************************************************EELSRKVDSLIDENASLKSEINQLSENSEKLRQENAALL********************************************************************PR*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNNEDGKSFKSEKPSSPPPSDQGNIHMYTDWAAMQAYYGPRVAIPPYYNSPIASGHAPQPYMWGPAQPMMPPYGAPYAAIYSTGGVYAHPAVPLGSHAHNHGVPTSPAAVTPLNTEAPTKSSGNADRGLAKKLKGLDGLAMSIGNASAESAEGGAEQRPSQSEADGSTDGSDGNTVRAGQSRKKRSREGTPIAGKPVGPVLSPGMPTKLELRNAPGMNVKASPTSVPQPCAVLPPETWIQNERELKRERRKQSNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNKQEIVLNEDKRVTPVSTENLLSRVNNSGTVDRNMEEGGHLFEKNSNSGAKLHQLLDASPRTDAVAAG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
G-box-binding factor 3 Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.probableP42776
Common plant regulatory factor 1 Binds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.probableQ99089

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CI6, chain A
Confidence level:confident
Coverage over the Query: 253-313
View the alignment between query and template
View the model in PyMOL
Template: 4EMC, chain A
Confidence level:probable
Coverage over the Query: 275-361
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 240-264
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 59-75
View the alignment between query and template
View the model in PyMOL