Citrus Sinensis ID: 016641
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 385 | 2.2.26 [Sep-21-2011] | |||||||
| Q9FIV6 | 586 | Protease Do-like 10, mito | yes | no | 0.753 | 0.494 | 0.8 | 1e-137 | |
| Q9SHZ1 | 559 | Putative protease Do-like | no | no | 0.703 | 0.484 | 0.664 | 1e-104 | |
| Q9SHZ0 | 518 | Protease Do-like 4, mitoc | no | no | 0.701 | 0.521 | 0.662 | 1e-103 | |
| Q9FM41 | 486 | Putative protease Do-like | no | no | 0.719 | 0.569 | 0.633 | 8e-98 | |
| Q9LK71 | 560 | Putative protease Do-like | no | no | 0.685 | 0.471 | 0.553 | 5e-82 | |
| Q9FL12 | 592 | Protease Do-like 9 OS=Ara | no | no | 0.690 | 0.449 | 0.557 | 2e-81 | |
| Q9LK70 | 499 | Putative protease Do-like | no | no | 0.787 | 0.607 | 0.495 | 3e-79 | |
| O82261 | 607 | Protease Do-like 2, chlor | no | no | 0.685 | 0.434 | 0.492 | 2e-68 | |
| Q9C691 | 219 | Putative protease Do-like | no | no | 0.462 | 0.812 | 0.474 | 4e-44 | |
| Q3E8B4 | 198 | Putative Do-like 15 prote | no | no | 0.431 | 0.838 | 0.475 | 7e-42 |
| >sp|Q9FIV6|DGP10_ARATH Protease Do-like 10, mitochondrial OS=Arabidopsis thaliana GN=DEGP10 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 487 bits (1254), Expect = e-137, Method: Compositional matrix adjust.
Identities = 232/290 (80%), Positives = 260/290 (89%)
Query: 88 RRRQRRRLAKTCGKTTNAYAAIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVI 147
R+ RRR A + A A++LALDSVVKIFTVS+SP+Y LPWQNKSQRE+ GSGFVI
Sbjct: 87 RKISRRRKAGKSLSISPAADAVDLALDSVVKIFTVSTSPSYFLPWQNKSQRESMGSGFVI 146
Query: 148 PGKKILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLE 207
G+KI+TNAHVVAD +FVLVRKHGS K+RA+V+AVGHECDLAIL+V+S+ FWEGM+ LE
Sbjct: 147 SGRKIITNAHVVADHSFVLVRKHGSSIKHRAEVQAVGHECDLAILVVDSEVFWEGMNALE 206
Query: 208 LGDIPFLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSG 267
LGDIPFLQ+AVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSG
Sbjct: 207 LGDIPFLQEAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSG 266
Query: 268 GPAIMGNKVAGVAFQNLSGAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTEN 327
GPAIMGNKVAGVAFQNLSGAENIGYIIP PVIKHFI GV E GKY+GFCS+G+SCQ EN
Sbjct: 267 GPAIMGNKVAGVAFQNLSGAENIGYIIPTPVIKHFINGVEECGKYIGFCSMGVSCQPMEN 326
Query: 328 VQLRNNFGMRSEVTGVLVNKINPLSDAHEILKKDDIILAFDGVPIANDGT 377
+LR+ F M SE+TGVLV+KINPLSDAH+ILKKDD++LAFDGVPIANDGT
Sbjct: 327 GELRSGFQMSSEMTGVLVSKINPLSDAHKILKKDDVLLAFDGVPIANDGT 376
|
Probable serine protease. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: - |
| >sp|Q9SHZ1|DEGP3_ARATH Putative protease Do-like 3, mitochondrial OS=Arabidopsis thaliana GN=DEGP3 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SHZ0|DEGP4_ARATH Protease Do-like 4, mitochondrial OS=Arabidopsis thaliana GN=DEGP4 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FM41|DGP13_ARATH Putative protease Do-like 13 OS=Arabidopsis thaliana GN=DEGP13 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LK71|DGP11_ARATH Putative protease Do-like 11, mitochondrial OS=Arabidopsis thaliana GN=DEGP11 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9FL12|DEGP9_ARATH Protease Do-like 9 OS=Arabidopsis thaliana GN=DEGP9 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LK70|DGP12_ARATH Putative protease Do-like 12, mitochondrial OS=Arabidopsis thaliana GN=DEGP12 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O82261|DEGP2_ARATH Protease Do-like 2, chloroplastic OS=Arabidopsis thaliana GN=DEGP2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9C691|DEGP6_ARATH Putative protease Do-like 6, chloroplastic OS=Arabidopsis thaliana GN=DEGP6 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q3E8B4|DGP15_ARATH Putative Do-like 15 protein OS=Arabidopsis thaliana GN=DEGP15 PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 385 | ||||||
| 359495826 | 564 | PREDICTED: protease Do-like 10, mitochon | 0.719 | 0.491 | 0.888 | 1e-146 | |
| 224098810 | 587 | predicted protein [Populus trichocarpa] | 0.714 | 0.468 | 0.894 | 1e-145 | |
| 242090545 | 587 | hypothetical protein SORBIDRAFT_09g02048 | 0.714 | 0.468 | 0.843 | 1e-139 | |
| 242051074 | 586 | hypothetical protein SORBIDRAFT_02g04114 | 0.714 | 0.469 | 0.843 | 1e-139 | |
| 226508134 | 556 | hypothetical protein [Zea mays] gi|19470 | 0.714 | 0.494 | 0.84 | 1e-139 | |
| 413945374 | 585 | hypothetical protein ZEAMMB73_513869 [Ze | 0.714 | 0.470 | 0.84 | 1e-138 | |
| 222631610 | 563 | hypothetical protein OsJ_18561 [Oryza sa | 0.714 | 0.488 | 0.832 | 1e-138 | |
| 115463921 | 614 | Os05g0417100 [Oryza sativa Japonica Grou | 0.714 | 0.447 | 0.832 | 1e-138 | |
| 125552354 | 614 | hypothetical protein OsI_19981 [Oryza sa | 0.714 | 0.447 | 0.832 | 1e-138 | |
| 449470362 | 601 | PREDICTED: protease Do-like 10, mitochon | 0.722 | 0.462 | 0.841 | 1e-137 |
| >gi|359495826|ref|XP_002265825.2| PREDICTED: protease Do-like 10, mitochondrial-like [Vitis vinifera] gi|296086873|emb|CBI33040.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 522 bits (1345), Expect = e-146, Method: Compositional matrix adjust.
Identities = 246/277 (88%), Positives = 263/277 (94%)
Query: 101 KTTNAYAAIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNAHVVA 160
+ TNAY+AIELALDSVVKIFTVSSSPNY LPWQNKSQRET GSGFVIPGK+ILTNAHVVA
Sbjct: 80 RETNAYSAIELALDSVVKIFTVSSSPNYLLPWQNKSQRETMGSGFVIPGKRILTNAHVVA 139
Query: 161 DSTFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIPFLQQAVAV 220
D TFVLVRKHGSPTKYRA+++AVGHECDLAIL+VES+EFWEG+ FLELGDIPFLQ+AVAV
Sbjct: 140 DHTFVLVRKHGSPTKYRAEIQAVGHECDLAILVVESEEFWEGLSFLELGDIPFLQEAVAV 199
Query: 221 VGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVA 280
VGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGN VAGVA
Sbjct: 200 VGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNSVAGVA 259
Query: 281 FQNLSGAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTENVQLRNNFGMRSEV 340
FQNLSGAENIGYIIPVPVIKHFI+G+ E GKYVGFCSLGLSCQ TEN+QLR +F M E+
Sbjct: 260 FQNLSGAENIGYIIPVPVIKHFISGIEETGKYVGFCSLGLSCQPTENIQLRTHFRMHPEM 319
Query: 341 TGVLVNKINPLSDAHEILKKDDIILAFDGVPIANDGT 377
TGVLV+KINPLSDAH +LKKDDIILAFDGVPIANDGT
Sbjct: 320 TGVLVSKINPLSDAHRVLKKDDIILAFDGVPIANDGT 356
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224098810|ref|XP_002311275.1| predicted protein [Populus trichocarpa] gi|222851095|gb|EEE88642.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|242090545|ref|XP_002441105.1| hypothetical protein SORBIDRAFT_09g020480 [Sorghum bicolor] gi|241946390|gb|EES19535.1| hypothetical protein SORBIDRAFT_09g020480 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|242051074|ref|XP_002463281.1| hypothetical protein SORBIDRAFT_02g041140 [Sorghum bicolor] gi|241926658|gb|EER99802.1| hypothetical protein SORBIDRAFT_02g041140 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|226508134|ref|NP_001142088.1| hypothetical protein [Zea mays] gi|194707054|gb|ACF87611.1| unknown [Zea mays] gi|413945373|gb|AFW78022.1| hypothetical protein ZEAMMB73_513869 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|413945374|gb|AFW78023.1| hypothetical protein ZEAMMB73_513869 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|222631610|gb|EEE63742.1| hypothetical protein OsJ_18561 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|115463921|ref|NP_001055560.1| Os05g0417100 [Oryza sativa Japonica Group] gi|50511464|gb|AAT77386.1| putative serine protease [Oryza sativa Japonica Group] gi|51854402|gb|AAU10782.1| putative serine protease [Oryza sativa Japonica Group] gi|113579111|dbj|BAF17474.1| Os05g0417100 [Oryza sativa Japonica Group] gi|215706483|dbj|BAG93339.1| unnamed protein product [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|125552354|gb|EAY98063.1| hypothetical protein OsI_19981 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|449470362|ref|XP_004152886.1| PREDICTED: protease Do-like 10, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 385 | ||||||
| TAIR|locus:2167468 | 586 | DEG10 "degradation of periplas | 0.701 | 0.460 | 0.837 | 9.5e-121 | |
| TAIR|locus:2018476 | 559 | DEG3 "degradation of periplasm | 0.703 | 0.484 | 0.664 | 6.1e-94 | |
| TAIR|locus:2173727 | 592 | DEG9 "degradation of periplasm | 0.690 | 0.449 | 0.557 | 2.7e-75 | |
| DICTYBASE|DDB_G0281081 | 647 | DDB_G0281081 "Protease degS" [ | 0.685 | 0.408 | 0.528 | 5.9e-73 | |
| TAIR|locus:2043403 | 607 | DEG2 "degradation of periplasm | 0.685 | 0.434 | 0.492 | 2.3e-64 | |
| TAIR|locus:504954966 | 198 | DEG16 "degradation of periplas | 0.212 | 0.414 | 0.566 | 1.8e-42 | |
| TAIR|locus:2008286 | 219 | DEG6 "degradation of periplasm | 0.444 | 0.780 | 0.482 | 5.9e-41 | |
| UNIPROTKB|Q607Z8 | 504 | MCA1599 "Putative serine prote | 0.579 | 0.442 | 0.344 | 2e-21 | |
| UNIPROTKB|P72780 | 394 | hhoA "Putative serine protease | 0.592 | 0.578 | 0.341 | 6.6e-21 | |
| UNIPROTKB|Q74GB5 | 464 | degP "Periplasmic trypsin-like | 0.594 | 0.493 | 0.333 | 1.1e-20 |
| TAIR|locus:2167468 DEG10 "degradation of periplasmic proteins 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1188 (423.3 bits), Expect = 9.5e-121, P = 9.5e-121
Identities = 226/270 (83%), Positives = 252/270 (93%)
Query: 108 AIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNAHVVADSTFVLV 167
A++LALDSVVKIFTVS+SP+Y LPWQNKSQRE+ GSGFVI G+KI+TNAHVVAD +FVLV
Sbjct: 107 AVDLALDSVVKIFTVSTSPSYFLPWQNKSQRESMGSGFVISGRKIITNAHVVADHSFVLV 166
Query: 168 RKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIPFLQQAVAVVGYPQGG 227
RKHGS K+RA+V+AVGHECDLAIL+V+S+ FWEGM+ LELGDIPFLQ+AVAVVGYPQGG
Sbjct: 167 RKHGSSIKHRAEVQAVGHECDLAILVVDSEVFWEGMNALELGDIPFLQEAVAVVGYPQGG 226
Query: 228 DNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQNLSGA 287
DNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQNLSGA
Sbjct: 227 DNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQNLSGA 286
Query: 288 ENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTENVQLRNNFGMRSEVTGVLVNK 347
ENIGYIIP PVIKHFI GV E GKY+GFCS+G+SCQ EN +LR+ F M SE+TGVLV+K
Sbjct: 287 ENIGYIIPTPVIKHFINGVEECGKYIGFCSMGVSCQPMENGELRSGFQMSSEMTGVLVSK 346
Query: 348 INPLSDAHEILKKDDIILAFDGVPIANDGT 377
INPLSDAH+ILKKDD++LAFDGVPIANDGT
Sbjct: 347 INPLSDAHKILKKDDVLLAFDGVPIANDGT 376
|
|
| TAIR|locus:2018476 DEG3 "degradation of periplasmic proteins 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173727 DEG9 "degradation of periplasmic proteins 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0281081 DDB_G0281081 "Protease degS" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043403 DEG2 "degradation of periplasmic proteins 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504954966 DEG16 "degradation of periplasmic proteins 16" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008286 DEG6 "degradation of periplasmic proteins 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q607Z8 MCA1599 "Putative serine protease, MucD" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P72780 hhoA "Putative serine protease HhoA" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q74GB5 degP "Periplasmic trypsin-like serine protease DegP" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9FIV6 | DGP10_ARATH | 3, ., 4, ., 2, 1, ., - | 0.8 | 0.7532 | 0.4948 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.4.21 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 385 | |||
| COG0265 | 347 | COG0265, DegQ, Trypsin-like serine proteases, typi | 7e-29 | |
| TIGR02037 | 428 | TIGR02037, degP_htrA_DO, periplasmic serine protea | 3e-24 | |
| pfam13365 | 138 | pfam13365, Trypsin_2, Trypsin-like peptidase domai | 2e-13 | |
| pfam00089 | 218 | pfam00089, Trypsin, Trypsin | 2e-12 | |
| TIGR02038 | 351 | TIGR02038, protease_degS, periplasmic serine pepet | 9e-11 | |
| PRK10942 | 473 | PRK10942, PRK10942, serine endoprotease; Provision | 1e-06 | |
| cd00987 | 90 | cd00987, PDZ_serine_protease, PDZ domain of tryspi | 2e-05 | |
| PRK10898 | 353 | PRK10898, PRK10898, serine endoprotease; Provision | 4e-04 | |
| PRK10139 | 455 | PRK10139, PRK10139, serine endoprotease; Provision | 0.003 |
| >gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Score = 114 bits (287), Expect = 7e-29
Identities = 79/297 (26%), Positives = 127/297 (42%), Gaps = 24/297 (8%)
Query: 92 RRRLAKTCGKTTNAYAAIELALDSVVKIFTVSSSPNYGLPWQNKSQRET--TGSGFVIPG 149
R L G+ + A+E +VV I T ++ + R GSGF+I
Sbjct: 22 GRALTSAAGQRLSFATAVEKVAPAVVSIATGLTAKLRSFFPSDPPLRSAEGLGSGFIISS 81
Query: 150 K-KILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLEL 208
I+TN HV+A + + V + A++ DLA+L ++ +
Sbjct: 82 DGYIVTNNHVIAGAEEITVTLADG-REVPAKLVGKDPISDLAVLKIDGAGGLPVIAL-GD 139
Query: 209 GDIPFLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGG 268
D + V +G P G +VT G+VS + T + IQ DAAINPGNSGG
Sbjct: 140 SDKLRVGDVVVAIGNPFGLGQ-TVTSGIVSALGRTGVGSAGGYVNFIQTDAAINPGNSGG 198
Query: 269 PAI-MGNKVAGVAFQNLS---GAENIGYIIPVPVIKHFITGVVEHGK----YVGFCSLGL 320
P + + +V G+ ++ G+ IG+ IPV ++ + ++ GK Y+G
Sbjct: 199 PLVNIDGEVVGINTAIIAPSGGSSGIGFAIPVNLVAPVLDELISKGKVVRGYLGVIG--- 255
Query: 321 SCQTTENVQLRNNFGMRSEVTGVLVNKINPLSDAHEI-LKKDDIILAFDGVPIANDG 376
E + G+ G +V + P S A + +K DII A +G P+A+
Sbjct: 256 -----EPLTADIALGL-PVAAGAVVLGVLPGSPAAKAGIKAGDIITAVNGKPVASLS 306
|
Length = 347 |
| >gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain | Back alignment and domain information |
|---|
| >gnl|CDD|215708 pfam00089, Trypsin, Trypsin | Back alignment and domain information |
|---|
| >gnl|CDD|233696 TIGR02038, protease_degS, periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >gnl|CDD|236802 PRK10942, PRK10942, serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >gnl|CDD|182820 PRK10898, PRK10898, serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182262 PRK10139, PRK10139, serine endoprotease; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 385 | |||
| PRK10139 | 455 | serine endoprotease; Provisional | 100.0 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 100.0 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 100.0 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 100.0 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 100.0 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 100.0 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 99.92 | |
| KOG1320 | 473 | consensus Serine protease [Posttranslational modif | 99.87 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 99.84 | |
| PF13365 | 120 | Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 | 99.57 | |
| PF00089 | 220 | Trypsin: Trypsin; InterPro: IPR001254 In the MEROP | 99.52 | |
| cd00190 | 232 | Tryp_SPc Trypsin-like serine protease; Many of the | 99.49 | |
| KOG1421 | 955 | consensus Predicted signaling-associated protein ( | 99.45 | |
| smart00020 | 229 | Tryp_SPc Trypsin-like serine protease. Many of the | 99.4 | |
| PF13180 | 82 | PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ | 98.95 | |
| cd00987 | 90 | PDZ_serine_protease PDZ domain of tryspin-like ser | 98.92 | |
| KOG3627 | 256 | consensus Trypsin [Amino acid transport and metabo | 98.79 | |
| COG3591 | 251 | V8-like Glu-specific endopeptidase [Amino acid tra | 98.69 | |
| cd00991 | 79 | PDZ_archaeal_metalloprotease PDZ domain of archaea | 98.53 | |
| cd00990 | 80 | PDZ_glycyl_aminopeptidase PDZ domain associated wi | 98.52 | |
| cd00136 | 70 | PDZ PDZ domain, also called DHR (Dlg homologous re | 98.51 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 98.5 | |
| TIGR01713 | 259 | typeII_sec_gspC general secretion pathway protein | 98.44 | |
| cd00989 | 79 | PDZ_metalloprotease PDZ domain of bacterial and pl | 98.37 | |
| cd00986 | 79 | PDZ_LON_protease PDZ domain of ATP-dependent LON s | 98.36 | |
| PF00863 | 235 | Peptidase_C4: Peptidase family C4 This family belo | 98.31 | |
| cd00992 | 82 | PDZ_signaling PDZ domain found in a variety of Eum | 98.21 | |
| cd00988 | 85 | PDZ_CTP_protease PDZ domain of C-terminal processi | 98.16 | |
| PF00595 | 81 | PDZ: PDZ domain (Also known as DHR or GLGF) Coordi | 97.93 | |
| smart00228 | 85 | PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als | 97.91 | |
| COG5640 | 413 | Secreted trypsin-like serine protease [Posttransla | 97.89 | |
| PF12812 | 78 | PDZ_1: PDZ-like domain | 97.73 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 97.63 | |
| PF03761 | 282 | DUF316: Domain of unknown function (DUF316) ; Inte | 97.62 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 97.62 | |
| PF05579 | 297 | Peptidase_S32: Equine arteritis virus serine endop | 97.61 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 97.57 | |
| PF00548 | 172 | Peptidase_C3: 3C cysteine protease (picornain 3C); | 97.54 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 97.53 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 97.53 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 97.46 | |
| KOG3553 | 124 | consensus Tax interaction protein TIP1 [Cell wall/ | 97.4 | |
| TIGR00225 | 334 | prc C-terminal peptidase (prc). A C-terminal pepti | 97.36 | |
| PLN00049 | 389 | carboxyl-terminal processing protease; Provisional | 97.21 | |
| PF14685 | 88 | Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 | 97.05 | |
| TIGR02860 | 402 | spore_IV_B stage IV sporulation protein B. SpoIVB, | 96.98 | |
| PF04495 | 138 | GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: | 96.52 | |
| COG0793 | 406 | Prc Periplasmic protease [Cell envelope biogenesis | 96.29 | |
| PF09342 | 267 | DUF1986: Domain of unknown function (DUF1986); Int | 96.23 | |
| PF08192 | 695 | Peptidase_S64: Peptidase family S64; InterPro: IPR | 96.01 | |
| KOG3532 | 1051 | consensus Predicted protein kinase [General functi | 95.93 | |
| COG3480 | 342 | SdrC Predicted secreted protein containing a PDZ d | 95.84 | |
| PRK11186 | 667 | carboxy-terminal protease; Provisional | 95.69 | |
| PF10459 | 698 | Peptidase_S46: Peptidase S46; InterPro: IPR019500 | 94.9 | |
| PF05580 | 218 | Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR | 94.87 | |
| KOG3129 | 231 | consensus 26S proteasome regulatory complex, subun | 94.86 | |
| COG3975 | 558 | Predicted protease with the C-terminal PDZ domain | 94.79 | |
| PF02122 | 203 | Peptidase_S39: Peptidase S39; InterPro: IPR000382 | 94.15 | |
| PF00947 | 127 | Pico_P2A: Picornavirus core protein 2A; InterPro: | 93.61 | |
| KOG3580 | 1027 | consensus Tight junction proteins [Signal transduc | 93.22 | |
| KOG3209 | 984 | consensus WW domain-containing protein [General fu | 91.91 | |
| KOG3552 | 1298 | consensus FERM domain protein FRM-8 [General funct | 91.8 | |
| PF00949 | 132 | Peptidase_S7: Peptidase S7, Flavivirus NS3 serine | 91.63 | |
| PRK09681 | 276 | putative type II secretion protein GspC; Provision | 91.58 | |
| KOG3550 | 207 | consensus Receptor targeting protein Lin-7 [Extrac | 91.12 | |
| PF00944 | 158 | Peptidase_S3: Alphavirus core protein ; InterPro: | 90.35 | |
| KOG2921 | 484 | consensus Intramembrane metalloprotease (sterol-re | 89.92 | |
| TIGR02860 | 402 | spore_IV_B stage IV sporulation protein B. SpoIVB, | 89.06 | |
| KOG3542 | 1283 | consensus cAMP-regulated guanine nucleotide exchan | 88.66 | |
| PF10459 | 698 | Peptidase_S46: Peptidase S46; InterPro: IPR019500 | 88.16 | |
| COG3031 | 275 | PulC Type II secretory pathway, component PulC [In | 87.55 | |
| KOG3606 | 358 | consensus Cell polarity protein PAR6 [Signal trans | 87.24 | |
| KOG3651 | 429 | consensus Protein kinase C, alpha binding protein | 85.15 | |
| KOG3571 | 626 | consensus Dishevelled 3 and related proteins [Gene | 84.23 | |
| PF02395 | 769 | Peptidase_S6: Immunoglobulin A1 protease Serine pr | 84.17 | |
| COG0750 | 375 | Predicted membrane-associated Zn-dependent proteas | 83.27 | |
| PF05416 | 535 | Peptidase_C37: Southampton virus-type processing p | 82.95 | |
| KOG1892 | 1629 | consensus Actin filament-binding protein Afadin [C | 82.76 | |
| PF02907 | 148 | Peptidase_S29: Hepatitis C virus NS3 protease; Int | 82.32 | |
| KOG3209 | 984 | consensus WW domain-containing protein [General fu | 82.23 | |
| PF03510 | 105 | Peptidase_C24: 2C endopeptidase (C24) cysteine pro | 82.0 | |
| KOG3580 | 1027 | consensus Tight junction proteins [Signal transduc | 81.0 |
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.2e-48 Score=388.20 Aligned_cols=271 Identities=23% Similarity=0.367 Sum_probs=234.0
Q ss_pred cHHHHHHHhCCCeEEEEeeecCCC----------CC---CCCCCCCCCcceEEEEEec--CCEEEecccccCCCceEEEE
Q 016641 104 NAYAAIELALDSVVKIFTVSSSPN----------YG---LPWQNKSQRETTGSGFVIP--GKKILTNAHVVADSTFVLVR 168 (385)
Q Consensus 104 ~~~~~~~~~~~SVV~I~~~~~~~~----------~~---~p~~~~~~~~~~GSGfiI~--~g~ILT~aHvv~~~~~i~V~ 168 (385)
++.++++++.||||.|.+...... ++ .||+......+.||||+|+ +||||||+|||+++..+.|+
T Consensus 41 ~~~~~~~~~~pavV~i~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~GSG~ii~~~~g~IlTn~HVv~~a~~i~V~ 120 (455)
T PRK10139 41 SLAPMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIIDAAKGYVLTNNHVINQAQKISIQ 120 (455)
T ss_pred cHHHHHHHhCCcEEEEEEEEeecccccCchhHHHhccccCCccccccccceEEEEEEECCCCEEEeChHHhCCCCEEEEE
Confidence 589999999999999998653210 11 1333333446789999997 58999999999999999999
Q ss_pred EcCCCcEEEEEEEEecCCCCeEEEEecCCcccccceeeecCCcc--cCCCeEEEEecCCCCCCceEEEeeEeeccccccc
Q 016641 169 KHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIP--FLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYV 246 (385)
Q Consensus 169 ~~~~g~~~~a~v~~~d~~~DlAlLkv~~~~~~~~~~~l~l~~~~--~~G~~V~~iG~p~~~~~~~~~~G~Vs~~~~~~~~ 246 (385)
+. |+++++|++++.|+.+||||||++... .+++++|+++. ++||+|+++|+|++.. .+++.|+|++..+....
T Consensus 121 ~~-dg~~~~a~vvg~D~~~DlAvlkv~~~~---~l~~~~lg~s~~~~~G~~V~aiG~P~g~~-~tvt~GivS~~~r~~~~ 195 (455)
T PRK10139 121 LN-DGREFDAKLIGSDDQSDIALLQIQNPS---KLTQIAIADSDKLRVGDFAVAVGNPFGLG-QTATSGIISALGRSGLN 195 (455)
T ss_pred EC-CCCEEEEEEEEEcCCCCEEEEEecCCC---CCceeEecCccccCCCCEEEEEecCCCCC-CceEEEEEccccccccC
Confidence 97 899999999999999999999998643 58899999876 5699999999999987 59999999998775322
Q ss_pred CCCceeeEEEecccCCCCCCCccee-eCCEEEEEEeeecC---CCCceEEEEecchHHHHHHHHHHcCeeeeeeccCccc
Q 016641 247 HGATQLMAIQIDAAINPGNSGGPAI-MGNKVAGVAFQNLS---GAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSC 322 (385)
Q Consensus 247 ~~~~~~~~i~~d~~i~~G~SGGPL~-~~G~vVGI~s~~~~---~~~~~~~aip~~~i~~~l~~l~~~g~~~~~~~lGi~~ 322 (385)
. .....+||+|+++++|||||||+ .+|+||||+++... +..+++||||++.+++++++|+++|++. ++|||+.+
T Consensus 196 ~-~~~~~~iqtda~in~GnSGGpl~n~~G~vIGi~~~~~~~~~~~~gigfaIP~~~~~~v~~~l~~~g~v~-r~~LGv~~ 273 (455)
T PRK10139 196 L-EGLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLIDFGEIK-RGLLGIKG 273 (455)
T ss_pred C-CCcceEEEECCccCCCCCcceEECCCCeEEEEEEEEEcCCCCccceEEEEEhHHHHHHHHHHhhcCccc-ccceeEEE
Confidence 2 22346899999999999999999 99999999998764 3467999999999999999999999998 89999999
Q ss_pred cccccHHHHhhcCCCCccCceEEEeeCCCCHHhhh-cCCCCEEEEECCEEcCChhhHHhhhc
Q 016641 323 QTTENVQLRNNFGMRSEVTGVLVNKINPLSDAHEI-LKKDDIILAFDGVPIANDGTGSHSML 383 (385)
Q Consensus 323 ~~~~~~~~~~~~g~~~~~~Gv~V~~V~~~spA~~a-L~~GDiI~~vng~~i~~~~~l~~~l~ 383 (385)
+++ +++.++.+|++. ..|++|.+|.++|||+++ ||+||+|++|||++|.+..|+.+.|.
T Consensus 274 ~~l-~~~~~~~lgl~~-~~Gv~V~~V~~~SpA~~AGL~~GDvIl~InG~~V~s~~dl~~~l~ 333 (455)
T PRK10139 274 TEM-SADIAKAFNLDV-QRGAFVSEVLPNSGSAKAGVKAGDIITSLNGKPLNSFAELRSRIA 333 (455)
T ss_pred EEC-CHHHHHhcCCCC-CCceEEEEECCCChHHHCCCCCCCEEEEECCEECCCHHHHHHHHH
Confidence 999 788999999873 579999999999999999 99999999999999999999988764
|
|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A | Back alignment and domain information |
|---|
| >PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms | Back alignment and domain information |
|---|
| >KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00020 Tryp_SPc Trypsin-like serine protease | Back alignment and domain information |
|---|
| >PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C | Back alignment and domain information |
|---|
| >cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >KOG3627 consensus Trypsin [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >TIGR01713 typeII_sec_gspC general secretion pathway protein C | Back alignment and domain information |
|---|
| >cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases | Back alignment and domain information |
|---|
| >PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification | Back alignment and domain information |
|---|
| >cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts | Back alignment and domain information |
|---|
| >PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] | Back alignment and domain information |
|---|
| >smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12812 PDZ_1: PDZ-like domain | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >TIGR00225 prc C-terminal peptidase (prc) | Back alignment and domain information |
|---|
| >PLN00049 carboxyl-terminal processing protease; Provisional | Back alignment and domain information |
|---|
| >PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A | Back alignment and domain information |
|---|
| >TIGR02860 spore_IV_B stage IV sporulation protein B | Back alignment and domain information |
|---|
| >PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous | Back alignment and domain information |
|---|
| >COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3532 consensus Predicted protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11186 carboxy-terminal protease; Provisional | Back alignment and domain information |
|---|
| >PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF05580 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR008763 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF02122 Peptidase_S39: Peptidase S39; InterPro: IPR000382 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00947 Pico_P2A: Picornavirus core protein 2A; InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3209 consensus WW domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] | Back alignment and domain information |
|---|
| >PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PRK09681 putative type II secretion protein GspC; Provisional | Back alignment and domain information |
|---|
| >KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] | Back alignment and domain information |
|---|
| >PF00944 Peptidase_S3: Alphavirus core protein ; InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG2921 consensus Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02860 spore_IV_B stage IV sporulation protein B | Back alignment and domain information |
|---|
| >KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF02395 Peptidase_S6: Immunoglobulin A1 protease Serine protease Prosite pattern; InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF05416 Peptidase_C37: Southampton virus-type processing peptidase; InterPro: IPR001665 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3209 consensus WW domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF03510 Peptidase_C24: 2C endopeptidase (C24) cysteine protease family; InterPro: IPR000317 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 385 | ||||
| 4fln_A | 539 | Crystal Structure Of Plant Protease Deg2 Length = 5 | 4e-69 | ||
| 1l1j_A | 239 | Crystal Structure Of The Protease Domain Of An Atp- | 6e-12 | ||
| 3pv4_A | 354 | Structure Of Legionella Fallonii Degq (Delta-Pdz2 V | 1e-11 | ||
| 3pv2_A | 451 | Structure Of Legionella Fallonii Degq (Wt) Length = | 2e-11 | ||
| 3pv3_A | 451 | Structure Of Legionella Fallonii Degq (S193a Varian | 3e-11 | ||
| 3nzi_A | 334 | Substrate Induced Remodeling Of The Active Site Reg | 3e-11 | ||
| 3num_A | 332 | Substrate Induced Remodeling Of The Active Site Reg | 8e-11 | ||
| 3pv5_A | 451 | Structure Of Legionella Fallonii Degq (N189gP190G V | 2e-09 | ||
| 3nwu_A | 227 | Substrate Induced Remodeling Of The Active Site Reg | 1e-08 | ||
| 3tjn_A | 228 | Htra1 Catalytic Domain, Apo Form Length = 228 | 1e-08 | ||
| 1lcy_A | 325 | Crystal Structure Of The Mitochondrial Serine Prote | 1e-08 | ||
| 3mh5_A | 456 | Htra Proteases Are Activated By A Conserved Mechani | 1e-08 | ||
| 2zle_A | 448 | Cryo-Em Structure Of Degp12OMP Length = 448 | 1e-08 | ||
| 3qo6_A | 348 | Crystal Structure Analysis Of The Plant Protease De | 2e-08 | ||
| 3tjo_A | 231 | Htra1 Catalytic Domain, Mutationally Inactivated Le | 3e-08 | ||
| 3mh4_A | 456 | Htra Proteases Are Activated By A Conserved Mechani | 3e-08 | ||
| 3otp_A | 459 | Crystal Structure Of The Degp Dodecamer With A Mode | 3e-08 | ||
| 4a8d_A | 448 | Degp Dodecamer With Bound Omp Length = 448 | 4e-08 | ||
| 3cs0_A | 448 | Crystal Structure Of Degp24 Length = 448 | 2e-07 | ||
| 3mh7_A | 456 | Htra Proteases Are Activated By A Conserved Mechani | 4e-07 | ||
| 1ky9_A | 448 | Crystal Structure Of Degp (Htra) Length = 448 | 4e-07 | ||
| 1te0_A | 318 | Structural Analysis Of Degs, A Stress Sensor Of The | 1e-06 | ||
| 3gcn_A | 340 | Crystal Structure Of Degs H198pD320A MUTANT MODIFIE | 2e-06 | ||
| 1y8t_A | 324 | Crystal Structure Of Rv0983 From Mycobacterium Tube | 5e-06 | ||
| 1soz_A | 314 | Crystal Structure Of Degs Protease In Complex With | 1e-05 | ||
| 3lgw_A | 241 | H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease | 1e-04 | ||
| 3lgt_A | 241 | Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease | 1e-04 | ||
| 1sot_A | 320 | Crystal Structure Of The Degs Stress Sensor Length | 1e-04 | ||
| 3lgv_A | 241 | H198p Mutant Of The Degs-Deltapdz Protease Length = | 2e-04 | ||
| 3k6y_A | 237 | Crystal Structure Of Rv3671c Protease From M. Tuber | 2e-04 | ||
| 3k6z_A | 219 | Crystal Structure Of Rv3671c Protease, Inactive For | 2e-04 | ||
| 3stj_A | 345 | Crystal Structure Of The Protease + Pdz1 Domain Of | 4e-04 | ||
| 3lt3_A | 217 | Crystal Structure Of Rv3671c From M. Tuberculosis H | 5e-04 |
| >pdb|4FLN|A Chain A, Crystal Structure Of Plant Protease Deg2 Length = 539 | Back alignment and structure |
|
| >pdb|1L1J|A Chain A, Crystal Structure Of The Protease Domain Of An Atp- Independent Heat Shock Protease Htra Length = 239 | Back alignment and structure |
| >pdb|3PV4|A Chain A, Structure Of Legionella Fallonii Degq (Delta-Pdz2 Variant) Length = 354 | Back alignment and structure |
| >pdb|3PV2|A Chain A, Structure Of Legionella Fallonii Degq (Wt) Length = 451 | Back alignment and structure |
| >pdb|3PV3|A Chain A, Structure Of Legionella Fallonii Degq (S193a Variant) Length = 451 | Back alignment and structure |
| >pdb|3NZI|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 334 | Back alignment and structure |
| >pdb|3NUM|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 332 | Back alignment and structure |
| >pdb|3PV5|A Chain A, Structure Of Legionella Fallonii Degq (N189gP190G VARIANT) Length = 451 | Back alignment and structure |
| >pdb|3NWU|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 227 | Back alignment and structure |
| >pdb|3TJN|A Chain A, Htra1 Catalytic Domain, Apo Form Length = 228 | Back alignment and structure |
| >pdb|1LCY|A Chain A, Crystal Structure Of The Mitochondrial Serine Protease Htra2 Length = 325 | Back alignment and structure |
| >pdb|3MH5|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 | Back alignment and structure |
| >pdb|2ZLE|A Chain A, Cryo-Em Structure Of Degp12OMP Length = 448 | Back alignment and structure |
| >pdb|3QO6|A Chain A, Crystal Structure Analysis Of The Plant Protease Deg1 Length = 348 | Back alignment and structure |
| >pdb|3TJO|A Chain A, Htra1 Catalytic Domain, Mutationally Inactivated Length = 231 | Back alignment and structure |
| >pdb|3MH4|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 | Back alignment and structure |
| >pdb|3OTP|A Chain A, Crystal Structure Of The Degp Dodecamer With A Model Substrate Length = 459 | Back alignment and structure |
| >pdb|4A8D|A Chain A, Degp Dodecamer With Bound Omp Length = 448 | Back alignment and structure |
| >pdb|3CS0|A Chain A, Crystal Structure Of Degp24 Length = 448 | Back alignment and structure |
| >pdb|3MH7|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 | Back alignment and structure |
| >pdb|1KY9|A Chain A, Crystal Structure Of Degp (Htra) Length = 448 | Back alignment and structure |
| >pdb|1TE0|A Chain A, Structural Analysis Of Degs, A Stress Sensor Of The Bacterial Periplasm Length = 318 | Back alignment and structure |
| >pdb|3GCN|A Chain A, Crystal Structure Of Degs H198pD320A MUTANT MODIFIED BY DFP IN Complex With Omp Peptide (Yqf) Length = 340 | Back alignment and structure |
| >pdb|1Y8T|A Chain A, Crystal Structure Of Rv0983 From Mycobacterium Tuberculosis- Proteolytically Active Form Length = 324 | Back alignment and structure |
| >pdb|1SOZ|A Chain A, Crystal Structure Of Degs Protease In Complex With An Activating Peptide Length = 314 | Back alignment and structure |
| >pdb|3LGW|A Chain A, H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 | Back alignment and structure |
| >pdb|3LGT|A Chain A, Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 | Back alignment and structure |
| >pdb|1SOT|A Chain A, Crystal Structure Of The Degs Stress Sensor Length = 320 | Back alignment and structure |
| >pdb|3LGV|A Chain A, H198p Mutant Of The Degs-Deltapdz Protease Length = 241 | Back alignment and structure |
| >pdb|3K6Y|A Chain A, Crystal Structure Of Rv3671c Protease From M. Tuberculosis, Active Form Length = 237 | Back alignment and structure |
| >pdb|3K6Z|A Chain A, Crystal Structure Of Rv3671c Protease, Inactive Form Length = 219 | Back alignment and structure |
| >pdb|3STJ|A Chain A, Crystal Structure Of The Protease + Pdz1 Domain Of Degq From Escherichia Coli Length = 345 | Back alignment and structure |
| >pdb|3LT3|A Chain A, Crystal Structure Of Rv3671c From M. Tuberculosis H37rv, Ser343ala Mutant, Inactive Form Length = 217 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Length = 210 | Back alignment and structure |
|---|
Score = 194 bits (495), Expect = 6e-61
Identities = 47/224 (20%), Positives = 79/224 (35%), Gaps = 38/224 (16%)
Query: 114 DSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNAHVVADSTF-VLVRKHGS 172
+V ++ P+ +GFVI I+TN HV D + H +
Sbjct: 3 KNVTQV-----KDTNNFPYNGVVSF-KDATGFVIGKNTIITNKHVSKDYKVGDRITAHPN 56
Query: 173 PTKYR------AQVEAVGHECDLAILIVESD---------EFWEGMHFLELGDIPFLQQA 217
K + + D++++ +E F E + +
Sbjct: 57 GDKGNGGIYKIKSISDYPGDEDISVMNIEEQAVERGPKGFNFNENVQAFNFAKDAKVDDK 116
Query: 218 VAVVGYPQGGDNI---SVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAI-MG 273
+ V+GYP N + G + R++ + DA I PGNSG P +
Sbjct: 117 IKVIGYPLPAQNSFKQFESTGTIKRIKDN----------ILNFDAYIEPGNSGSPVLNSN 166
Query: 274 NKVAGVAFQNLS--GAENIGYIIPVPVIKHFITGVVEHGKYVGF 315
N+V GV + + G+E G + P IK FI +E +
Sbjct: 167 NEVIGVVYGGIGKIGSEYNGAVYFTPQIKDFIQKHIEQHHHHHH 210
|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Length = 200 | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Length = 204 | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Length = 237 | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Length = 163 | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Length = 239 | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Length = 231 | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Length = 245 | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Length = 242 | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Length = 237 | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Length = 185 | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Length = 191 | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 | Back alignment and structure |
|---|
| >3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Length = 213 | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Length = 187 | Back alignment and structure |
|---|
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 | Back alignment and structure |
|---|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 385 | |||
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 100.0 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 100.0 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 100.0 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 100.0 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 100.0 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 100.0 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 100.0 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 100.0 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 100.0 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 100.0 | |
| 3sti_A | 245 | Protease DEGQ; serine protease, PDZ domain, chaper | 100.0 | |
| 1l1j_A | 239 | Heat shock protease HTRA; hydrolase, serine protei | 100.0 | |
| 3lgi_A | 237 | Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro | 100.0 | |
| 3tjo_A | 231 | Serine protease HTRA1; peptidase, hydrolase; HET: | 100.0 | |
| 3k6y_A | 237 | Serine protease, possible membrane-associated seri | 99.97 | |
| 2as9_A | 210 | Serine protease; trypsin-like fold, hydrolase; 1.7 | 99.91 | |
| 2w5e_A | 163 | Putative serine protease; coiled coil, transmembra | 99.9 | |
| 2w7s_A | 200 | Serine protease SPLA; hydrolase, family S1; 1.80A | 99.87 | |
| 1agj_A | 242 | Epidermolytic toxin A; hydrolase, serine protease; | 99.87 | |
| 2vid_A | 204 | Serine protease SPLB; hydrolase; 1.80A {Staphyloco | 99.85 | |
| 2o8l_A | 274 | V8 protease, taphylococcal serine; serine protease | 99.85 | |
| 1wcz_A | 268 | Glutamyl endopeptidase; virulence factor, hydrolas | 99.84 | |
| 2h5c_A | 198 | Alpha-lytic protease; serine protease, acylation t | 99.81 | |
| 1qtf_A | 246 | Exfoliative toxin B; serine protease, superantigen | 99.79 | |
| 2qa9_E | 185 | Streptogrisin-B; chymotrypsin-type serine peptidas | 99.78 | |
| 2oua_A | 188 | Serine protease, protein NAPA; kinetic stability, | 99.77 | |
| 1hpg_A | 187 | Glutamic acid specific protease; serine protease, | 99.77 | |
| 2ea3_A | 189 | Chymotrypsin; celloulomonas, protease, hydrolase; | 99.75 | |
| 2pfe_A | 186 | Protease A, alkaline serine protease, TFPA; beta-b | 99.71 | |
| 2sga_A | 181 | Proteinase A; hydrolase (serine proteinase); 1.50A | 99.7 | |
| 1fxy_A | 228 | Coagulation factor XA-trypsin chimera; protease, c | 99.68 | |
| 1hj8_A | 222 | Trypsin I; hydrolase, radiation damage, disulphide | 99.68 | |
| 4i8h_A | 223 | Cationic trypsin, beta-trypsin; serine protease, h | 99.67 | |
| 1ton_A | 235 | Tonin; hydrolase(serine proteinase); 1.80A {Rattus | 99.67 | |
| 2zch_P | 237 | Prostate-specific antigen; human PSA, kallikrein r | 99.67 | |
| 1cgh_A | 224 | Cathepsin G; inflammation, specificity, serine pro | 99.66 | |
| 2bdg_A | 223 | Kallikrein-4; serine proteinase, S1 subsite, 70-80 | 99.65 | |
| 3mfj_A | 223 | Cationic trypsin; serine proteinase, hydrolase; 0. | 99.65 | |
| 1npm_A | 225 | Neuropsin; serine proteinase, glycoprotein; HET: N | 99.65 | |
| 1ao5_A | 237 | Glandular kallikrein-13; serine protease, protein | 99.65 | |
| 1iau_A | 227 | Granzyme B; hydrolase-hydrolase inhibitor complex; | 99.65 | |
| 1mbm_A | 198 | NSP4 proteinase, chymotrypsin-like serine protease | 99.64 | |
| 2psx_A | 227 | Kallikrein-5; zinc inhibition, stratum corneum, gl | 99.64 | |
| 1sgf_A | 240 | 7S NGF, nerve growth factor; growth factor (beta-N | 99.64 | |
| 3s9c_A | 234 | Vipera russelli proteinase RVV-V gamma; serine pro | 99.64 | |
| 1lo6_A | 223 | Kallikrein 6, HK6; serine protease, human kallikre | 99.64 | |
| 1fuj_A | 221 | PR3, myeloblastin; hydrolase, serine protease, gly | 99.64 | |
| 1gvz_A | 237 | Kallikrein-1E2; antigen, prostate specific antigen | 99.63 | |
| 2qxi_A | 224 | Kallikrein-7; S1 pocket, chloromethyl ketone, alte | 99.63 | |
| 1mza_A | 240 | Pro-granzyme K; apoptosis, serine protease, S1 fam | 99.63 | |
| 1aut_C | 250 | Activated protein C; serine proteinase, plasma cal | 99.63 | |
| 2aiq_A | 231 | Protein C activator; snake venom serine proteinase | 99.63 | |
| 1pq7_A | 224 | Trypsin; ultra-high resolution, catalysis, hydrola | 99.63 | |
| 2l97_A | 134 | HTRA, putative serine protease; HTRA-PDZ, protein | 99.63 | |
| 1azz_A | 226 | Collagenase; complex (serine protease/inhibitor), | 99.63 | |
| 4ag1_A | 226 | Chymase; hydrolase-de novo protein complex, inhibi | 99.63 | |
| 4e7n_A | 238 | Snake-venom thrombin-like enzyme; beta-barrel, hyd | 99.63 | |
| 3s69_A | 234 | Thrombin-like enzyme defibrase; beta-barrel, serin | 99.63 | |
| 1a7s_A | 225 | Heparin binding protein; serine protease homolog, | 99.63 | |
| 1spj_A | 238 | Kallikrein 1; serine protease, KLK1, HK1, hydrolas | 99.62 | |
| 1eq9_A | 222 | Chymotrypsin; FIRE ANT, serine proteinase, hydrola | 99.61 | |
| 3rp2_A | 224 | RAT MAST cell protease II; serine proteinase; 1.90 | 99.61 | |
| 2z7f_E | 218 | Leukocyte elastase; serine protease, serine protea | 99.61 | |
| 2xw9_A | 228 | Complement factor D; immune system, hydrolase, ser | 99.61 | |
| 1euf_A | 227 | Duodenase; serine protease, dual specificity, hydr | 99.61 | |
| 3h7t_A | 235 | Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 | 99.6 | |
| 3fzz_A | 227 | Granzyme C; hydrolase, cytolysis, protease, serine | 99.6 | |
| 1orf_A | 234 | Granzyme A; hydrolase-hydrolase inhibitor complex; | 99.59 | |
| 3gov_B | 251 | MAsp-1; complement, serine protease, beta barrel, | 99.59 | |
| 1bru_P | 241 | Elastase, PPE; serine protease, hydrolase; HET: 1N | 99.59 | |
| 1gvk_B | 240 | Elastase 1, peptide inhibitor; hydrolase, serine p | 99.59 | |
| 2zgc_A | 240 | Granzyme M; serine protease, cytolysis, glycoprote | 99.58 | |
| 1t8o_A | 245 | Chymotrypsin A; chymotrypsin, serine proteinase, B | 99.58 | |
| 1si5_H | 240 | Scatter factor, hepatocyte growth factor, SF, hepa | 99.58 | |
| 2f91_A | 237 | Hepatopancreas trypsin; trypsin, canonical inhibit | 99.58 | |
| 2asu_B | 234 | Hepatocyte growth factor-like protein; serine prot | 99.58 | |
| 2qy0_B | 242 | Complement C1R subcomponent; serine protease, beta | 99.58 | |
| 1p3c_A | 215 | Glutamyl-endopeptidase; serine protease, hydrolase | 99.57 | |
| 2jkh_A | 241 | Activated factor XA heavy chain; plasma, calcium, | 99.57 | |
| 2hlc_A | 230 | Collagenase; serine protease, hydrolase, collagen | 99.57 | |
| 1elt_A | 236 | Elastase; serine proteinase; 1.61A {Salmo salar} S | 99.57 | |
| 2bdy_A | 289 | Thrombin; thrombin, complex structure, hydrolase, | 99.56 | |
| 3tvj_B | 242 | Mannan-binding lectin serine protease 2 B chain; i | 99.56 | |
| 1ym0_A | 238 | Fibrinotic enzyme component B; two chains, glycosy | 99.56 | |
| 3ncl_A | 241 | Suppressor of tumorigenicity 14 protein; proteinas | 99.56 | |
| 3bg8_A | 238 | Coagulation factor XIA light chain; protease inhib | 99.56 | |
| 3h7o_A | 228 | Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 | 99.55 | |
| 2any_A | 241 | Kininogenin, plasma kallikrein, light chain, fletc | 99.55 | |
| 2wph_S | 235 | Coagulation factor IXA heavy chain; serine proteas | 99.55 | |
| 1ddj_A | 247 | Plasminogen; catalytic domain, blood clotting; 2.0 | 99.55 | |
| 1m9u_A | 241 | Earthworm fibrinolytic enzyme; hydrolase, serine p | 99.54 | |
| 3gyl_B | 261 | Prostasin; ENAC, zymogen, divalent cation, channel | 99.54 | |
| 3beu_A | 224 | Trypsin, SGT; beta sheets, serine protease, hydrol | 99.54 | |
| 3rm2_H | 259 | Thrombin heavy chain; serine protease, kringle, hy | 99.54 | |
| 2bz6_H | 254 | Blood coagulation factor VIIA; serine protease, en | 99.54 | |
| 2oq5_A | 232 | Transmembrane protease, serine 11E; type II trans- | 99.53 | |
| 2olg_A | 278 | Pro-phenoloxidase activating enzyme-I; prophenolox | 99.53 | |
| 1rtf_B | 252 | (TC)-T-PA, two chain tissue plasminogen activator; | 99.53 | |
| 1md8_A | 329 | C1R complement serine protease; innate immunity, a | 99.53 | |
| 1pyt_D | 251 | TC, PCPA-TC, chymotrypsinogen C; ternary complex ( | 99.53 | |
| 2r0l_A | 248 | Hepatocyte growth factor activator; serine proteas | 99.53 | |
| 2f9n_A | 245 | Alpha I tryptase; serine proteinase, trypsin-like, | 99.52 | |
| 4dgj_A | 235 | Enteropeptidase catalytic light chain; serine prot | 99.52 | |
| 4f4o_C | 347 | Haptoglobin; globin fold, serine protease fold, co | 99.51 | |
| 1fiw_A | 290 | Beta-acrosin heavy chain; anti-parallel beta-barre | 99.51 | |
| 1yc0_A | 283 | Hepatocyte growth factor activator; hydrolase/inhi | 99.51 | |
| 1z8g_A | 372 | Serine protease hepsin; serine protease hepsin, pr | 99.5 | |
| 3mhw_U | 247 | Urokinase-type plasminogen activator; hydrolase, b | 99.5 | |
| 2jde_A | 276 | Urokinase-type plasminogen activator; plasminogen | 99.48 | |
| 1gpz_A | 399 | Complement C1R component; hydrolase, activation, i | 99.48 | |
| 3cp7_A | 218 | Alkaline serine protease Al20; trypsin-like, hydro | 99.48 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 99.47 | |
| 1fon_A | 240 | Procarboxypeptidase A-S6; truncated zymogen E, ser | 99.47 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 99.46 | |
| 1elv_A | 333 | Complement C1S component; trypsin-like serin prote | 99.45 | |
| 3nxp_A | 424 | Prethrombin-1; allostery, blood coagulation, hydro | 99.44 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 99.44 | |
| 3fan_A | 213 | Non-structural protein; chymotrypsin-like, N-termi | 99.44 | |
| 2b9l_A | 394 | Prophenoloxidase activating factor; CLIP domain, e | 99.43 | |
| 2vnt_A | 276 | Urokinase-type plasminogen activator; UPA, inhibit | 99.42 | |
| 2xxl_A | 408 | GRAM-positive specific serine protease, isoform B; | 99.41 | |
| 4dur_A | 791 | Plasminogen, serine protease; fibrinolysis, hydrol | 99.34 | |
| 2f83_A | 625 | Coagulation factor XI; protease, apple domain, hyd | 99.32 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 99.29 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 99.28 | |
| 2pzd_A | 113 | Serine protease HTRA2; PDZ domain, apoptosis, mito | 99.24 | |
| 1zyo_A | 191 | Serine protease; beta-barrel, glutamyl endopeptida | 99.24 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 99.22 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 99.21 | |
| 2p3w_A | 112 | Probable serine protease HTRA3; PDZ domain, phage | 99.21 | |
| 1arb_A | 268 | Achromobacter protease I; hydrolase(serine proteas | 99.18 | |
| 1yph_C | 131 | Chymotrypsin A, chain B; serine protease, hydrolas | 98.97 | |
| 2pka_B | 152 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 98.95 | |
| 2vz5_A | 139 | TAX1-binding protein 3; WNT signaling pathway, pro | 98.86 | |
| 3sfj_A | 104 | TAX1-binding protein 3; PDZ:peptide complex, signa | 98.77 | |
| 2eaq_A | 90 | LIM domain only protein 7; conserved hypothetical | 98.73 | |
| 3mmg_A | 241 | Nuclear inclusion protein A; 3C-type protease, TEV | 98.7 | |
| 2fcf_A | 103 | Multiple PDZ domain protein; adaptor molecule, pro | 98.7 | |
| 2i4s_A | 105 | General secretion pathway protein C; EPSC, GSPC, P | 98.67 | |
| 2rcz_A | 81 | Tight junction protein ZO-1; PDZ, domain-swapping, | 98.66 | |
| 1uit_A | 117 | Human discs large 5 protein; PDZ domain, HDLG5, ma | 98.65 | |
| 2iwq_A | 123 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.62 | |
| 3kzd_A | 94 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 98.55 | |
| 2eeh_A | 100 | PDZ domain-containing protein 7; structural genomi | 98.55 | |
| 2vsp_A | 91 | PDZ domain-containing protein 1; membrane, cytopla | 98.54 | |
| 2e7k_A | 91 | Maguk P55 subfamily member 2; PDZ domain, MPP2 pro | 98.53 | |
| 2ego_A | 96 | General receptor for phosphoinositides 1- associat | 98.53 | |
| 2jxo_A | 98 | Ezrin-radixin-moesin-binding phosphoprotein 50; nh | 98.52 | |
| 1wi2_A | 104 | Riken cDNA 2700099C19; structural genomics, riken | 98.5 | |
| 2pa1_A | 87 | PDZ and LIM domain protein 2; PDZ domain, structur | 98.49 | |
| 2he4_A | 90 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p | 98.49 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 98.47 | |
| 2pkt_A | 91 | PDZ and LIM domain protein 1; PDZ domain, structur | 98.47 | |
| 3i18_A | 100 | LMO2051 protein; alpha-beta protein, structural ge | 98.46 | |
| 1wh1_A | 124 | KIAA1095 protein; PDZ domain, structural genomics, | 98.46 | |
| 3cyy_A | 92 | Tight junction protein ZO-1; protein-ligand comple | 98.45 | |
| 2vsv_A | 109 | Rhophilin-2; scaffold protein, RHO GTPase binding, | 98.44 | |
| 2w4f_A | 97 | Protein LAP4; structural protein, phosphoprotein, | 98.42 | |
| 2kjp_A | 91 | Uncharacterized protein YLBL; mixed alpha-beta pro | 98.42 | |
| 2i6v_A | 87 | General secretion pathway protein C; EPSC, GSPC, P | 98.41 | |
| 2f5y_A | 91 | Regulator of G-protein signalling 3 isoform 1; PDZ | 98.41 | |
| 2v90_A | 96 | PDZ domain-containing protein 3; membrane, protein | 98.41 | |
| 2kv8_A | 83 | RGS12, regulator of G-protein signaling 12; PDZ do | 98.39 | |
| 1vb7_A | 94 | PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, | 98.39 | |
| 2uzc_A | 88 | Human pdlim5, PDZ and LIM domain 5; metal-binding, | 98.39 | |
| 2z17_A | 104 | Pleckstrin homology SEC7 and coiled-coil domains- | 98.39 | |
| 3qik_A | 101 | Phosphatidylinositol 3,4,5-trisphosphate-dependen | 98.39 | |
| 3r68_A | 95 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P | 98.39 | |
| 2kl1_A | 94 | YLBL protein; structure genomics, structural genom | 98.38 | |
| 1g9o_A | 91 | NHE-RF; PDZ domain, complex, signaling protein; 1. | 98.38 | |
| 2dls_A | 93 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 98.37 | |
| 1rgw_A | 85 | ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, | 98.37 | |
| 3ngh_A | 106 | PDZ domain-containing protein 1; adaptor protein, | 98.36 | |
| 3id1_A | 95 | Regulator of sigma E protease; hydrolase, cell inn | 98.36 | |
| 3khf_A | 99 | Microtubule-associated serine/threonine-protein ki | 98.36 | |
| 1y7n_A | 90 | Amyloid beta A4 precursor protein-binding family A | 98.35 | |
| 1va8_A | 113 | Maguk P55 subfamily member 5; PDZ domain, palmitoy | 98.35 | |
| 1vae_A | 111 | Rhophilin 2, rhophilin, RHO GTPase binding protein | 98.35 | |
| 1x5q_A | 110 | LAP4 protein; PDZ domain, scribble homolog protein | 98.34 | |
| 3tsv_A | 124 | Tight junction protein ZO-1; PDZ, scaffolding, JAM | 98.34 | |
| 1m5z_A | 91 | GRIP, AMPA receptor interacting protein; six beta- | 98.33 | |
| 1nf3_C | 128 | PAR-6B; semi-CRIB motif, switch I and II, PDZ doma | 98.33 | |
| 2q3g_A | 89 | PDZ and LIM domain protein 7; structural genomics, | 98.33 | |
| 2ejy_A | 97 | 55 kDa erythrocyte membrane protein; GPC, maguk, P | 98.33 | |
| 1q3o_A | 109 | Shank1; PDZ, GKAP, peptide binding protein; 1.80A | 98.32 | |
| 1whd_A | 100 | RGS3, regulator of G-protein signaling 3; PDZ doma | 98.32 | |
| 1kwa_A | 88 | Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca | 98.31 | |
| 1lvm_A | 229 | Catalytic domain of the nuclear inclusion protein | 98.31 | |
| 1v5l_A | 103 | PDZ and LIM domain 3; actinin alpha 2 associated L | 98.31 | |
| 2hga_A | 125 | Conserved protein MTH1368; GFT structural genomics | 98.3 | |
| 2d90_A | 102 | PDZ domain containing protein 1; structural genomi | 98.28 | |
| 2o2t_A | 117 | Multiple PDZ domain protein; structural protein, s | 98.27 | |
| 2zpm_A | 91 | Regulator of sigma E protease; metalloproteinase, | 98.27 | |
| 2h2b_A | 107 | Tight junction protein ZO-1; PDZ domain, phage der | 98.27 | |
| 2edz_A | 114 | PDZ domain-containing protein 1; CFTR-associated p | 98.26 | |
| 2eeg_A | 94 | PDZ and LIM domain protein 4; PDZ domain, structur | 98.26 | |
| 2jil_A | 97 | GRIP1 protein, glutamate receptor interacting prot | 98.25 | |
| 1uez_A | 101 | KIAA1526 protein; PDZ domain, structural genomics, | 98.25 | |
| 2vwr_A | 95 | Ligand of NUMB protein X 2; protein-binding, metal | 98.24 | |
| 2q9v_A | 90 | Membrane-associated guanylate kinase, WW and PDZ c | 98.24 | |
| 2i04_A | 85 | Membrane-associated guanylate kinase, WW and PDZ d | 98.24 | |
| 2yub_A | 118 | LIMK-2, LIM domain kinase 2; PDZ domain, structura | 98.24 | |
| 2kjd_A | 128 | Sodium/hydrogen exchange regulatory cofactor NHE- | 98.24 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 98.23 | |
| 3qzr_A | 187 | 3C protein; chymotrypsin-fold, beta-ribbon, hydrol | 98.22 | |
| 1ihj_A | 98 | INAD; intermolecular disulfide bond, PDZ domain, s | 98.22 | |
| 2la8_A | 106 | Inactivation-NO-after-potential D protein, KON-TI | 98.22 | |
| 3bpu_A | 88 | Membrane-associated guanylate kinase, WW and PDZ c | 98.22 | |
| 2yt7_A | 101 | Amyloid beta A4 precursor protein-binding family A | 98.22 | |
| 3e17_A | 88 | Tight junction protein ZO-2; domain swapping, alte | 98.21 | |
| 3cbz_A | 108 | Dishevelled-2; PDZ domain, phage derived high affi | 98.2 | |
| 1qau_A | 112 | Neuronal nitric oxide synthase (residues 1-130); b | 98.2 | |
| 3qe1_A | 107 | Sorting nexin-27, G protein-activated inward RECT | 98.19 | |
| 2db5_A | 128 | INAD-like protein; PDZ domain, hinadl, PALS1- asso | 98.19 | |
| 4e34_A | 87 | Golgi-associated PDZ and coiled-coil motif-contai | 98.17 | |
| 2qkv_A | 96 | Inactivation-NO-after-potential D protein; PDZ dom | 98.16 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 98.16 | |
| 1d5g_A | 96 | Human phosphatase HPTP1E; protein-peptide complex, | 98.16 | |
| 2yuy_A | 126 | RHO GTPase activating protein 21; PDZ domain, stru | 98.15 | |
| 2lob_A | 112 | Golgi-associated PDZ and coiled-coil motif-contai | 97.44 | |
| 3o46_A | 93 | Maguk P55 subfamily member 7; PDZ domain, structur | 98.14 | |
| 2gzv_A | 114 | PRKCA-binding protein; protein kinase C, PDZ domai | 98.14 | |
| 2fe5_A | 94 | Presynaptic protein SAP102; PDZ domain, DLG3, huma | 98.14 | |
| 2fne_A | 117 | Multiple PDZ domain protein; structural protein, s | 98.13 | |
| 1uep_A | 103 | Membrane associated guanylate kinase inverted-2 (M | 98.13 | |
| 2qg1_A | 92 | Multiple PDZ domain protein; MPDZ, MUPP1, structur | 98.13 | |
| 1uf1_A | 128 | KIAA1526 protein; PDZ domain, structural genomics, | 98.13 | |
| 2eei_A | 106 | PDZ domain-containing protein 1; regulatory factor | 98.13 | |
| 2jre_A | 108 | C60-1 PDZ domain peptide; de novo protein; NMR {Sy | 98.12 | |
| 2d8i_A | 114 | T-cell lymphoma invasion and metastasis 1 variant; | 98.12 | |
| 2i1n_A | 102 | Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig | 98.12 | |
| 1ueq_A | 123 | Membrane associated guanylate kinase inverted-2 (M | 98.12 | |
| 3q3y_A | 191 | HEVB EV93 3C protease; cysteine trypsin-like prote | 98.11 | |
| 2opg_A | 98 | Multiple PDZ domain protein; structural protein, s | 98.1 | |
| 1mfg_A | 95 | ERB-B2 interacting protein; PDZ domain, protein-pe | 98.1 | |
| 2b0f_A | 182 | Picornain 3C (protease 3C) (P3C); beta barrel, hyd | 98.1 | |
| 2dkr_A | 93 | LIN-7 homolog B; LIN-7B, PDZ, structural genomics, | 98.1 | |
| 2byg_A | 117 | Channel associated protein of synapse-110; DLG2, P | 98.09 | |
| 1cqq_A | 180 | Type 2 rhinovirus 3C protease; viral protein, hydr | 98.09 | |
| 3b76_A | 118 | E3 ubiquitin-protein ligase LNX; PDZ, bound ligand | 98.08 | |
| 1uew_A | 114 | Membrane associated guanylate kinase inverted-2 (M | 98.08 | |
| 1n7e_A | 97 | AMPA receptor interacting protein GRIP; PDZ, prote | 98.08 | |
| 1wha_A | 105 | KIAA0147 protein, scribble; PDZ domain, cellular s | 98.07 | |
| 2jik_A | 101 | Synaptojanin-2 binding protein; transmembrane, out | 98.06 | |
| 3zve_A | 190 | 3C protease; hydrolase, michael inhibitor; HET: G8 | 98.06 | |
| 3l4f_D | 132 | SH3 and multiple ankyrin repeat domains protein 1; | 98.06 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 98.05 | |
| 1x5n_A | 114 | Harmonin; PDZ domain, usher syndrome 1C protein, a | 98.05 | |
| 2koj_A | 111 | Partitioning defective 3 homolog; PDZ domain, stru | 98.05 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 98.04 | |
| 2kom_A | 121 | Partitioning defective 3 homolog; PAR-3B, PDZ doma | 98.04 | |
| 1v62_A | 117 | KIAA1719 protein; structural genomics, synaptic tr | 98.04 | |
| 1v5q_A | 122 | GRIP1 homolog, glutamate receptor interacting prot | 98.04 | |
| 1q7x_A | 108 | PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str | 98.03 | |
| 2dmz_A | 129 | INAD-like protein; PDZ domain, inadl protein, hina | 98.03 | |
| 2djt_A | 104 | Unnamed protein product; PDZ domain, structural ge | 98.03 | |
| 2awx_A | 105 | Synapse associated protein 97; membrane protein, s | 98.02 | |
| 1x6d_A | 119 | Interleukin-16; PDZ domain, lymphocyte chemoattrac | 98.02 | |
| 2eno_A | 120 | Synaptojanin-2-binding protein; mitochondrial oute | 98.02 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 98.01 | |
| 4amh_A | 106 | Disks large homolog 1; permutation, protein foldin | 98.0 | |
| 3axa_A | 106 | Afadin, nectin-3, protein AF-6; PDZ domain, fusion | 98.0 | |
| 2edp_A | 100 | Fragment, shroom family member 4; APX/shroom famil | 98.0 | |
| 2dm8_A | 116 | INAD-like protein; PDZ domain, inadl protein, hina | 97.99 | |
| 4dcd_A | 190 | Protease 3C, genome polyprotein; antiviral inhibit | 97.98 | |
| 1wfg_A | 131 | Regulating synaptic membrane exocytosis protein 2; | 97.98 | |
| 2dlu_A | 111 | INAD-like protein; PDZ domain, inadl protein, hina | 97.98 | |
| 2hal_A | 212 | Hepatitis A protease 3C; 3C protease, inhibitor de | 97.97 | |
| 1b8q_A | 127 | Protein (neuronal nitric oxide synthase); PDZ doma | 97.97 | |
| 1um1_A | 110 | KIAA1849 protein, RSGI RUH-007; PDZ domain, human | 97.97 | |
| 1wf8_A | 107 | Neurabin-I; PDZ domain, structural genomics, NPPSF | 97.97 | |
| 3i4w_A | 104 | Disks large homolog 4; alpha and beta protein, alt | 97.97 | |
| 1uju_A | 111 | Scribble; PDZ domain, cellular signaling, structur | 97.97 | |
| 1uhp_A | 107 | Hypothetical protein KIAA1095; PDZ domain, semapho | 97.96 | |
| 1tp5_A | 119 | Presynaptic density protein 95; PDZ-peptide ligand | 97.96 | |
| 1ujd_A | 117 | KIAA0559 protein; PDZ domain, structural genomics, | 97.95 | |
| 2d92_A | 108 | INAD-like protein; PDZ domain, inadl protein, hina | 97.95 | |
| 2r4h_A | 112 | Membrane-associated guanylate kinase, WW and PDZ c | 97.94 | |
| 2kpk_A | 129 | Membrane-associated guanylate kinase, WW and PDZ c | 97.94 | |
| 2g5m_B | 113 | Neurabin-2; spinophilin, PDZ domain, CNS, synaptic | 97.93 | |
| 1wfv_A | 103 | Membrane associated guanylate kinase inverted-2; a | 97.93 | |
| 1n7t_A | 103 | 99-MER peptide of densin-180-like protein; PDZ dom | 97.92 | |
| 2iwn_A | 97 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 97.91 | |
| 2iwo_A | 120 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 97.9 | |
| 1wif_A | 126 | RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s | 97.9 | |
| 3hpk_A | 125 | Protein interacting with PRKCA 1; oxidized, PDZ do | 97.89 | |
| 2csj_A | 117 | TJP2 protein; PDZ domain, structural genomics, NPP | 97.89 | |
| 2daz_A | 124 | INAD-like protein; PDZ domain, inadl protein, hina | 97.89 | |
| 1ujv_A | 96 | Membrane associated guanylate kinase inverted-2 (M | 97.88 | |
| 2ehr_A | 117 | INAD-like protein; PDZ domain, inadl protein, hina | 97.87 | |
| 2edv_A | 96 | FERM and PDZ domain-containing protein 1; cytoskel | 97.85 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 97.84 | |
| 1wg6_A | 127 | Hypothetical protein (riken cDNA 2810455B10); stru | 97.84 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 97.83 | |
| 4fgm_A | 597 | Aminopeptidase N family protein; structural genomi | 97.82 | |
| 3k1r_A | 192 | Harmonin; protein-protein complex, alternative spl | 97.81 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 97.8 | |
| 1wi4_A | 109 | Synip, syntaxin binding protein 4; syntaxin4-inter | 97.8 | |
| 1v6b_A | 118 | Harmonin isoform A1; structural genomics, usher sy | 97.8 | |
| 2krg_A | 216 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a | 97.8 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 97.8 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 97.79 | |
| 1r6j_A | 82 | Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap | 97.78 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 97.73 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 97.72 | |
| 1um7_A | 113 | Synapse-associated protein 102; PDZ, discs large h | 97.71 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 97.7 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 97.67 | |
| 3egg_C | 170 | Spinophilin; PP1, serine/threonine phosphatase, po | 97.67 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 97.66 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 97.65 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 97.65 | |
| 1ufx_A | 103 | KIAA1526 protein; PDZ domain, structural genomics, | 97.63 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 97.63 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 97.63 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 97.62 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 97.59 | |
| 2pka_A | 80 | Kallikrein A; serine proteinase; 2.05A {Sus scrofa | 97.56 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 97.5 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 97.48 | |
| 1fc6_A | 388 | Photosystem II D1 protease; D1 C-terminal processi | 97.35 | |
| 2bhg_A | 209 | Foot-and-mouth disease virus 3C protease; chymotry | 97.32 | |
| 3soe_A | 113 | Membrane-associated guanylate kinase, WW and PDZ c | 97.27 | |
| 2ijd_1 | 644 | Picornain 3C, RNA-directed RNA polymerase; RNA-dep | 97.26 | |
| 3gge_A | 95 | PDZ domain-containing protein GIPC2; structural ge | 97.25 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 97.23 | |
| 3k50_A | 403 | Putative S41 protease; structural genomics, joint | 97.21 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 97.05 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 96.92 | |
| 1yph_E | 97 | Chymotrypsin A, chain C; serine protease, hydrolas | 96.75 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 96.71 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 96.38 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 96.31 | |
| 4ash_A | 185 | NS6 protease; hydrolase, trypsin-like, calicivirus | 95.67 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 95.47 | |
| 1wxr_A | 1048 | Haemoglobin protease; hemoglobine protease, autotr | 94.42 | |
| 2fyq_A | 194 | Chymotrypsin-like cysteine proteinase; protease, n | 94.1 | |
| 2hrv_A | 142 | 2A cysteine proteinase; hydrolase (cysteine protei | 86.02 | |
| 1vcp_A | 149 | Semliki forest virus capsid protein; virus coat pr | 85.78 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 85.5 | |
| 4agk_A | 158 | Capsid protein, coat protein, C; hydrolase, viral | 85.41 | |
| 1svp_A | 161 | Sindbis virus capsid protein; chymotrypsin-like se | 85.4 | |
| 3e90_B | 198 | NS3 protease; trypsin-like serine protease, protea | 85.35 | |
| 3u1j_B | 191 | Serine protease NS3; serine protease, ER MEM hydro | 85.2 | |
| 2fom_B | 185 | Polyprotein; flavivirus, NS3 protease, NS2B cofact | 84.92 | |
| 1ep5_B | 157 | Capsid protein C, coat protein C; beta barrel, hyd | 84.83 | |
| 2ggv_B | 185 | NS3, non-structural protein 3; beta barrel, serine | 84.61 | |
| 2fp7_B | 172 | Serine protease NS3; flavivirus, NS3 protease, NS2 | 84.43 | |
| 3lkw_A | 236 | Fusion protein of nonstructural protein 2B and non | 83.36 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 82.49 | |
| 1z8r_A | 166 | Coxsackievirus B4 polyprotein; beta barrel coordin | 81.87 |
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Probab=100.00 E-value=4e-53 Score=429.70 Aligned_cols=267 Identities=49% Similarity=0.841 Sum_probs=243.2
Q ss_pred HhCCCeEEEEeeecCCCCCCCCCCCCCCcceEEEEEecCCEEEecccccCCCceEEEEEcCCCcEEEEEEEEecCCCCeE
Q 016641 111 LALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLA 190 (385)
Q Consensus 111 ~~~~SVV~I~~~~~~~~~~~p~~~~~~~~~~GSGfiI~~g~ILT~aHvv~~~~~i~V~~~~~g~~~~a~v~~~d~~~DlA 190 (385)
...+|||+|++....++|..||+...+..+.||||+|++||||||+|||+++..+.|++.+|++.++|++++.|+.+|||
T Consensus 45 ~~~~sVV~I~~~~~~~~~~~Pw~~~~~~~s~GSGfiI~dG~IlTN~HVV~~a~~i~V~~~~dg~~~~A~vv~~D~~~DLA 124 (539)
T 4fln_A 45 SFLNAVVKVYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVDCDIA 124 (539)
T ss_dssp HHHTTEEEEEEEECCBCSSSTTSBCCCEEEEEEEEEEETTEEEECGGGGTTEEEEEEECTTCCCCEEEEEEEEETTTTEE
T ss_pred ccCCCeEEEEEEecCCCCCCccccCCccceEEEEEEEECCEEEEChHHcCCCCeEEEEEccCCEEEEEEEEEECCCCCEE
Confidence 45689999999999999999999999999999999999999999999999999999998779999999999999999999
Q ss_pred EEEecCCcccccceeeecCCcccCCCeEEEEecCCCCCCceEEEeeEeecccccccCCCceeeEEEecccCCCCCCCcce
Q 016641 191 ILIVESDEFWEGMHFLELGDIPFLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPA 270 (385)
Q Consensus 191 lLkv~~~~~~~~~~~l~l~~~~~~G~~V~~iG~p~~~~~~~~~~G~Vs~~~~~~~~~~~~~~~~i~~d~~i~~G~SGGPL 270 (385)
|||++...++..++++.+++.+++|++|+++|||+++...+++.|+|+++.+..+..+.....+||+|+++++|||||||
T Consensus 125 vLkv~~~~~~~~~~pl~~g~~~~vGd~V~aiG~P~g~~~~tvT~GIVSa~~r~~~~~~~~~~~~IQtDAaInpGnSGGPL 204 (539)
T 4fln_A 125 LLSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPA 204 (539)
T ss_dssp EEEECCSSSSTTCCCCCBCCCCCTTCEEEEEECCSSSCCCEEEEEEEEEEEEEECTTSCCEEEEEEESSCCCTTTTTSEE
T ss_pred EEEEeCCcCCcCCceeecCCcCcCCCeEEEEEcCCCCCCCcEEeEEECcccccccCCCCcceeEEEEEeEecCCCccchh
Confidence 99999876666778899998889999999999999887569999999999887665555566789999999999999999
Q ss_pred e-eCCEEEEEEeeecC--CCCceEEEEecchHHHHHHHHHHcCeeeeeeccCccccccccHHHHhhcCCCCccCceEEEe
Q 016641 271 I-MGNKVAGVAFQNLS--GAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTENVQLRNNFGMRSEVTGVLVNK 347 (385)
Q Consensus 271 ~-~~G~vVGI~s~~~~--~~~~~~~aip~~~i~~~l~~l~~~g~~~~~~~lGi~~~~~~~~~~~~~~g~~~~~~Gv~V~~ 347 (385)
+ .+|+||||+++... +..+++||||++.+++++++++++|++.+|+|||+.++++.++.+++.+|++. ..|++|.+
T Consensus 205 vn~~GeVIGIntai~~~~~~~gigfAIP~~~v~~vl~~l~~~G~~~~r~~LGv~~~~~~~~~~~~~~~l~~-~~Gv~V~~ 283 (539)
T 4fln_A 205 FNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLTDYERNGKYTGYPCLGVLLQKLENPALRECLKVPT-NEGVLVRR 283 (539)
T ss_dssp ECSSSCEEEEECCCC-----CCCEEEEEHHHHHHHHHHHHTTTSCCCCCBCCEEEEECCCHHHHHHHTCSS-SBCEEEEE
T ss_pred ccCCCcEEEEEEEEecCCCCCcceecccHHHHHHHHHHHHHcCeEEeeeecceEEEecCCHHHHHhcCCCC-cCceeeec
Confidence 9 99999999998654 45689999999999999999999999988999999999988899999999985 58999999
Q ss_pred eCCCCHHhhhcCCCCEEEEECCEEcCChhhH
Q 016641 348 INPLSDAHEILKKDDIILAFDGVPIANDGTG 378 (385)
Q Consensus 348 V~~~spA~~aL~~GDiI~~vng~~i~~~~~l 378 (385)
|.++|||+++||+||||+++||++|.+..++
T Consensus 284 V~~~spA~~al~~GDvI~~idg~~V~~~g~~ 314 (539)
T 4fln_A 284 VEPTSDASKVLKEGDVIVSFDDLHVGCEGTV 314 (539)
T ss_dssp ECTTSGGGGTCCTTCEEEEETTEECBSSSEE
T ss_pred ccCCChHHhCccCCCEEEEECCEEeCcCCee
Confidence 9999999988999999999999999887763
|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A | Back alignment and structure |
|---|
| >3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A | Back alignment and structure |
|---|
| >3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A | Back alignment and structure |
|---|
| >2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} | Back alignment and structure |
|---|
| >2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A | Back alignment and structure |
|---|
| >1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A | Back alignment and structure |
|---|
| >2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A | Back alignment and structure |
|---|
| >1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... | Back alignment and structure |
|---|
| >1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A | Back alignment and structure |
|---|
| >2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... | Back alignment and structure |
|---|
| >2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} | Back alignment and structure |
|---|
| >1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 | Back alignment and structure |
|---|
| >2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} | Back alignment and structure |
|---|
| >2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} | Back alignment and structure |
|---|
| >2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A | Back alignment and structure |
|---|
| >1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A | Back alignment and structure |
|---|
| >4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* | Back alignment and structure |
|---|
| >1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* | Back alignment and structure |
|---|
| >2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* | Back alignment and structure |
|---|
| >3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... | Back alignment and structure |
|---|
| >1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* | Back alignment and structure |
|---|
| >1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A | Back alignment and structure |
|---|
| >1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* | Back alignment and structure |
|---|
| >1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* | Back alignment and structure |
|---|
| >1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* | Back alignment and structure |
|---|
| >1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A | Back alignment and structure |
|---|
| >1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A | Back alignment and structure |
|---|
| >1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* | Back alignment and structure |
|---|
| >2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* | Back alignment and structure |
|---|
| >1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A | Back alignment and structure |
|---|
| >4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} | Back alignment and structure |
|---|
| >3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* | Back alignment and structure |
|---|
| >1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* | Back alignment and structure |
|---|
| >1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* | Back alignment and structure |
|---|
| >2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A | Back alignment and structure |
|---|
| >1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} | Back alignment and structure |
|---|
| >3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A | Back alignment and structure |
|---|
| >1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A | Back alignment and structure |
|---|
| >3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B | Back alignment and structure |
|---|
| >1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... | Back alignment and structure |
|---|
| >2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A | Back alignment and structure |
|---|
| >1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... | Back alignment and structure |
|---|
| >1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A | Back alignment and structure |
|---|
| >2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A | Back alignment and structure |
|---|
| >2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... | Back alignment and structure |
|---|
| >2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A | Back alignment and structure |
|---|
| >1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... | Back alignment and structure |
|---|
| >3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* | Back alignment and structure |
|---|
| >1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} | Back alignment and structure |
|---|
| >3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* | Back alignment and structure |
|---|
| >3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... | Back alignment and structure |
|---|
| >3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* | Back alignment and structure |
|---|
| >2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* | Back alignment and structure |
|---|
| >1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A | Back alignment and structure |
|---|
| >1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* | Back alignment and structure |
|---|
| >3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A | Back alignment and structure |
|---|
| >3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... | Back alignment and structure |
|---|
| >2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... | Back alignment and structure |
|---|
| >2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} | Back alignment and structure |
|---|
| >2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* | Back alignment and structure |
|---|
| >1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 | Back alignment and structure |
|---|
| >2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* | Back alignment and structure |
|---|
| >2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* | Back alignment and structure |
|---|
| >4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B | Back alignment and structure |
|---|
| >4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} | Back alignment and structure |
|---|
| >1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* | Back alignment and structure |
|---|
| >1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A | Back alignment and structure |
|---|
| >1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* | Back alignment and structure |
|---|
| >3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A | Back alignment and structure |
|---|
| >1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A | Back alignment and structure |
|---|
| >2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} | Back alignment and structure |
|---|
| >2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} | Back alignment and structure |
|---|
| >2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 | Back alignment and structure |
|---|
| >1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* | Back alignment and structure |
|---|
| >1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... | Back alignment and structure |
|---|
| >2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B | Back alignment and structure |
|---|
| >2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A | Back alignment and structure |
|---|
| >3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A | Back alignment and structure |
|---|
| >1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A | Back alignment and structure |
|---|
| >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A | Back alignment and structure |
|---|
| >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* | Back alignment and structure |
|---|
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A | Back alignment and structure |
|---|
| >1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A | Back alignment and structure |
|---|
| >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} | Back alignment and structure |
|---|
| >2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >3qzr_A 3C protein; chymotrypsin-fold, beta-ribbon, hydrolysis, nucleus, hydrola hydrolase inhibitor complex; HET: AG7; 1.04A {Human enterovirus 71} SCOP: b.47.1.0 PDB: 3osy_A 3qzq_A* 3r0f_A* 3sjo_A* 3sjk_A 3sji_A* 3sj8_A* 3sj9_A | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A | Back alignment and structure |
|---|
| >2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3q3y_A HEVB EV93 3C protease; cysteine trypsin-like protease, 3C cysteine protease (picorn antiviral compound 1 (AG7404); HET: XNV; 1.32A {Human enterovirus B} SCOP: b.47.1.4 PDB: 3q3x_A* 3ruo_A* 3zyd_A 3zz5_A* 3zz6_A* 3zz7_A* 3zz8_A* 3zz9_A* 3zza_A* 3zzb_A* 2ztx_A 2vb0_A 2zty_A 2ztz_A 2zu3_A* 3zye_A 3zz3_A 2zu1_A 3zz4_A 3zzc_A* ... | Back alignment and structure |
|---|
| >2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A | Back alignment and structure |
|---|
| >2b0f_A Picornain 3C (protease 3C) (P3C); beta barrel, hydrolase-hydrolase inhibitor complex; HET: CA1; NMR {Human rhinovirus 14} PDB: 2in2_A | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1cqq_A Type 2 rhinovirus 3C protease; viral protein, hydrolase; HET: AG7; 1.85A {Human rhinovirus 2} SCOP: b.47.1.4 PDB: 2xya_A* | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A | Back alignment and structure |
|---|
| >1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A | Back alignment and structure |
|---|
| >3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A | Back alignment and structure |
|---|
| >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dcd_A Protease 3C, genome polyprotein; antiviral inhibitors, dipeptidyl inhib hydrolase-hydrolase inhibitor complex; HET: K36; 1.69A {Human poliovirus 1} PDB: 1l1n_A | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hal_A Hepatitis A protease 3C; 3C protease, inhibitor design; HET: BBL; 1.35A {Hepatitis a virus} SCOP: b.47.1.4 PDB: 2h6m_A* 2h9h_A* 2cxv_A* 2a4o_A* 1hav_A 1qa7_A* | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A | Back alignment and structure |
|---|
| >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A | Back alignment and structure |
|---|
| >2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A | Back alignment and structure |
|---|
| >3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ijd_1 Picornain 3C, RNA-directed RNA polymerase; RNA-dependent RNA polymerase, picornavirus, protease, hydrolase, transferase; 3.40A {Human poliovirus 1} SCOP: b.47.1.4 e.8.1.4 | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >4ash_A NS6 protease; hydrolase, trypsin-like, calicivirus; 1.58A {Murine norovirus 1} | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A | Back alignment and structure |
|---|
| >2fyq_A Chymotrypsin-like cysteine proteinase; protease, norovirus, calicivirus, viral protein; 1.50A {Norwalk virus} PDB: 2fyr_A 2iph_A* 1wqs_A* | Back alignment and structure |
|---|
| >2hrv_A 2A cysteine proteinase; hydrolase (cysteine proteinase); 1.95A {Human rhinovirus 2} SCOP: b.47.1.4 | Back alignment and structure |
|---|
| >1vcp_A Semliki forest virus capsid protein; virus coat protein, polyprotein, transmembrane, glycoprotein, nucleocapsid protein, viral protein; 3.00A {Semliki forest virus} SCOP: b.47.1.3 PDB: 1dyl_A 1vcq_A | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} | Back alignment and structure |
|---|
| >4agk_A Capsid protein, coat protein, C; hydrolase, viral protein; 1.81A {Aura virus} PDB: 4agj_A 1kxa_A 2snw_A 1svp_A 1kxb_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A | Back alignment and structure |
|---|
| >1svp_A Sindbis virus capsid protein; chymotrypsin-like serine, mutant, coat protein, viral protein; 2.00A {Sindbis virus} SCOP: b.47.1.3 PDB: 1kxb_A 1kxa_A 2snw_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A | Back alignment and structure |
|---|
| >3e90_B NS3 protease; trypsin-like serine protease, protease inhibitor, catalytic histidine, induced FIT, ATP-binding, capsid protein, helicase; HET: NKK; 2.45A {West nile virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >3u1j_B Serine protease NS3; serine protease, ER MEM hydrolase-hydrolase inhibitor complex; 1.80A {Dengue virus 3} SCOP: b.47.1.3 PDB: 3u1i_B | Back alignment and structure |
|---|
| >2fom_B Polyprotein; flavivirus, NS3 protease, NS2B cofactor, viral protein-prote complex; 1.50A {Dengue virus 2} SCOP: b.47.1.3 PDB: 1df9_A 2qid_A 1bef_A | Back alignment and structure |
|---|
| >1ep5_B Capsid protein C, coat protein C; beta barrel, hydrolase; 2.30A {Venezuelan equine encephalitis virus} SCOP: b.47.1.3 PDB: 1ep6_A 3j0c_C | Back alignment and structure |
|---|
| >2ggv_B NS3, non-structural protein 3; beta barrel, serine protease, viral protease, flavivirus, hydrolase; 1.80A {West nile virus} PDB: 2ijo_B | Back alignment and structure |
|---|
| >2fp7_B Serine protease NS3; flavivirus, NS3 protease, NS2B cofactor; HET: OAR; 1.68A {West nile virus} SCOP: b.47.1.3 | Back alignment and structure |
|---|
| >3lkw_A Fusion protein of nonstructural protein 2B and nonstructural protein 3; viral protease, serine protease, NS3 protease, NS2B cofactor; 2.00A {Dengue virus 1} PDB: 3l6p_A | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A | Back alignment and structure |
|---|
| >1z8r_A Coxsackievirus B4 polyprotein; beta barrel coordinated zinc ION, hydrolase; NMR {Human coxsackievirus B4} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 385 | ||||
| d2z9ia2 | 221 | b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu | 2e-19 | |
| d1lcya2 | 205 | b.47.1.1 (A:6-210) Mitochondrial serine protease H | 4e-19 | |
| d2qf3a1 | 210 | b.47.1.1 (A:43-252) Stress sensor protease DegS, c | 2e-17 | |
| d1l1ja_ | 228 | b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic | 2e-17 | |
| d2bhga1 | 199 | b.47.1.4 (A:7-205) 3C cysteine protease (picornain | 7e-17 | |
| d2qaaa1 | 185 | b.47.1.1 (A:16-242) Protease B {Streptomyces grise | 2e-16 | |
| d1ky9a2 | 249 | b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata | 8e-16 | |
| d2sgaa_ | 181 | b.47.1.1 (A:) Protease A {Streptomyces griseus, st | 4e-14 | |
| d1agja_ | 242 | b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A | 2e-13 | |
| d2o8la1 | 216 | b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur | 2e-13 | |
| d1qtfa_ | 246 | b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus | 6e-13 | |
| d1lvmb_ | 219 | b.47.1.3 (B:) TEV protease (nucleat inclusion prot | 6e-11 | |
| d1hpga_ | 187 | b.47.1.1 (A:) Glutamic acid-specific protease {Str | 3e-10 | |
| d2h5ca1 | 198 | b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobac | 5e-10 | |
| d1p3ca_ | 215 | b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int | 1e-04 | |
| d1cqqa_ | 180 | b.47.1.4 (A:) 3C cysteine protease (picornain 3C) | 2e-04 |
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Prokaryotic proteases domain: Protease PepD species: Mycobacterium tuberculosis [TaxId: 1773]
Score = 84.3 bits (207), Expect = 2e-19
Identities = 54/230 (23%), Positives = 86/230 (37%), Gaps = 39/230 (16%)
Query: 107 AAIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVI-PGKKILTNAHVVADSTFV 165
+ SVV + T + ++ GSG ++ ILTN HV+A +
Sbjct: 5 QVAAKVVPSVVMLET------------DLGRQSEEGSGIILSAEGLILTNNHVIAAAAKP 52
Query: 166 LVRK--------HGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIPFLQQA 217
+ V D+A++ V+ + D+ Q
Sbjct: 53 PLGSPPPKTTVTFSDGRTAPFTVVGADPTSDIAVVRVQGVSGLTPISLGSSSDLRVGQPV 112
Query: 218 VAVVGYPQGGDNISVTKGVVSRVE-----PTQYVHGATQLMAIQIDAAINPGNSGGPAIM 272
+A+ G +VT G+VS + + + T L AIQ DAAINPGNSGG +
Sbjct: 113 LAI--GSPLGLEGTVTTGIVSALNRPVSTTGEAGNQNTVLDAIQTDAAINPGNSGGALVN 170
Query: 273 GN-KVAGVAFQNLS----------GAENIGYIIPVPVIKHFITGVVEHGK 311
N ++ GV + G+ +G+ IPV K ++ GK
Sbjct: 171 MNAQLVGVNSAIATLGADSADAQSGSIGLGFAIPVDQAKRIADELISTGK 220
|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 205 | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Length = 199 | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 185 | Back information, alignment and structure |
|---|
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 181 | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Length = 219 | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 | Back information, alignment and structure |
|---|
| >d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Length = 198 | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 | Back information, alignment and structure |
|---|
| >d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Length = 180 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 385 | |||
| d1ky9a2 | 249 | Protease Do (DegP, HtrA), catalytic domain {Escher | 100.0 | |
| d1l1ja_ | 228 | Protease Do (DegP, HtrA), catalytic domain {Thermo | 100.0 | |
| d2qf3a1 | 210 | Stress sensor protease DegS, catalytic domain {Esc | 99.97 | |
| d2z9ia2 | 221 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 99.97 | |
| d1lcya2 | 205 | Mitochondrial serine protease HtrA2, catalytic dom | 99.97 | |
| d1lvmb_ | 219 | TEV protease (nucleat inclusion protein A, NIA) {T | 99.85 | |
| d1agja_ | 242 | Epidermolytic (exfoliative) toxin A {Staphylococcu | 99.83 | |
| d2qaaa1 | 185 | Protease B {Streptomyces griseus, strain k1 [TaxId | 99.79 | |
| d2o8la1 | 216 | V8 protease {Staphylococcus aureus [TaxId: 1280]} | 99.73 | |
| d1qtfa_ | 246 | Exfoliative toxin B {Staphylococcus aureus [TaxId: | 99.68 | |
| d2bhga1 | 199 | 3C cysteine protease (picornain 3C) {Foot-and-mout | 99.63 | |
| d2sgaa_ | 181 | Protease A {Streptomyces griseus, strain k1 [TaxId | 99.62 | |
| d2h5ca1 | 198 | alpha-Lytic protease {Lysobacter enzymogenes, 495 | 99.61 | |
| d1hpga_ | 187 | Glutamic acid-specific protease {Streptomyces gris | 99.57 | |
| d1p3ca_ | 215 | Glutamyl endopeptidase {Bacillus intermedius [TaxI | 99.53 | |
| d1j16a_ | 223 | Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 | 99.52 | |
| d1hj8a_ | 222 | Trypsin(ogen) {North atlantic salmon (Salmo salar) | 99.5 | |
| d1lo6a_ | 221 | Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d1nn6a_ | 224 | Chymase (mast cell protease I) {Human (Homo sapien | 99.47 | |
| d1tona_ | 235 | Tonin {Rat (Rattus rattus) [TaxId: 10117]} | 99.46 | |
| d1eufa_ | 224 | Duodenase {Cow (Bos taurus) [TaxId: 9913]} | 99.46 | |
| d1t32a1 | 224 | Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d1fxya_ | 228 | Coagulation factor Xa-trypsin chimera {Synthetic, | 99.45 | |
| d1a7sa_ | 225 | Heparin binding protein, HBP {Human (Homo sapiens) | 99.45 | |
| d1npma_ | 225 | Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | 99.44 | |
| d1ao5a_ | 237 | Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] | 99.44 | |
| d1azza_ | 226 | Crab collagenase {Atlantic sand fiddler crab (Uca | 99.43 | |
| d1fi8a_ | 227 | Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] | 99.43 | |
| d1autc_ | 240 | Activated protein c (autoprothrombin IIa) {Human ( | 99.42 | |
| d1op0a_ | 234 | Venom serine protease {Hundred-pace snake (Agkistr | 99.42 | |
| d1gdna_ | 224 | Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 | 99.41 | |
| g2pka.1 | 232 | Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} | 99.4 | |
| d1ky9a1 | 94 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 99.4 | |
| d1fuja_ | 221 | Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 | 99.4 | |
| d3rp2a_ | 224 | Chymase II (mast cell proteinase II) {Rat (Rattus | 99.38 | |
| d2z7fe1 | 218 | Elastase {Human (Homo sapiens) [TaxId: 9606]} | 99.38 | |
| d1bioa_ | 228 | Factor D {Human (Homo sapiens) [TaxId: 9606]} | 99.36 | |
| g1gg6.1 | 238 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 99.36 | |
| d1rrka1 | 287 | Factor B {Human (Homo sapiens) [TaxId: 9606]} | 99.36 | |
| d1lcya1 | 100 | Mitochondrial serine protease HtrA2 {Human (Homo s | 99.35 | |
| d1hj9a_ | 223 | Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | 99.35 | |
| d1eq9a_ | 222 | (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So | 99.35 | |
| d1mzaa_ | 240 | Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | 99.34 | |
| d1orfa_ | 232 | Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | 99.34 | |
| d2hlca_ | 230 | HL collagenase {Common cattle grub (Hypoderma line | 99.33 | |
| d1sota1 | 99 | Stress sensor protease DegS, C-terminal domain {Es | 99.33 | |
| d1elva1 | 259 | Complement C1S protease, catalytic domain {Human ( | 99.32 | |
| d1sgfa_ | 228 | 7S NGF protease subunits {Mouse (Mus musculus) [Ta | 99.31 | |
| d1brup_ | 241 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 99.31 | |
| d2p3ub1 | 233 | Coagulation factor Xa, protease domain {Human (Hom | 99.3 | |
| g1h8d.1 | 289 | Thrombin {Human (Homo sapiens) [TaxId: 9606]} | 99.29 | |
| d1gvza_ | 237 | Prostate specific antigen (PSA kallikrein) {Horse | 99.29 | |
| d1fq3a_ | 227 | Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | 99.29 | |
| d1xx9a_ | 237 | Coagulation factor XI {Human (Homo sapiens) [TaxId | 99.28 | |
| d1elta_ | 236 | Elastase {Salmon (Salmo salar) [TaxId: 8030]} | 99.28 | |
| d2qy0b1 | 240 | Complement C1R protease, catalytic domain {Human ( | 99.27 | |
| d1z8ga1 | 255 | Hepsin, catalytic domain {Human (Homo sapiens) [Ta | 99.27 | |
| d1si5h_ | 234 | Hepatocyte growth factor, HGF {Human (Homo sapiens | 99.26 | |
| d1q3xa1 | 242 | Mannan-binding lectin serine protease 2 (MASP-2), | 99.26 | |
| d1pytd_ | 251 | (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) | 99.23 | |
| g1fiw.1 | 274 | Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} | 99.23 | |
| d1rfna_ | 235 | Coagulation factor IXa, protease domain {Human (Ho | 99.23 | |
| d1rjxb_ | 247 | Plasmin(ogen), catalytic domain {Human (Homo sapie | 99.22 | |
| d1eaxa_ | 241 | Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 | 99.22 | |
| d1cqqa_ | 180 | 3C cysteine protease (picornain 3C) {Human rhinovi | 99.21 | |
| d1fona_ | 232 | Procarboxypeptidase A-S6 subunit III (zymogen E) { | 99.2 | |
| d1gvkb_ | 240 | Elastase {Pig (Sus scrofa) [TaxId: 9823]} | 99.19 | |
| d1ekbb_ | 235 | Enteropeptidase (enterokinase light chain) {Cow (B | 99.19 | |
| d2f91a1 | 237 | Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus | 99.18 | |
| d2bz6h1 | 254 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 99.16 | |
| d2fpza1 | 243 | beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | 99.15 | |
| g1gj7.1 | 256 | Urokinase-type plasminogen activator (LMW U-PA), c | 99.12 | |
| d1os8a_ | 223 | Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 | 99.08 | |
| d1m9ua_ | 241 | Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | 99.05 | |
| g1rtf.1 | 260 | Two-chain tissue plasminogen activator (TC)-T-PA { | 99.04 | |
| d1arba_ | 263 | Achromobacter protease {Achromobacter lyticus, str | 99.04 | |
| d2z9ia1 | 88 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 98.99 | |
| d1ky9b2 | 88 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 98.78 | |
| d2hgaa1 | 103 | Uncharacterized protein MTH1368 {Methanobacterium | 98.74 | |
| d1w9ea1 | 85 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 98.49 | |
| d1fc6a3 | 92 | Photosystem II D1 C-terminal processing protease { | 98.43 | |
| d1l1na_ | 180 | 3C cysteine protease (picornain 3C) {Human poliovi | 98.39 | |
| d2i6va1 | 87 | General secretion pathway protein C, EpsC {Vibrio | 98.37 | |
| d2f5ya1 | 77 | Regulator of G-protein signaling 3, RGS3 {Human (H | 98.34 | |
| d1k32a1 | 91 | Tricorn protease {Archaeon Thermoplasma acidophilu | 98.31 | |
| d1ozia_ | 99 | Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 | 98.26 | |
| d1vaea_ | 111 | Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | 98.23 | |
| d1x5qa1 | 97 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 98.19 | |
| d1rgwa_ | 85 | Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax | 98.17 | |
| d1qaua_ | 112 | Neuronal nitric oxide synthase, NNOS {Rat (Rattus | 98.17 | |
| d1t2ma1 | 92 | Afadin {Human (Homo sapiens) [TaxId: 9606]} | 98.17 | |
| d1q3oa_ | 104 | Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId | 98.17 | |
| d1wi2a_ | 104 | PDZ domain containing protein 11, Pdzk11 {Mouse (M | 98.15 | |
| d1g9oa_ | 91 | Na+/H+ exchanger regulatory factor, NHERF {Human ( | 98.13 | |
| d1kwaa_ | 88 | Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.12 | |
| d1ueza_ | 101 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 98.12 | |
| d2h3la1 | 103 | Erbin {Human (Homo sapiens) [TaxId: 9606]} | 98.11 | |
| d1m5za_ | 91 | Glutamate receptor interacting protein {Rat (Rattu | 98.1 | |
| d2fcfa1 | 96 | Multiple PDZ domain protein {Human (Homo sapiens) | 98.09 | |
| d1y7na1 | 79 | Amyloid beta A4 precursor protein-binding family A | 98.08 | |
| d1va8a1 | 100 | Maguk p55 subfamily member 5 {Mouse (Mus musculus) | 98.07 | |
| d1rgra_ | 93 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 98.05 | |
| d1vb7a_ | 94 | PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta | 98.04 | |
| d1rzxa_ | 98 | GTPase-binding domain of the cell polarity protein | 98.03 | |
| d1uf1a_ | 128 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 98.02 | |
| d2fe5a1 | 92 | Synapse-associated protein 102 {Human (Homo sapien | 98.02 | |
| d1ihja_ | 94 | Inad {Fruit fly (Drosophila melanogaster) [TaxId: | 98.01 | |
| d1uhpa_ | 107 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 98.01 | |
| d1x5na1 | 101 | Harmonin {Human (Homo sapiens) [TaxId: 9606]} | 98.0 | |
| d1uita_ | 117 | Discs large 5 protein KIAA0583 {Human (Homo sapien | 98.0 | |
| d1tp5a1 | 102 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 97.99 | |
| d1um1a_ | 110 | Hypothetical protein KIAA1849 {Human (Homo sapiens | 97.98 | |
| d1p1da2 | 99 | Glutamate receptor interacting protein {Rat (Rattu | 97.95 | |
| d1wh1a_ | 124 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 97.94 | |
| d1wf8a1 | 94 | Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | 97.94 | |
| d2fnea1 | 88 | Multiple PDZ domain protein {Human (Homo sapiens) | 97.91 | |
| d1uewa_ | 114 | Membrane associated guanylate kinase inverted-2 (M | 97.91 | |
| d1x45a1 | 85 | Amyloid beta A4 precursor protein-binding family A | 97.9 | |
| d1whaa_ | 105 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 97.9 | |
| d1v62a_ | 117 | Glutamate receptor interacting protein 2, GRIP2 (K | 97.89 | |
| d1ujda_ | 117 | Hypothetical protein KIAA0559 {Human (Homo sapiens | 97.87 | |
| d2csja1 | 104 | Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc | 97.86 | |
| d1n7ea_ | 95 | Glutamate receptor-interacting protein 1, GRIP1 {R | 97.86 | |
| d2f0aa1 | 92 | Segment polarity protein dishevelled homolog Dvl-2 | 97.85 | |
| d1x6da1 | 107 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 97.85 | |
| d1wi4a1 | 96 | Syntaxin binding protein 4 {Mouse (Mus musculus) [ | 97.84 | |
| d1qava_ | 90 | Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | 97.82 | |
| d1r6ja_ | 82 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 97.81 | |
| d2cssa1 | 108 | Regulating synaptic membrane exocytosis protein 1, | 97.8 | |
| d1ujua_ | 111 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 97.79 | |
| d1ufxa_ | 103 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 97.78 | |
| d1uepa_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 97.77 | |
| d1wf7a_ | 103 | Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 | 97.76 | |
| d1v5la_ | 103 | Alpha-actinin-2 associated LIM protein {Mouse (Mus | 97.74 | |
| d1wifa_ | 126 | hypothetical PDZ domain containing protein Uqcrc2 | 97.74 | |
| d1ueqa_ | 123 | Membrane associated guanylate kinase inverted-2 (M | 97.73 | |
| d1mbma_ | 198 | NSP4 proteinase {Equine arteritis virus, EAV [TaxI | 97.71 | |
| d1v6ba_ | 118 | Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | 97.7 | |
| d1v5qa_ | 122 | Glutamate receptor interacting protein {Mouse (Mus | 97.67 | |
| d1wfva_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 97.61 | |
| d2h6ma1 | 212 | 3C cysteine protease (picornain 3C) {Human hepatit | 97.59 | |
| d1wg6a_ | 127 | Partitioning-defective 3-like protein, PAR3-L (RIK | 97.58 | |
| d1x5ra1 | 99 | Glutamate receptor interacting protein 2, GRIP2 (K | 97.58 | |
| d2cs5a1 | 106 | Tyrosine-protein phosphatase non-receptor type 4, | 97.56 | |
| d1i16a_ | 130 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 97.46 | |
| d1ujva_ | 96 | Membrane associated guanylate kinase inverted-2 (M | 95.32 | |
| d2fomb1 | 150 | NS3 protease {Dengue virus type 2 [TaxId: 11060]} | 90.68 | |
| d2fp7b1 | 152 | NS3 protease {West nile virus [TaxId: 11082]} | 89.58 | |
| d1ep5a_ | 156 | Viral capsid protein {Venezuelan equine encephalit | 88.31 | |
| d1wyka_ | 152 | Viral capsid protein {Sindbis virus [TaxId: 11034] | 87.76 | |
| d1vcpa_ | 149 | Viral capsid protein {Semliki forest virus [TaxId: | 87.29 |
| >d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Trypsin-like serine proteases superfamily: Trypsin-like serine proteases family: Prokaryotic proteases domain: Protease Do (DegP, HtrA), catalytic domain species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=1.7e-34 Score=266.38 Aligned_cols=202 Identities=26% Similarity=0.414 Sum_probs=162.4
Q ss_pred cHHHHHHHhCCCeEEEEeeecCC-------C---CCC-----------C-----C----------CCCCCCcceEEEEEe
Q 016641 104 NAYAAIELALDSVVKIFTVSSSP-------N---YGL-----------P-----W----------QNKSQRETTGSGFVI 147 (385)
Q Consensus 104 ~~~~~~~~~~~SVV~I~~~~~~~-------~---~~~-----------p-----~----------~~~~~~~~~GSGfiI 147 (385)
++.++++++.||||.|.+..... . +++ | + .......+.||||+|
T Consensus 4 s~a~~ve~v~PaVV~I~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~GSG~iI 83 (249)
T d1ky9a2 4 SLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVII 83 (249)
T ss_dssp CSHHHHHHHGGGEEEEEEEEEEEECCCCSSCCTTCCCC---------------------------CEEEEEEEEEEEEEE
T ss_pred ChHHHHHHhCCceEEEEEEEEEeecCCcCcchhhhccccCCcccccccccccccccccccccccccccccccccccEEEE
Confidence 56789999999999998743210 0 000 0 0 000112357999999
Q ss_pred c-C-CEEEecccccCCCceEEEEEcCCCcEEEEEEEEecCCCCeEEEEecCCcccccceeeecCCcc--cCCCeEEEEec
Q 016641 148 P-G-KKILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIP--FLQQAVAVVGY 223 (385)
Q Consensus 148 ~-~-g~ILT~aHvv~~~~~i~V~~~~~g~~~~a~v~~~d~~~DlAlLkv~~~~~~~~~~~l~l~~~~--~~G~~V~~iG~ 223 (385)
+ + ||||||+|||+++..+.|.+. +++.+.++++..|+.+|+|+|+++... .+++++|+++. ++||+|+++||
T Consensus 84 ~~~~g~IlTn~HVv~~~~~~~v~~~-~~~~~~a~~~~~d~~~dlavl~i~~~~---~~~~~~l~~~~~~~~G~~v~aiG~ 159 (249)
T d1ky9a2 84 DADKGYVVTNNHVVDNATVIKVQLS-DGRKFDAKMVGKDPRSDIALIQIQNPK---NLTAIKMADSDALRVGDYTVAIGN 159 (249)
T ss_dssp ETTTTEEEEEHHHHTTEEEEEEEET-TSCEEEEEEEEEETTTTEEEEEESSCC---SCCCCCBCCGGGCCTTCEEEEEEC
T ss_pred eccCceEEeeccccccceeeeeeec-ccccccceeeEeccchhhceeeecccc---cceEEEcCCcCcCCcCCEEEEEec
Confidence 7 4 899999999999999999987 899999999999999999999998754 58899999765 56999999999
Q ss_pred CCCCCCceEEEeeEeecccccccCCCceeeEEEecccCCCCCCCccee-eCCEEEEEEeeecC---CCCceEEEEecchH
Q 016641 224 PQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAI-MGNKVAGVAFQNLS---GAENIGYIIPVPVI 299 (385)
Q Consensus 224 p~~~~~~~~~~G~Vs~~~~~~~~~~~~~~~~i~~d~~i~~G~SGGPL~-~~G~vVGI~s~~~~---~~~~~~~aip~~~i 299 (385)
|++.. .+++.++++...+.... ......+||+|+.+++|||||||+ .+|+||||+++... +..+++||||++.+
T Consensus 160 P~g~~-~tvt~~~~~~~~~~~~~-~~~~~~~iqtda~i~~GnSGGPl~n~~G~vIGI~t~~~~~~~~~~gi~faIP~~~~ 237 (249)
T d1ky9a2 160 PFGLG-ETVTSGIVSALGRSGLN-AENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMV 237 (249)
T ss_dssp TTSSS-CEEEEEEEEEESSCC------CCCCEEESCCCTTSCCCSEEECTTSCEEEEEECSSTTSCCCSSSEEEEEHHHH
T ss_pred ccccC-Cceeecceeeccccccc-CccccceEEEeeeecCCCCCceEECCCCEEEEEEEEEeccCCCcccEEEEEEHHHH
Confidence 99987 59999999887664322 223345799999999999999999 99999999998765 34578999999999
Q ss_pred HHHHHHHHHcCe
Q 016641 300 KHFITGVVEHGK 311 (385)
Q Consensus 300 ~~~l~~l~~~g~ 311 (385)
++++++|+++|+
T Consensus 238 ~~~~~~l~~~G~ 249 (249)
T d1ky9a2 238 KNLTSQMVEYGQ 249 (249)
T ss_dssp HHHHHHHHHHSS
T ss_pred HHHHHHHHHhCc
Confidence 999999998875
|
| >d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} | Back information, alignment and structure |
|---|
| >d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} | Back information, alignment and structure |
|---|
| >d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} | Back information, alignment and structure |
|---|
| >d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} | Back information, alignment and structure |
|---|
| >d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} | Back information, alignment and structure |
|---|
| >d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} | Back information, alignment and structure |
|---|
| >d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} | Back information, alignment and structure |
|---|
| >d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} | Back information, alignment and structure |
|---|
| >d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} | Back information, alignment and structure |
|---|
| >d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} | Back information, alignment and structure |
|---|
| >d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} | Back information, alignment and structure |
|---|
| >d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} | Back information, alignment and structure |
|---|
| >d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mbma_ b.47.1.3 (A:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]} | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fomb1 b.47.1.3 (B:18-167) NS3 protease {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West nile virus [TaxId: 11082]} | Back information, alignment and structure |
|---|
| >d1ep5a_ b.47.1.3 (A:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]} | Back information, alignment and structure |
|---|
| >d1wyka_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]} | Back information, alignment and structure |
|---|
| >d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus [TaxId: 11033]} | Back information, alignment and structure |
|---|