Citrus Sinensis ID: 016644

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-----

MAPKGNDVIVSDRKLEMILSMKGGNGEASYANNSQAQAIHAQSMLHLLRETLDNIQLMEPPSETIPFALADLGCSCGNNTLYIVDVIIKHISKRYEASGYEPPEFSAFFSDLPSNDFNTLFQLLPPIGSSMEECLASDTHRSYFAAGVPGSFYRRLFPTRSIDFFHSAFSLHWLSQVPESALDKRSMAYNKGKVYIHGANEHTANAYKKQFQTDLAAFLGARSKEMKRCGSMFLVCLGRTSADPTDQGGPGILFGTHFQDAWNDLVQEGLITGEKRDSFNIPVYASSLQEFKEVVEANGSFVINKLEVFKGGSPLVVKQPDDAAEVGQALANSCRSVAGVLVDAHIGDQLSEELFKRVERRGSCYAKELIEQLQFFHIVASLSFA

ccccccccccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEECcccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHcccccccHHHHHcccccccEEEEcccccccccccccccccEEEcccccccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHcccEEEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEcc

***********DRKLEMILSMKGGNGEASYANNSQAQAIHAQSMLHLLRETLDNIQLMEPPSETIPFALADLGCSCGNNTLYIVDVIIKHISKRYEASGYEPPEFSAFFSDLPSNDFNTLFQLLPPIGSSMEECLASDTHRSYFAAGVPGSFYRRLFPTRSIDFFHSAFSLHWLSQVPESALDKRSMAYNKGKVYIHGANEHTANAYKKQFQTDLAAFLGARSKEMKRCGSMFLVCLGRTSADPTDQGGPGILFGTHFQDAWNDLVQEGLITGEKRDSFNIPVYASSLQEFKEVVEANGSFVINKLEVFKGGSPLVVKQPDDAAEVGQALANSCRSVAGVLVDAHIGDQLSEELFKRVERRGSCYAKELIEQLQFFHIVASLSFA

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Indole-3-acetate O-methyltransferase 1	Catalyzes the methylation of the free carboxyl end of the plant hormone indole-3-acetic acid (IAA). Converts IAA to IAA methyl ester (MeIAA). Regulates IAA activities by IAA methylation. Methylation of IAA plays an important role in regulating plant development and auxin homeostasis. Required for correct leaf pattern formation. MeIAA seems to be an inactive form of IAA.	confident	Q9FLN8
Indole-3-acetate O-methyltransferase 1	Catalyzes the methylation of the free carboxyl end of the plant hormone indole-3-acetic acid (IAA). Converts IAA to IAA methyl ester (MeIAA). Regulates IAA activities by IAA methylation. Methylation of IAA plays an important role in regulating plant development and auxin homeostasis. MeIAA seems to be an inactive form of IAA.	probable	Q0J998

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B5I, chain A
Confidence level:very confident
Coverage over the Query: 38-383
View the alignment between query and template
View the model in PyMOL