Citrus Sinensis ID: 016680

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380----

MPRSRGLEMPQRQSPRRPHQLRTSSSDSDPPHHRPIADRSPKIGDRRSPRGAPHSDPINQKKLGTRIADLESQLGQAQEELKNLKDQLASAEAAKKEAQEKLEKKTKKPEVPGTVEVVEQHSLPEIQESETTKNDPKDEVAEENQPETDVFEMSVEKSTVEPEVEFSQQTFKEEKETKSINVSTEPPAEPEPEKVSIHELTLTKDEINLLQNKLDEKEKQLEGMAQENKSLKKQLNEASSNISTAQKEKEEMTQSLNKLGEEVQASKAEAIQLKEKLEAAEGAKKALEMEMKKLRVQTDQWKKAADAAASILAGGVEMNGRIPERCGSMDKHFGGVFEPLTGSYAGFVGSPGMADDLDGGFASGKRKGSGIKMFGDLWKKKGHK

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccccHHHHHHHccccccHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcHHcccccccccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccc

******************************************************************************************************************************************************************************************************************************************************************************************************************AAASILAGGVE*N*****RCGS***HFGGVFEP**************************************WKK****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MPRSRGLEMPQRQSPRRPHQLRTSSSDSDPPHHRPIADRSPKIGDRRSPRGAPHSDPINxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPEVPGTVEVVEQHSLPEIQESETTKNDPKDEVAEENQPETDVFEMSVEKSTVEPEVEFSQQTFKEEKETKSINVSTEPPAEPEPEKVSIHExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxADAAASILAGGVEMNGRIPERCGSMDKHFGGVFEPLTGSYAGFVGSPGMADDLDGGFASGKRKGSGIKMFGDLWKKKGHK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Interactor of constitutive active ROPs 4	Acts as a scaffold, mediating interaction of ROPs with different proteins.	probable	Q9M9F9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 196-279
View the alignment between query and template
View the model in PyMOL

Template: 2FXO, chain A
Confidence level:probable
Coverage over the Query: 197-305
View the alignment between query and template
View the model in PyMOL

Template: 2DFS, chain A
Confidence level:probable
Coverage over the Query: 137-178,198-297
View the alignment between query and template
View the model in PyMOL