Citrus Sinensis ID: 016682


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380----
MAEQHVSLKRVQVAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSHSPYKMSSSDCNGFFNELQKLGFDKAAAVAAEAAEKIDTAK
cccccccccHHHcccccHHHHHHcHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccEEEEEccccHHHHHHHHccccEEEEccccHcccccccccccccHHHHHHHHHHHHHcccccEEEECcccccccccHHHHHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHcccccEEEEccccccccEEHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccc
************VAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNI*********************HLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSHSPYKMSSSDCNGFFNELQKLGFDKA***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEQHVSLKRVQVAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSHSPYKMSSSDCNGFFNELQKLGFDKAAAVAAEAAEKIDTAK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
3-methyl-2-oxobutanoate hydroxymethyltransferase Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is tranferred onto alpha-ketoisovalerate to form ketopantoate.probableB0TC10
3-methyl-2-oxobutanoate hydroxymethyltransferase Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is tranferred onto alpha-ketoisovalerate to form ketopantoate.probableQ2RM79
3-methyl-2-oxobutanoate hydroxymethyltransferase Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is tranferred onto alpha-ketoisovalerate to form ketopantoate.probableQ311U7

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.2.-Hydroxymethyl-, formyl- and related transferases.probable
2.1.2.113-methyl-2-oxobutanoate hydroxymethyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OY0, chain A
Confidence level:very confident
Coverage over the Query: 76-219,234-344
View the alignment between query and template
View the model in PyMOL
Template: 2NWR, chain A
Confidence level:probable
Coverage over the Query: 13-44,57-260
View the alignment between query and template
View the model in PyMOL