Citrus Sinensis ID: 016682

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380----
MAEQHVSLKRVQVAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSHSPYKMSSSDCNGFFNELQKLGFDKAAAVAAEAAEKIDTAK
cccccccccHHHccccHHHHHHHcHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccEEEEEccccHHHHHHHHccccEEEEcccHHcccccccccccccHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHcccccEEEEccccccccEEHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccc
cccHccccEEEEEccccHHHcccccEEHHHHcccHHHccccccHHHHcccccccEEEcccccccccccccccccccccccHHHHHHHHHccccEEEEEEcccHHHHHHHHccccEEEEEcccHHHEEcccccccccHHHHHHHHHHHHHcccccEEEEccccccccccHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHccccEEEEEccccccHHHccccEEccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHccccEEEEccccccccEEEEEEcHcccccccccccccHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccc
MAEQHVSLKRvqvaqpkhlfkQTQLLVTLTQHYSRILnnsnmsfsrinrarPLLVRCmsnipensvyggpkpqnpnqrVTLTHLRqkhkngepitmvtaydypsavhldsagidiclvgdsaamvvhghdttlpITLEEMLVHCRAVargakrpllvgdlpfgtyesstnQAVDTAVRILKEGGmdaikleggspsriTAARGIVEAGIAVMGHVGLTPQAisvlggfrpqgknvTSAVKVVETALALQEVGCFSVvlecvpppvaAAATsalqiptigigagpfcsgqVLVYHDllgmmqhphhakvtpKFCKQFARVGDVINKALLEYKeevtngsfpgpshspykmsssdcnGFFNELQKLGFDKAAAVAAEAAEKIDTAK
maeqhvslkrvqvaqpkhlfkQTQLLVTLTQHYSRIlnnsnmsfsRINRARPLLVRCMSNIPensvyggpkpqNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFgtyesstnqaVDTAVRILKEGGMdaikleggspsrITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSHSPYKMSSSDCNGFFNELQKLGFDKAAAVAAEAAEKIDTAK
MAEQHVSLKRVQVAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECvpppvaaaaTSALQIPTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSHSPYKMSSSDCNGFFNELQKLGFDKaaavaaeaaeKIDTAK
************VAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNI*******************************PITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEE*********************NGFFNELQKLGFDKA***************
************VAQ**HLF***QLLVTLTQHYS************************************************HLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSHSPYKMSSSDCNGFF**************************
*********RVQVAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSHSPYKMSSSDCNGFFNELQKLGFDKAAAVAAEAAEKIDTAK
*****VSLKRVQVAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNIPENSVY*GP*PQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSHSPYKMSSSDCNGFFNELQKLGFDKAAAVAA**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEQHVSLKRVQVAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSHSPYKMSSSDCNGFFNELQKLGFDKAAAVAAEAAEKIDTAK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query384 2.2.26 [Sep-21-2011]
B0TC10276 3-methyl-2-oxobutanoate h yes no 0.684 0.952 0.505 1e-73
Q3A9L0276 3-methyl-2-oxobutanoate h yes no 0.682 0.949 0.488 7e-72
Q9Y7B6349 3-methyl-2-oxobutanoate h yes no 0.755 0.830 0.471 2e-70
Q2RM79269 3-methyl-2-oxobutanoate h yes no 0.682 0.973 0.518 2e-70
A0PXQ3275 3-methyl-2-oxobutanoate h yes no 0.692 0.967 0.483 8e-70
A1VBJ4307 3-methyl-2-oxobutanoate h yes no 0.710 0.889 0.464 3e-69
Q729A6307 3-methyl-2-oxobutanoate h yes no 0.710 0.889 0.464 3e-69
Q2LTJ5272 3-methyl-2-oxobutanoate h yes no 0.695 0.981 0.487 3e-69
A0LLW3282 3-methyl-2-oxobutanoate h yes no 0.651 0.886 0.515 5e-69
Q5YZ95283 3-methyl-2-oxobutanoate h yes no 0.716 0.971 0.485 5e-69
>sp|B0TC10|PANB_HELMI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=panB PE=3 SV=1 Back     alignment and function desciption
 Score =  276 bits (707), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 136/269 (50%), Positives = 188/269 (69%), Gaps = 6/269 (2%)

Query: 77  QRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPIT 136
           +++TL   ++  K G+ + M+TAYDYP A  +D + I+I LVGDS  MVV G+D+T+P+T
Sbjct: 3   KKITLPQCKEMKKQGKRLRMITAYDYPFARLVDESEIEIILVGDSLGMVVLGYDSTVPVT 62

Query: 137 LEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPS 196
           L+EM+ HC+ V RGA   L+V D+PFG+Y  S   A+  A R+LKE G++A+K+EGG+  
Sbjct: 63  LDEMIHHCKPVVRGAPNTLVVADMPFGSYNVSKEDAIRNANRMLKESGIEAVKVEGGTRM 122

Query: 197 RITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSV 256
             T  R +V+AGI VMGH+GLTPQ  + LGGF+ QGK   +A +++E ALAL+  G FS+
Sbjct: 123 APT-VRALVDAGIPVMGHIGLTPQTAAQLGGFKVQGKTEDAAQQLLEDALALESAGAFSI 181

Query: 257 VLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQF 316
           V+ECVP  +A   T++L IPTIGIGAGP+C+GQVLV  DLLG+     + +  PKF KQ+
Sbjct: 182 VIECVPAGLARTITASLSIPTIGIGAGPYCNGQVLVIQDLLGI-----YDRFVPKFVKQY 236

Query: 317 ARVGDVINKALLEYKEEVTNGSFPGPSHS 345
           A+ G  I  AL +Y  EV +G FPGP HS
Sbjct: 237 AQTGPAIRAALNDYAREVADGVFPGPEHS 265
Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is tranferred onto alpha-ketoisovalerate to form ketopantoate.
Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) (taxid: 498761)
EC: 2EC: .EC: 1EC: .EC: 2EC: .EC: 1EC: 1
>sp|Q3A9L0|PANB_CARHZ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008) GN=panB PE=3 SV=1 Back     alignment and function description
>sp|Q9Y7B6|PANB_EMENI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=panB PE=3 SV=1 Back     alignment and function description
>sp|Q2RM79|PANB_MOOTA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=panB PE=3 SV=1 Back     alignment and function description
>sp|A0PXQ3|PANB_CLONN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium novyi (strain NT) GN=panB PE=3 SV=1 Back     alignment and function description
>sp|A1VBJ4|PANB_DESVV 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=panB PE=3 SV=1 Back     alignment and function description
>sp|Q729A6|PANB_DESVH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=panB PE=3 SV=1 Back     alignment and function description
>sp|Q2LTJ5|PANB_SYNAS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Syntrophus aciditrophicus (strain SB) GN=panB PE=3 SV=2 Back     alignment and function description
>sp|A0LLW3|PANB_SYNFM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=panB PE=3 SV=1 Back     alignment and function description
>sp|Q5YZ95|PANB_NOCFA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=panB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query384
15233139354 Phosphoenolpyruvate carboxylase family p 0.875 0.949 0.866 1e-168
297821010353 hypothetical protein ARALYDRAFT_486638 [ 0.880 0.957 0.855 1e-168
15225928347 ketopantoate hydroxymethyltransferase 1 0.880 0.974 0.838 1e-166
225454302363 PREDICTED: 3-methyl-2-oxobutanoate hydro 0.859 0.909 0.863 1e-166
224130402360 ketopantoate hydroxymethyltransferase [P 0.848 0.905 0.883 1e-163
255541718362 3-methyl-2-oxobutanoate hydroxymethyltra 0.859 0.911 0.872 1e-163
297828337346 KPHMT1/PANB1 [Arabidopsis lyrata subsp. 0.875 0.971 0.800 1e-159
356522560358 PREDICTED: 3-methyl-2-oxobutanoate hydro 0.901 0.966 0.799 1e-159
449443772347 PREDICTED: 3-methyl-2-oxobutanoate hydro 0.851 0.942 0.827 1e-157
357504415351 3-methyl-2-oxobutanoate hydroxymethyltra 0.846 0.925 0.844 1e-156
>gi|15233139|ref|NP_191712.1| Phosphoenolpyruvate carboxylase family protein [Arabidopsis thaliana] gi|42572757|ref|NP_974474.1| Phosphoenolpyruvate carboxylase family protein [Arabidopsis thaliana] gi|6850844|emb|CAB71083.1| 3-methyl-2-oxobutanoate hydroxy-methyl-transferase-like protein [Arabidopsis thaliana] gi|21593121|gb|AAM65070.1| 3-methyl-2-oxobutanoate hydroxy-methyl-transferase-like protein [Arabidopsis thaliana] gi|94442441|gb|ABF19008.1| At3g61530 [Arabidopsis thaliana] gi|332646697|gb|AEE80218.1| Phosphoenolpyruvate carboxylase family protein [Arabidopsis thaliana] gi|332646698|gb|AEE80219.1| Phosphoenolpyruvate carboxylase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  598 bits (1543), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 292/337 (86%), Positives = 316/337 (93%), Gaps = 1/337 (0%)

Query: 45  SRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPS 104
           SR +RA    VR MSN+PE++VYGGPKPQN NQRVTLT LRQKH+ GEPITMVTAYDYPS
Sbjct: 11  SRASRAI-TTVRFMSNVPEDTVYGGPKPQNSNQRVTLTQLRQKHRKGEPITMVTAYDYPS 69

Query: 105 AVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGT 164
           AVH+D+AGID+CLVGDSAAMVVHG+DTTLPI+LEEMLVHCRAVARGAKRPLLVGDLPFGT
Sbjct: 70  AVHIDTAGIDVCLVGDSAAMVVHGYDTTLPISLEEMLVHCRAVARGAKRPLLVGDLPFGT 129

Query: 165 YESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISV 224
           YESSTNQAVDTAVR+LKEGGMDAIKLEGGSPSRITAA+ IVEAGIAVMGHVGLTPQAISV
Sbjct: 130 YESSTNQAVDTAVRVLKEGGMDAIKLEGGSPSRITAAKSIVEAGIAVMGHVGLTPQAISV 189

Query: 225 LGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGP 284
           LGGFRPQGKN+ SAVKVVETA+ALQE GCFSVVLECVPPPVAAAATSAL IPTIGIGAGP
Sbjct: 190 LGGFRPQGKNIASAVKVVETAMALQEAGCFSVVLECVPPPVAAAATSALNIPTIGIGAGP 249

Query: 285 FCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSH 344
           FCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQ+A+VG+VINKALLEYKEEV+   FPGPSH
Sbjct: 250 FCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQYAQVGEVINKALLEYKEEVSKHLFPGPSH 309

Query: 345 SPYKMSSSDCNGFFNELQKLGFDKAAAVAAEAAEKID 381
           SPYK+SSSD +GF +ELQKLG DKAA+ AA +AEK+D
Sbjct: 310 SPYKISSSDLDGFLSELQKLGLDKAASDAAASAEKMD 346

Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297821010|ref|XP_002878388.1| hypothetical protein ARALYDRAFT_486638 [Arabidopsis lyrata subsp. lyrata] gi|297324226|gb|EFH54647.1| hypothetical protein ARALYDRAFT_486638 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15225928|ref|NP_182135.1| ketopantoate hydroxymethyltransferase 1 [Arabidopsis thaliana] gi|3702336|gb|AAC62893.1| 3-methyl-2-oxobutanoate hydroxy-methyl-transferase [Arabidopsis thaliana] gi|28466955|gb|AAO44086.1| At2g46110 [Arabidopsis thaliana] gi|110735692|dbj|BAE99826.1| 3-methyl-2-oxobutanoate hydroxy-methyl-transferase [Arabidopsis thaliana] gi|330255551|gb|AEC10645.1| ketopantoate hydroxymethyltransferase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225454302|ref|XP_002276965.1| PREDICTED: 3-methyl-2-oxobutanoate hydroxymethyltransferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|224130402|ref|XP_002320828.1| ketopantoate hydroxymethyltransferase [Populus trichocarpa] gi|222861601|gb|EEE99143.1| ketopantoate hydroxymethyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255541718|ref|XP_002511923.1| 3-methyl-2-oxobutanoate hydroxymethyltransferase, putative [Ricinus communis] gi|223549103|gb|EEF50592.1| 3-methyl-2-oxobutanoate hydroxymethyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297828337|ref|XP_002882051.1| KPHMT1/PANB1 [Arabidopsis lyrata subsp. lyrata] gi|297327890|gb|EFH58310.1| KPHMT1/PANB1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356522560|ref|XP_003529914.1| PREDICTED: 3-methyl-2-oxobutanoate hydroxymethyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|449443772|ref|XP_004139651.1| PREDICTED: 3-methyl-2-oxobutanoate hydroxymethyltransferase-like [Cucumis sativus] gi|449475405|ref|XP_004154444.1| PREDICTED: 3-methyl-2-oxobutanoate hydroxymethyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357504415|ref|XP_003622496.1| 3-methyl-2-oxobutanoate hydroxymethyltransferase [Medicago truncatula] gi|355497511|gb|AES78714.1| 3-methyl-2-oxobutanoate hydroxymethyltransferase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query384
TAIR|locus:2082847354 PANB2 [Arabidopsis thaliana (t 0.875 0.949 0.821 1.2e-147
TAIR|locus:2062969347 KPHMT1 "ketopantoate hydroxyme 0.880 0.974 0.791 5.7e-146
DICTYBASE|DDB_G0286637 833 DDB_G0286637 "3-methyl-2-oxobu 0.726 0.334 0.472 7.6e-72
TIGR_CMR|CHY_2377276 CHY_2377 "3-methyl-2-oxobutano 0.682 0.949 0.477 1.4e-64
ASPGD|ASPL0000048463349 pantoB [Emericella nidulans (t 0.833 0.916 0.432 6e-64
UNIPROTKB|G4NB94373 MGG_00599 "3-methyl-2-oxobutan 0.75 0.772 0.472 1.1e-62
TIGR_CMR|GSU_1705267 GSU_1705 "3-methyl-2-oxobutano 0.687 0.988 0.455 6.6e-58
UNIPROTKB|P0A5Q8281 panB "3-methyl-2-oxobutanoate 0.716 0.978 0.437 1.1e-57
TIGR_CMR|DET_0803282 DET_0803 "3-methyl-2-oxobutano 0.669 0.911 0.460 2.2e-57
CGD|CAL0005148309 orf19.6057 [Candida albicans ( 0.729 0.906 0.426 2.9e-55
TAIR|locus:2082847 PANB2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1442 (512.7 bits), Expect = 1.2e-147, P = 1.2e-147
 Identities = 277/337 (82%), Positives = 299/337 (88%)

Query:    45 SRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPS 104
             SR +RA    VR MSN+PE++VYGGPKPQN NQRVTLT LRQKH+ GEPITMVTAYDYPS
Sbjct:    11 SRASRAITT-VRFMSNVPEDTVYGGPKPQNSNQRVTLTQLRQKHRKGEPITMVTAYDYPS 69

Query:   105 AVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGT 164
             AVH+D+AGID+CLVGDSAAMVVHG+DTTLPI+LEEMLVHCRAVARGAKRPLLVGDLPFGT
Sbjct:    70 AVHIDTAGIDVCLVGDSAAMVVHGYDTTLPISLEEMLVHCRAVARGAKRPLLVGDLPFGT 129

Query:   165 YESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISV 224
             YESSTNQAVDTAVR+LKEGGMDAIKLEGGSPSRITAA+ IVEAGIAVMGHVGLTPQAISV
Sbjct:   130 YESSTNQAVDTAVRVLKEGGMDAIKLEGGSPSRITAAKSIVEAGIAVMGHVGLTPQAISV 189

Query:   225 LGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECXXXXXXXXXTSALQIPTIGIGAGP 284
             LGGFRPQGKN+ SAVKVVETA+ALQE GCFSVVLEC         TSAL IPTIGIGAGP
Sbjct:   190 LGGFRPQGKNIASAVKVVETAMALQEAGCFSVVLECVPPPVAAAATSALNIPTIGIGAGP 249

Query:   285 FCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSH 344
             FCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQ+A+VG+VINKALLEYKEEV+   FPGPSH
Sbjct:   250 FCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQYAQVGEVINKALLEYKEEVSKHLFPGPSH 309

Query:   345 SPYKMSSSDCNGFFNELQKLGFDKXXXXXXXXXXKID 381
             SPYK+SSSD +GF +ELQKLG DK          K+D
Sbjct:   310 SPYKISSSDLDGFLSELQKLGLDKAASDAAASAEKMD 346
GO:0003824 "catalytic activity" evidence=IEA
GO:0003864 "3-methyl-2-oxobutanoate hydroxymethyltransferase activity" evidence=IEA;IGI;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0015940 "pantothenate biosynthetic process" evidence=IEA;IGI;ISS
GO:0005739 "mitochondrion" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IDA
GO:0050897 "cobalt ion binding" evidence=IDA
TAIR|locus:2062969 KPHMT1 "ketopantoate hydroxymethyltransferase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286637 DDB_G0286637 "3-methyl-2-oxobutanoate hydroxymethyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2377 CHY_2377 "3-methyl-2-oxobutanoate hydroxymethyltransferase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
ASPGD|ASPL0000048463 pantoB [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4NB94 MGG_00599 "3-methyl-2-oxobutanoate hydroxymethyltransferase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1705 GSU_1705 "3-methyl-2-oxobutanoate hydroxymethyltransferase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P0A5Q8 panB "3-methyl-2-oxobutanoate hydroxymethyltransferase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0803 DET_0803 "3-methyl-2-oxobutanoate hydroxymethyltransferase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
CGD|CAL0005148 orf19.6057 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A0LLW3PANB_SYNFM2, ., 1, ., 2, ., 1, 10.51550.65100.8865yesno
B0TC10PANB_HELMI2, ., 1, ., 2, ., 1, 10.50550.68480.9528yesno
Q2RM79PANB_MOOTA2, ., 1, ., 2, ., 1, 10.51860.68220.9739yesno
Q311U7PANB_DESDG2, ., 1, ., 2, ., 1, 10.51360.65360.8685yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.20.766
4th Layer2.1.2.110.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query384
PLN02424332 PLN02424, PLN02424, ketopantoate hydroxymethyltran 0.0
cd06557254 cd06557, KPHMT-like, Ketopantoate hydroxymethyltra 1e-147
pfam02548261 pfam02548, Pantoate_transf, Ketopantoate hydroxyme 1e-143
PRK00311264 PRK00311, panB, 3-methyl-2-oxobutanoate hydroxymet 1e-141
COG0413268 COG0413, PanB, Ketopantoate hydroxymethyltransfera 1e-124
TIGR00222263 TIGR00222, panB, 3-methyl-2-oxobutanoate hydroxyme 4e-92
cd06556240 cd06556, ICL_KPHMT, Members of the ICL/PEPM_KPHMT 4e-49
COG2513289 COG2513, PrpB, PEP phosphonomutase and related enz 3e-04
pfam13714238 pfam13714, PEP_mutase, Phosphoenolpyruvate phospho 0.002
>gnl|CDD|215233 PLN02424, PLN02424, ketopantoate hydroxymethyltransferase Back     alignment and domain information 
 Score =  662 bits (1709), Expect = 0.0
 Identities = 272/327 (83%), Positives = 302/327 (92%)

Query: 58  MSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICL 117
           MSN+PE++VYGGPKPQNP QRVTL  LRQK++ GEPITMVTAYDYPSAVH+DSAGID+CL
Sbjct: 1   MSNLPEDTVYGGPKPQNPAQRVTLRTLRQKYRRGEPITMVTAYDYPSAVHVDSAGIDVCL 60

Query: 118 VGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAV 177
           VGDSAAMVVHGHDTTLPITL+EMLVHCRAVARGA RPLLVGDLPFG+YESST+QAV++AV
Sbjct: 61  VGDSAAMVVHGHDTTLPITLDEMLVHCRAVARGANRPLLVGDLPFGSYESSTDQAVESAV 120

Query: 178 RILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTS 237
           R+LKEGGMDA+KLEGGSPSR+TAA+ IVEAGIAVMGHVGLTPQAISVLGGFRPQG+   S
Sbjct: 121 RMLKEGGMDAVKLEGGSPSRVTAAKAIVEAGIAVMGHVGLTPQAISVLGGFRPQGRTAES 180

Query: 238 AVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLL 297
           AVKVVETALALQE GCF+VVLECVP PVAAA TSALQIPTIGIGAGPFCSGQVLVYHDLL
Sbjct: 181 AVKVVETALALQEAGCFAVVLECVPAPVAAAITSALQIPTIGIGAGPFCSGQVLVYHDLL 240

Query: 298 GMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSHSPYKMSSSDCNGF 357
           GMMQHPHHAKVTPKFCKQ+A+VG+VINKAL EYKEEV NG+FPGP+HSPYK+SS++ +GF
Sbjct: 241 GMMQHPHHAKVTPKFCKQYAKVGEVINKALAEYKEEVENGAFPGPAHSPYKISSAEVDGF 300

Query: 358 FNELQKLGFDKAAAVAAEAAEKIDTAK 384
              LQK G DKAA  AA AAEK +++ 
Sbjct: 301 AEALQKRGLDKAAEAAAAAAEKEESSD 327

Length = 332
>gnl|CDD|119342 cd06557, KPHMT-like, Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>gnl|CDD|217097 pfam02548, Pantoate_transf, Ketopantoate hydroxymethyltransferase Back     alignment and domain information
>gnl|CDD|234723 PRK00311, panB, 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|223490 COG0413, PanB, Ketopantoate hydroxymethyltransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|232882 TIGR00222, panB, 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>gnl|CDD|119341 cd06556, ICL_KPHMT, Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>gnl|CDD|225311 COG2513, PrpB, PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|222337 pfam13714, PEP_mutase, Phosphoenolpyruvate phosphomutase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 384
PLN02424332 ketopantoate hydroxymethyltransferase 100.0
COG0413268 PanB Ketopantoate hydroxymethyltransferase [Coenzy 100.0
PF02548261 Pantoate_transf: Ketopantoate hydroxymethyltransfe 100.0
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 100.0
KOG2949306 consensus Ketopantoate hydroxymethyltransferase [C 100.0
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 100.0
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 100.0
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 100.0
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 100.0
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 99.97
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 99.96
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 99.96
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 99.96
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 99.96
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 99.95
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 99.93
PRK15063428 isocitrate lyase; Provisional 99.88
TIGR01346 527 isocit_lyase isocitrate lyase. Isocitrate lyase an 99.06
COG2224433 AceA Isocitrate lyase [Energy production and conve 98.4
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 97.89
KOG1260 492 consensus Isocitrate lyase [Energy production and 97.74
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 97.65
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 97.57
PRK08185283 hypothetical protein; Provisional 97.56
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 97.53
PRK06498 531 isocitrate lyase; Provisional 97.51
PLN02892 570 isocitrate lyase 97.44
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 97.39
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 97.38
PRK06801286 hypothetical protein; Provisional 97.31
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 97.29
PRK06806281 fructose-bisphosphate aldolase; Provisional 97.28
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 97.25
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 97.24
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 97.2
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 97.19
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 97.07
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 97.07
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 97.03
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 97.01
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 97.01
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 96.98
PF09370268 TIM-br_sig_trns: TIM-barrel signal transduction pr 96.98
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 96.93
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 96.89
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 96.88
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 96.85
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 96.84
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 96.82
TIGR02990239 ectoine_eutA ectoine utilization protein EutA. Mem 96.8
PRK07315293 fructose-bisphosphate aldolase; Provisional 96.79
PRK08610286 fructose-bisphosphate aldolase; Reviewed 96.73
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 96.73
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 96.7
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 96.67
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 96.64
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 96.64
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 96.57
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 96.57
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 96.54
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 96.46
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 96.46
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 96.43
PRK07709285 fructose-bisphosphate aldolase; Provisional 96.34
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 96.33
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 96.32
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 96.29
CHL00162267 thiG thiamin biosynthesis protein G; Validated 96.27
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 96.21
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 96.2
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 96.15
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 96.13
PRK00208250 thiG thiazole synthase; Reviewed 96.1
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 96.1
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 96.05
COG0826347 Collagenase and related proteases [Posttranslation 96.05
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 96.04
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 96.04
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 96.02
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 96.0
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 95.98
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 95.95
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 95.94
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 95.93
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 95.93
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 95.88
PRK14040 593 oxaloacetate decarboxylase; Provisional 95.87
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 95.86
PRK12581 468 oxaloacetate decarboxylase; Provisional 95.84
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 95.84
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 95.84
PRK14042 596 pyruvate carboxylase subunit B; Provisional 95.83
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 95.83
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 95.79
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 95.77
PRK03170292 dihydrodipicolinate synthase; Provisional 95.76
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 95.74
PRK12330 499 oxaloacetate decarboxylase; Provisional 95.73
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 95.71
PRK07475245 hypothetical protein; Provisional 95.71
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 95.7
PLN02591250 tryptophan synthase 95.68
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 95.67
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 95.66
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 95.64
PLN02274505 inosine-5'-monophosphate dehydrogenase 95.64
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 95.64
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 95.62
PRK08645 612 bifunctional homocysteine S-methyltransferase/5,10 95.61
PRK12330 499 oxaloacetate decarboxylase; Provisional 95.6
PRK14024241 phosphoribosyl isomerase A; Provisional 95.6
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 95.6
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 95.59
PRK12331 448 oxaloacetate decarboxylase; Provisional 95.58
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 95.55
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 95.49
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 95.48
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 95.45
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 95.42
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 95.42
COG0821361 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat 95.41
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 95.4
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 95.39
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 95.37
PRK04147293 N-acetylneuraminate lyase; Provisional 95.37
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 95.36
PRK00208250 thiG thiazole synthase; Reviewed 95.36
COG0646311 MetH Methionine synthase I (cobalamin-dependent), 95.36
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 95.34
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 95.33
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 95.33
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 95.33
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 95.27
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 95.26
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 95.21
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 95.17
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 95.17
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 95.13
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 95.08
PRK00366360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 95.06
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 95.03
PLN02274505 inosine-5'-monophosphate dehydrogenase 95.02
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 95.01
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 95.01
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 95.0
PRK07534336 methionine synthase I; Validated 94.98
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 94.98
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 94.97
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 94.94
PRK09282 592 pyruvate carboxylase subunit B; Validated 94.94
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 94.94
PF00463 526 ICL: Isocitrate lyase family; InterPro: IPR000918 94.93
PRK07226267 fructose-bisphosphate aldolase; Provisional 94.92
PLN02417280 dihydrodipicolinate synthase 94.92
PRK04208468 rbcL ribulose bisophosphate carboxylase; Reviewed 94.89
TIGR00612346 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho 94.86
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 94.85
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 94.85
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 94.82
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 94.82
cd08205367 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase l 94.81
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 94.8
PRK12331 448 oxaloacetate decarboxylase; Provisional 94.79
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 94.79
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 94.78
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 94.77
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 94.74
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 94.7
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 94.7
PRK14041 467 oxaloacetate decarboxylase; Provisional 94.68
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 94.67
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 94.66
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 94.66
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 94.65
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 94.64
cd00953279 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas 94.63
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 94.62
PRK14041 467 oxaloacetate decarboxylase; Provisional 94.61
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 94.6
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 94.59
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 94.58
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 94.57
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 94.55
PRK03170292 dihydrodipicolinate synthase; Provisional 94.54
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 94.54
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 94.54
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 94.44
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 94.42
PRK10128267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 94.4
PRK14042 596 pyruvate carboxylase subunit B; Provisional 94.39
PRK05835307 fructose-bisphosphate aldolase; Provisional 94.38
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 94.36
CHL00162267 thiG thiamin biosynthesis protein G; Validated 94.35
PLN02424332 ketopantoate hydroxymethyltransferase 94.34
TIGR03326412 rubisco_III ribulose bisphosphate carboxylase, typ 94.33
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 94.32
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 94.3
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 94.29
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 94.28
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 94.25
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 94.24
PLN02489335 homocysteine S-methyltransferase 94.23
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 94.22
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 94.21
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 94.19
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 94.09
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 94.09
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 94.07
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 94.07
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 94.06
COG1794230 RacX Aspartate racemase [Cell envelope biogenesis, 94.05
PRK15063428 isocitrate lyase; Provisional 94.02
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 94.01
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 94.0
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 93.96
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 93.96
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 93.93
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 93.89
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 93.79
PRK08227264 autoinducer 2 aldolase; Validated 93.73
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 93.73
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 93.72
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 93.71
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 93.69
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 93.68
TIGR03586327 PseI pseudaminic acid synthase. 93.68
PLN02417280 dihydrodipicolinate synthase 93.63
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 93.63
PRK04147293 N-acetylneuraminate lyase; Provisional 93.62
PRK09485304 mmuM homocysteine methyltransferase; Provisional 93.59
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 93.54
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 93.5
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 93.46
PRK09283323 delta-aminolevulinic acid dehydratase; Validated 93.46
COG3473238 Maleate cis-trans isomerase [Secondary metabolites 93.45
cd08210364 RLP_RrRLP Ribulose bisphosphate carboxylase like p 93.41
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 93.4
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 93.39
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 93.37
cd08205367 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase l 93.32
PRK10200230 putative racemase; Provisional 93.23
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 93.19
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 93.19
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 93.19
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 93.12
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 93.07
PF01487224 DHquinase_I: Type I 3-dehydroquinase; InterPro: IP 93.07
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 93.06
PRK10558256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 93.06
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 93.05
PRK13523337 NADPH dehydrogenase NamA; Provisional 93.05
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 93.04
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 93.03
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 93.03
PRK00230230 orotidine 5'-phosphate decarboxylase; Reviewed 93.02
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 93.0
cd08212450 RuBisCO_large_I Ribulose bisphosphate carboxylase 92.97
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 92.91
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 92.91
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 92.89
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 92.84
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 92.83
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 92.82
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 92.81
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 92.76
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 92.75
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 92.75
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 92.74
PRK11572248 copper homeostasis protein CutC; Provisional 92.73
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 92.72
PRK06806281 fructose-bisphosphate aldolase; Provisional 92.72
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 92.7
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 92.69
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 92.68
PRK13384322 delta-aminolevulinic acid dehydratase; Provisional 92.61
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 92.59
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 92.51
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 92.46
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 92.46
PRK12581 468 oxaloacetate decarboxylase; Provisional 92.44
TIGR02082 1178 metH 5-methyltetrahydrofolate--homocysteine methyl 92.41
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 92.38
PRK11858378 aksA trans-homoaconitate synthase; Reviewed 92.37
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 92.34
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 92.3
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 92.23
PRK13523337 NADPH dehydrogenase NamA; Provisional 92.22
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 92.22
cd02812219 PcrB_like PcrB_like proteins. One member of this f 92.21
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 92.21
PRK07226267 fructose-bisphosphate aldolase; Provisional 92.18
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 92.17
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 92.14
PLN02617538 imidazole glycerol phosphate synthase hisHF 92.08
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 92.04
PF00682237 HMGL-like: HMGL-like of this family is not conserv 92.03
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 91.96
TIGR00035229 asp_race aspartate racemase. 91.84
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 91.81
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 91.71
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 91.71
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 91.66
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 91.65
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 91.6
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 91.57
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 91.53
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 91.49
PF02574305 S-methyl_trans: Homocysteine S-methyltransferase; 91.41
TIGR03849237 arch_ComA phosphosulfolactate synthase. This model 91.4
cd04823320 ALAD_PBGS_aspartate_rich Porphobilinogen synthase 91.38
PF02548261 Pantoate_transf: Ketopantoate hydroxymethyltransfe 91.37
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 91.34
TIGR00676272 fadh2 5,10-methylenetetrahydrofolate reductase, pr 91.28
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 91.28
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 91.27
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 91.21
PRK07084321 fructose-bisphosphate aldolase; Provisional 91.21
PF00490324 ALAD: Delta-aminolevulinic acid dehydratase; Inter 91.19
PRK07535261 methyltetrahydrofolate:corrinoid/iron-sulfur prote 91.15
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 91.13
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 91.13
TIGR01740213 pyrF orotidine 5'-phosphate decarboxylase, subfami 91.12
PRK09490 1229 metH B12-dependent methionine synthase; Provisiona 91.09
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 91.04
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 91.01
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 90.99
PRK09283323 delta-aminolevulinic acid dehydratase; Validated 90.91
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 90.86
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 90.8
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 90.8
cd00384314 ALAD_PBGS Porphobilinogen synthase (PBGS), which i 90.75
PRK09875292 putative hydrolase; Provisional 90.74
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 90.68
PRK07709285 fructose-bisphosphate aldolase; Provisional 90.51
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 90.45
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 90.42
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 90.39
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 90.33
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 90.32
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 90.19
PLN02535364 glycolate oxidase 90.18
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 90.13
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 90.07
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 90.06
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 90.02
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 89.98
PRK09282 592 pyruvate carboxylase subunit B; Validated 89.95
PRK14040 593 oxaloacetate decarboxylase; Provisional 89.93
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 89.93
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 89.91
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 89.89
TIGR00284499 dihydropteroate synthase-related protein. This pro 89.88
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 89.86
PRK12999 1146 pyruvate carboxylase; Reviewed 89.86
PRK07475245 hypothetical protein; Provisional 89.86
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 89.84
TIGR00677281 fadh2_euk methylenetetrahydrofolate reductase, euk 89.81
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 89.81
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 89.73
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 89.7
TIGR01520357 FruBisAldo_II_A fructose-bisphosphate aldolase, cl 89.63
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 89.6
cd08148366 RuBisCO_large Ribulose bisphosphate carboxylase la 89.6
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 89.56
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 89.53
cd04823320 ALAD_PBGS_aspartate_rich Porphobilinogen synthase 89.44
PRK13384322 delta-aminolevulinic acid dehydratase; Provisional 89.37
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 89.35
PRK09427454 bifunctional indole-3-glycerol phosphate synthase/ 89.3
PRK10605362 N-ethylmaleimide reductase; Provisional 89.25
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 89.25
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 89.23
PRK00979308 tetrahydromethanopterin S-methyltransferase subuni 89.09
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 88.98
TIGR01362258 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase. 88.93
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 88.82
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 88.82
PF00682237 HMGL-like: HMGL-like of this family is not conserv 88.72
PLN028581378 fructose-bisphosphate aldolase 88.71
PRK00915 513 2-isopropylmalate synthase; Validated 88.69
cd00953279 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas 88.67
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 88.62
PRK09197350 fructose-bisphosphate aldolase; Provisional 88.51
PF02679244 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); 88.45
cd08210364 RLP_RrRLP Ribulose bisphosphate carboxylase like p 88.42
PF09505466 Dimeth_Pyl: Dimethylamine methyltransferase (Dimet 88.39
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 88.37
PRK11197381 lldD L-lactate dehydrogenase; Provisional 88.37
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 88.32
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 88.31
TIGR00977 526 LeuA_rel 2-isopropylmalate synthase/homocitrate sy 88.28
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This famil 88.28
PRK00865261 glutamate racemase; Provisional 88.25
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 88.21
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 88.2
PRK08610286 fructose-bisphosphate aldolase; Reviewed 88.18
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 88.14
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 88.14
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 88.1
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 88.08
PLN02746347 hydroxymethylglutaryl-CoA lyase 88.07
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 88.03
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 87.94
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 87.94
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 87.92
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 87.8
cd00384314 ALAD_PBGS Porphobilinogen synthase (PBGS), which i 87.74
PRK11858378 aksA trans-homoaconitate synthase; Reviewed 87.73
cd00537274 MTHFR Methylenetetrahydrofolate reductase (MTHFR). 87.63
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 87.49
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 87.46
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 87.37
PF09370268 TIM-br_sig_trns: TIM-barrel signal transduction pr 87.27
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 87.26
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 87.25
PRK06852304 aldolase; Validated 87.1
PRK00507221 deoxyribose-phosphate aldolase; Provisional 87.07
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 87.03
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 86.89
PF07302221 AroM: AroM protein; InterPro: IPR010843 This famil 86.87
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 86.6
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 86.57
PF00490324 ALAD: Delta-aminolevulinic acid dehydratase; Inter 86.55
PRK10605362 N-ethylmaleimide reductase; Provisional 86.49
PRK15452 443 putative protease; Provisional 86.44
cd04824320 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthas 86.43
PF02219287 MTHFR: Methylenetetrahydrofolate reductase; InterP 86.41
PRK06801286 hypothetical protein; Provisional 86.39
PLN02746347 hydroxymethylglutaryl-CoA lyase 86.38
PRK08185283 hypothetical protein; Provisional 86.21
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 86.17
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 86.07
PRK08508279 biotin synthase; Provisional 86.07
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 85.95
TIGR02311249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 85.91
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 85.87
PRK13753279 dihydropteroate synthase; Provisional 85.82
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 85.8
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 85.77
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 85.77
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 85.67
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 85.65
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 85.6
TIGR02082 1178 metH 5-methyltetrahydrofolate--homocysteine methyl 85.57
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 85.53
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 85.52
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 85.48
TIGR00067251 glut_race glutamate racemase. The most closely rel 85.48
PF04551359 GcpE: GcpE protein; InterPro: IPR004588 This prote 85.47
COG0646311 MetH Methionine synthase I (cobalamin-dependent), 85.3
PRK12344 524 putative alpha-isopropylmalate/homocitrate synthas 85.19
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 84.97
TIGR01496257 DHPS dihydropteroate synthase. This model represen 84.84
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 84.82
TIGR00433296 bioB biotin synthetase. Catalyzes the last step of 84.79
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 84.62
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 84.53
PRK00865261 glutamate racemase; Provisional 84.46
TIGR01093228 aroD 3-dehydroquinate dehydratase, type I. Type II 84.45
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 84.1
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 84.08
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 83.97
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 83.95
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 83.95
PLN02979366 glycolate oxidase 83.82
PRK07084321 fructose-bisphosphate aldolase; Provisional 83.78
PRK07695201 transcriptional regulator TenI; Provisional 83.78
PRK12999 1146 pyruvate carboxylase; Reviewed 83.68
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 83.59
PRK06256336 biotin synthase; Validated 83.48
COG2159293 Predicted metal-dependent hydrolase of the TIM-bar 83.42
PRK07094323 biotin synthase; Provisional 83.29
PRK09250348 fructose-bisphosphate aldolase; Provisional 83.24
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 82.8
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 82.79
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 82.72
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 82.71
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 82.71
cd04824320 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthas 82.69
COG0119409 LeuA Isopropylmalate/homocitrate/citramalate synth 82.66
PRK08227264 autoinducer 2 aldolase; Validated 82.63
cd03329368 MR_like_4 Mandelate racemase (MR)-like subfamily o 82.49
COG0821 361 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat 82.41
PRK13753279 dihydropteroate synthase; Provisional 82.41
PRK07360371 FO synthase subunit 2; Reviewed 82.4
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 82.3
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 82.29
PTZ00413398 lipoate synthase; Provisional 82.17
PLN03228 503 methylthioalkylmalate synthase; Provisional 82.12
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav 82.04
PRK11613282 folP dihydropteroate synthase; Provisional 82.02
PRK10128267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 81.82
PRK15108345 biotin synthase; Provisional 81.79
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 81.77
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 81.74
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 81.56
TIGR01740213 pyrF orotidine 5'-phosphate decarboxylase, subfami 81.5
COG0284240 PyrF Orotidine-5'-phosphate decarboxylase [Nucleot 81.49
cd00502225 DHQase_I Type I 3-dehydroquinase, (3-dehydroquinat 81.47
cd00453340 FTBP_aldolase_II Fructose/tagarose-bisphosphate al 81.2
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information 
Probab=100.00  E-value=3.6e-110  Score=820.31  Aligned_cols=326  Identities=83%  Similarity=1.305  Sum_probs=314.8

Q ss_pred             ccCCCCCCCCCCCCCCCCCCCCCHHHHHHhhhCCCcEEEEecCChHHHHHHHHcCCCEEEecchhhhhhccCCCCcCCCH
Q 016682           58 MSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITL  137 (384)
Q Consensus        58 ~s~~~~~~~~~~~~~~~~~~~~t~~~lr~~k~~g~~I~mlTAyD~~sA~iae~AGiD~IlVGDSl~mv~lG~~dT~~Vtl  137 (384)
                      ||+.|+.++|+.++++.+.+|+|+.+|+++|++|+||+|+|||||+||+++|++|+|+||||||++|++|||+||.+|||
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~k~ti~~l~~~k~~g~kivmlTAyD~~sA~i~d~aGvD~ILVGDSlgmv~lG~~~T~~Vtl   80 (332)
T PLN02424          1 MSNLPEDTVYGGPKPQNPAQRVTLRTLRQKYRRGEPITMVTAYDYPSAVHVDSAGIDVCLVGDSAAMVVHGHDTTLPITL   80 (332)
T ss_pred             CCCCCcccccCCCCcccCCCCcCHHHHHHHHhCCCcEEEEecCCHHHHHHHHHcCCCEEEECCcHHHHhcCCCCCCCcCH
Confidence            68889999998887666567899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHcccCCCcEEEeCCCCCCcCCHHHHHHHHHHHHHHhCCCEEEeCCCccchHHHHHHHHHcCCceeeeccC
Q 016682          138 EEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGL  217 (384)
Q Consensus       138 deMl~h~raV~Rga~~~~vvaDmPfgsY~~s~e~av~nA~rl~keaGAdaVKLEgg~~e~~~~I~alv~aGIPV~gHiGL  217 (384)
                      |||++|+++|+||+++||+++|||||||+.|++++++||.|+|+|+||++||||||..+++++|++|+++||||||||||
T Consensus        81 d~mi~H~~aV~Rga~~a~vVaDmPfgSY~~s~e~av~nA~rl~~eaGa~aVKlEGg~~~~~~~I~~l~~~GIPV~gHiGL  160 (332)
T PLN02424         81 DEMLVHCRAVARGANRPLLVGDLPFGSYESSTDQAVESAVRMLKEGGMDAVKLEGGSPSRVTAAKAIVEAGIAVMGHVGL  160 (332)
T ss_pred             HHHHHHHHHHhccCCCCEEEeCCCCCCCCCCHHHHHHHHHHHHHHhCCcEEEECCCcHHHHHHHHHHHHcCCCEEEeecc
Confidence            99999999999999999999999999999999999999999999999999999999557899999999999999999999


Q ss_pred             CcccccccCCccccCCCHHHHHHHHHHHHHHHHcCCcEEEecCCCHHHHHHHHhhcCCCEEEEcCCCCCCchhhhHhhhh
Q 016682          218 TPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLL  297 (384)
Q Consensus       218 tPQ~~~~lgGfrvqGrt~~~a~~ll~rAkAleeAGAf~IvlE~Vp~ela~~It~~l~IPtIGIGAG~~cDGQvLV~~DlL  297 (384)
                      |||+++++||||+|||+.++++++++||++||+||||+|||||||.+++++||++++|||||||||++|||||||+||||
T Consensus       161 tPQs~~~lGGykvqGr~~~~a~~li~dA~ale~AGAf~ivLE~Vp~~la~~It~~l~IPtIGIGAG~~cDGQVLV~~D~L  240 (332)
T PLN02424        161 TPQAISVLGGFRPQGRTAESAVKVVETALALQEAGCFAVVLECVPAPVAAAITSALQIPTIGIGAGPFCSGQVLVYHDLL  240 (332)
T ss_pred             cceeehhhcCccccCCCHHHHHHHHHHHHHHHHcCCcEEEEcCCcHHHHHHHHHhCCCCEEeecCCCCCCceeEeHHhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCCCCCcchhhhhhhhHHHHHHHHHHHHHHhccCCCCCCCCCCccCChhhHHHHHHHHHhcChhHHHHHHHHHH
Q 016682          298 GMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSHSPYKMSSSDCNGFFNELQKLGFDKAAAVAAEAA  377 (384)
Q Consensus       298 G~~~~P~~~~~~PkFvk~y~~~~~~~~~A~~~y~~eV~~g~FP~~~h~~y~~~~~e~~~f~~~~~~~~~~~~~~~~~~~~  377 (384)
                      |++.+|+|+++.|||||+|+|+++.+++|+++|++|||+|+||.++|++|+|++++|++|+++|+++|+||||+++++++
T Consensus       241 G~~~~p~h~~~~PkFvk~y~~~~~~~~~A~~~y~~eVk~g~FP~~eh~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~  320 (332)
T PLN02424        241 GMMQHPHHAKVTPKFCKQYAKVGEVINKALAEYKEEVENGAFPGPAHSPYKISSAEVDGFAEALQKRGLDKAAEAAAAAA  320 (332)
T ss_pred             CCCCCccccCCCCchHHHHHhHHHHHHHHHHHHHHHHhCCCCCCccccCCCCCHHHHHHHHHHHHHcCchHHHHHHHHHH
Confidence            99977888889999999999999999999999999999999999999779999999999999999999999999999999


Q ss_pred             hhhhhc
Q 016682          378 EKIDTA  383 (384)
Q Consensus       378 ~~~~~~  383 (384)
                      ||.+.+
T Consensus       321 ~~~~~~  326 (332)
T PLN02424        321 EKEESS  326 (332)
T ss_pred             hhcccc
Confidence            998765

>COG0413 PanB Ketopantoate hydroxymethyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2 Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>KOG2949 consensus Ketopantoate hydroxymethyltransferase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PRK15063 isocitrate lyase; Provisional Back     alignment and domain information
>TIGR01346 isocit_lyase isocitrate lyase Back     alignment and domain information
>COG2224 AceA Isocitrate lyase [Energy production and conversion] Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>KOG1260 consensus Isocitrate lyase [Energy production and conversion] Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK06498 isocitrate lyase; Provisional Back     alignment and domain information
>PLN02892 isocitrate lyase Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART) Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>TIGR02990 ectoine_eutA ectoine utilization protein EutA Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>PRK07475 hypothetical protein; Provisional Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PRK08645 bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein; Reviewed Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism] Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>COG0646 MetH Methionine synthase I (cobalamin-dependent), methyltransferase domain [Amino acid transport and metabolism] Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PRK07534 methionine synthase I; Validated Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PF00463 ICL: Isocitrate lyase family; InterPro: IPR000918 Isocitrate lyase (4 Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>PRK04208 rbcL ribulose bisophosphate carboxylase; Reviewed Back     alignment and domain information
>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>cd08205 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>TIGR03326 rubisco_III ribulose bisphosphate carboxylase, type III Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PLN02489 homocysteine S-methyltransferase Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>COG1794 RacX Aspartate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15063 isocitrate lyase; Provisional Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>PRK09485 mmuM homocysteine methyltransferase; Provisional Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>PRK09283 delta-aminolevulinic acid dehydratase; Validated Back     alignment and domain information
>COG3473 Maleate cis-trans isomerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd08210 RLP_RrRLP Ribulose bisphosphate carboxylase like proteins (RLPs) similar to R Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd08205 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV Back     alignment and domain information
>PRK10200 putative racemase; Provisional Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>PF01487 DHquinase_I: Type I 3-dehydroquinase; InterPro: IPR001381 3-dehydroquinate dehydratase (4 Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>cd08212 RuBisCO_large_I Ribulose bisphosphate carboxylase large chain, Form I Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13384 delta-aminolevulinic acid dehydratase; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR02082 metH 5-methyltetrahydrofolate--homocysteine methyltransferase Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>TIGR00035 asp_race aspartate racemase Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PF02574 S-methyl_trans: Homocysteine S-methyltransferase; InterPro: IPR003726 S-methylmethionine: homocysteine methyltransferase 2 Back     alignment and domain information
>TIGR03849 arch_ComA phosphosulfolactate synthase Back     alignment and domain information
>cd04823 ALAD_PBGS_aspartate_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2 Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>TIGR00676 fadh2 5,10-methylenetetrahydrofolate reductase, prokaryotic form Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK07084 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF00490 ALAD: Delta-aminolevulinic acid dehydratase; InterPro: IPR001731 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] Back     alignment and domain information
>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>PRK09490 metH B12-dependent methionine synthase; Provisional Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK09283 delta-aminolevulinic acid dehydratase; Validated Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd00384 ALAD_PBGS Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>PRK09875 putative hydrolase; Provisional Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00284 dihydropteroate synthase-related protein Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK07475 hypothetical protein; Provisional Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>TIGR00677 fadh2_euk methylenetetrahydrofolate reductase, eukaryotic type Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>TIGR01520 FruBisAldo_II_A fructose-bisphosphate aldolase, class II, yeast/E Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>cd08148 RuBisCO_large Ribulose bisphosphate carboxylase large chain Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>cd04823 ALAD_PBGS_aspartate_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>PRK13384 delta-aminolevulinic acid dehydratase; Provisional Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>PRK00979 tetrahydromethanopterin S-methyltransferase subunit H; Provisional Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09197 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds [] Back     alignment and domain information
>cd08210 RLP_RrRLP Ribulose bisphosphate carboxylase like proteins (RLPs) similar to R Back     alignment and domain information
>PF09505 Dimeth_Pyl: Dimethylamine methyltransferase (Dimeth_PyL); InterPro: IPR012653 This family consists of dimethylamine methyltransferases from the genus Methanosarcina Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>PRK00865 glutamate racemase; Provisional Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd00384 ALAD_PBGS Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>cd00537 MTHFR Methylenetetrahydrofolate reductase (MTHFR) Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART) Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PF07302 AroM: AroM protein; InterPro: IPR010843 This family consists of several bacterial and archaeal AroM proteins Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>PF00490 ALAD: Delta-aminolevulinic acid dehydratase; InterPro: IPR001731 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>cd04824 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>PF02219 MTHFR: Methylenetetrahydrofolate reductase; InterPro: IPR003171 This family includes the 5,10-methylenetetrahydrofolate reductase 1 Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PRK13753 dihydropteroate synthase; Provisional Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>TIGR02082 metH 5-methyltetrahydrofolate--homocysteine methyltransferase Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>TIGR00067 glut_race glutamate racemase Back     alignment and domain information
>PF04551 GcpE: GcpE protein; InterPro: IPR004588 This protein previously of unknown biochemical function is essential in Escherichia coli Back     alignment and domain information
>COG0646 MetH Methionine synthase I (cobalamin-dependent), methyltransferase domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR00433 bioB biotin synthetase Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>PRK00865 glutamate racemase; Provisional Back     alignment and domain information
>TIGR01093 aroD 3-dehydroquinate dehydratase, type I Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>PRK07084 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>cd04824 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>cd03329 MR_like_4 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 4 Back     alignment and domain information
>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism] Back     alignment and domain information
>PRK13753 dihydropteroate synthase; Provisional Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PTZ00413 lipoate synthase; Provisional Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>COG0284 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00502 DHQase_I Type I 3-dehydroquinase, (3-dehydroquinate dehydratase or DHQase Back     alignment and domain information
>cd00453 FTBP_aldolase_II Fructose/tagarose-bisphosphate aldolase class II Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query384
1oy0_A281 The Crystal Structure Of The First Enzyme Of Pantot 2e-60
3ez4_A269 Crystal Structure Of 3-Methyl-2-Oxobutanoate Hydrox 2e-50
3vav_A275 Crystal Structure Of 3-Methyl-2-Oxobutanoate Hydrox 4e-50
1m3u_A264 Crystal Structure Of Ketopantoate Hydroxymethyltran 4e-45
1o66_A275 Crystal Structure Of 3-Methyl-2-Oxobutanoate Hydrox 2e-38
>pdb|1OY0|A Chain A, The Crystal Structure Of The First Enzyme Of Pantothenate Biosynthetic Pathway, Ketopantoate Hydroxymethyltransferase From Mycobacterium Tuberculosis Shows A Decameric Assembly And Terminal Helix-Swapping Length = 281 Back     alignment and structure 
Iteration: 1

 Score =  229 bits (585), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 123/286 (43%), Positives = 172/286 (60%), Gaps = 11/286 (3%)
Query: 63  ENSVYGGPKP--QNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGD 120
           E ++YG   P    P  ++   HL++   +G    M+TAYDY +A   D AGI + LVGD
Sbjct: 3   EQTIYGANTPGGSGPRTKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGD 62
Query: 121 SAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRIL 180
           SAA VV+G+DTT+PI+++E++   R V RGA   L+V DLPFG+YE+    A+  A R L
Sbjct: 63  SAANVVYGYDTTVPISIDELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATRFL 122
Query: 181 KEGGMDAIKLEGGSPSRITAARG-IVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAV 239
           K+GG  A+KLEGG   R+      +  AGI VM H+G TPQ+++ LGGFR QG+   +A 
Sbjct: 123 KDGGAHAVKLEGG--ERVAEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRG-DAAE 179
Query: 240 KVVETALALQEVGCFSVVLECXXXXXXXXXTSALQIPTIGIGAGPFCSGQVLVYHDLLGM 299
           + +  A+A+ E G F+VV+E          T  L IPT+GIGAGP C GQVLV+ D+ G 
Sbjct: 180 QTIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVWQDMAGF 239
Query: 300 MQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSHS 345
                    T +F K++A VG  + +A ++Y +EV  G FP   HS
Sbjct: 240 -----SGAKTARFVKRYADVGGELRRAAMQYAQEVAGGVFPADEHS 280
>pdb|3EZ4|A Chain A, Crystal Structure Of 3-Methyl-2-Oxobutanoate Hydroxymethyltransferase From Burkholderia Pseudomallei Length = 269 Back     alignment and structure
>pdb|3VAV|A Chain A, Crystal Structure Of 3-Methyl-2-Oxobutanoate Hydroxymethyltransferase From Burkholderia Thailandensis Length = 275 Back     alignment and structure
>pdb|1M3U|A Chain A, Crystal Structure Of Ketopantoate Hydroxymethyltransferase Complexed The Product Ketopantoate Length = 264 Back     alignment and structure
>pdb|1O66|A Chain A, Crystal Structure Of 3-Methyl-2-Oxobutanoate Hydroxymethyltransferase Length = 275 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query384
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 1e-152
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 1e-136
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 1e-136
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 1e-135
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 8e-05
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 9e-05
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 2e-04
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 2e-04
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Length = 281 Back     alignment and structure
 Score =  428 bits (1104), Expect = e-152
 Identities = 125/287 (43%), Positives = 175/287 (60%), Gaps = 9/287 (3%)

Query: 61  IPENSVYGGPKP--QNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLV 118
           + E ++YG   P    P  ++   HL++   +G    M+TAYDY +A   D AGI + LV
Sbjct: 1   MSEQTIYGANTPGGSGPRTKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLV 60

Query: 119 GDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVR 178
           GDSAA VV+G+DTT+PI+++E++   R V RGA   L+V DLPFG+YE+    A+  A R
Sbjct: 61  GDSAANVVYGYDTTVPISIDELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATR 120

Query: 179 ILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSA 238
            LK+GG  A+KLEGG          +  AGI VM H+G TPQ+++ LGGFR QG+   +A
Sbjct: 121 FLKDGGAHAVKLEGGER-VAEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRG-DAA 178

Query: 239 VKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLLG 298
            + +  A+A+ E G F+VV+E VP  +A   T  L IPT+GIGAGP C GQVLV+ D+ G
Sbjct: 179 EQTIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVWQDMAG 238

Query: 299 MMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSHS 345
                     T +F K++A VG  + +A ++Y +EV  G FP   HS
Sbjct: 239 F-----SGAKTARFVKRYADVGGELRRAAMQYAQEVAGGVFPADEHS 280
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} PDB: 3ez4_A Length = 275 Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Length = 264 Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Length = 275 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} Length = 298 Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Length = 255 Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Length = 287 Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Length = 295 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query384
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 100.0
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 100.0
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 100.0
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 100.0
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 100.0
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 100.0
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 100.0
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 100.0
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 100.0
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 100.0
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 100.0
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 100.0
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 100.0
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 100.0
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 100.0
3i4e_A439 Isocitrate lyase; structural genomics, seattle str 99.87
3eol_A433 Isocitrate lyase; seattle structural center for in 99.86
1f8m_A429 Isocitrate lyase, ICL; alpha-beta barrel, helix-sw 99.86
3lg3_A435 Isocitrate lyase; conserved, CD, proteomics eviden 99.85
1dqu_A 538 Isocitrate lyase; beta barrel; 2.80A {Emericella n 99.74
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 97.76
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 97.73
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 97.66
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 97.65
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 97.65
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 97.47
1ujp_A271 Tryptophan synthase alpha chain; riken structural 97.39
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 97.33
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 97.3
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 97.26
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 97.26
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 97.26
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 97.23
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 97.21
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 97.21
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 97.18
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 97.13
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 97.12
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 97.1
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 97.08
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 97.07
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 97.05
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 97.05
1viz_A240 PCRB protein homolog; structural genomics, unknown 97.0
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 96.99
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 96.98
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 96.93
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 96.9
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 96.9
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 96.89
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 96.85
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 96.83
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 96.74
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.71
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 96.71
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 96.65
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 96.61
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 96.59
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 96.56
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 96.54
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 96.54
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 96.5
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 96.5
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 96.49
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 96.46
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 96.45
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 96.4
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 96.39
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 96.39
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 96.38
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 96.37
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 96.36
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 96.34
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 96.34
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 96.33
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 96.33
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 96.31
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 96.28
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 96.28
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 96.27
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 96.26
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 96.25
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 96.25
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 96.24
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 96.23
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 96.22
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 96.2
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 96.18
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 96.16
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 96.16
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 96.14
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 96.14
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 96.13
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 96.12
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 96.12
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 96.1
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 96.1
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 96.08
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 96.08
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 96.06
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 96.02
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 96.01
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 96.01
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 96.0
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 95.99
2hmc_A344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 95.95
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 95.94
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 95.94
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 95.93
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 95.92
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 95.9
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 95.89
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 95.88
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 95.86
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 95.86
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 95.84
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 95.81
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 95.79
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 95.76
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 95.75
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 95.71
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 95.66
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 95.66
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 95.6
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 95.58
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 95.58
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 95.51
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 95.49
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 95.48
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 95.46
3i4e_A439 Isocitrate lyase; structural genomics, seattle str 95.46
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 95.45
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 95.44
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 95.3
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 95.29
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 95.29
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 95.29
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 95.29
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 95.25
1lt8_A406 Betaine-homocysteine methyltransferase; homocystei 95.23
2eq5_A228 228AA long hypothetical hydantoin racemase; struct 95.21
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 95.19
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 95.14
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 95.12
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 95.11
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 95.06
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 95.05
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 95.05
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 95.02
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 95.01
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 95.01
2r91_A286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 95.0
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 94.99
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 94.99
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 94.93
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 94.92
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 94.92
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 94.91
2nuw_A288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 94.91
3noy_A366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 94.89
2dwu_A276 Glutamate racemase; isomerase; HET: DGL; 1.60A {Ba 94.88
4djd_D323 C/Fe-SP, corrinoid/iron-sulfur protein small subun 94.87
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 94.86
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 94.84
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 94.79
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 94.76
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 94.74
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 94.72
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 94.7
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 94.7
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 94.7
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 94.62
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 94.6
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 94.57
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 94.56
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 94.53
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 94.49
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 94.49
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 94.49
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 94.47
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 94.47
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 94.46
2gzm_A267 Glutamate racemase; enzyme, isomerase; HET: DGL; 1 94.45
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 94.45
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 94.42
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 94.42
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 94.38
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 94.34
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 94.3
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 94.25
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 94.25
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 94.24
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 94.23
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 94.22
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 94.21
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 94.13
2qgy_A391 Enolase from the environmental genome shotgun sequ 94.12
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 94.06
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 94.05
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 93.99
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 93.99
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 93.97
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 93.96
2nx9_A464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 93.94
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 93.93
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 93.93
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 93.92
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 93.92
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 93.9
3ixl_A240 Amdase, arylmalonate decarboxylase; enantioselecti 93.9
1pii_A452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 93.89
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 93.88
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 93.85
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 93.8
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 93.8
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 93.79
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 93.77
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 93.74
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 93.71
4dpp_A360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 93.69
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 93.67
3tfx_A259 Orotidine 5'-phosphate decarboxylase; PSI-biology, 93.66
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 93.63
2nwr_A267 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KD 93.63
2o56_A407 Putative mandelate racemase; dehydratase, structur 93.62
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 93.53
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 93.51
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 93.48
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 93.46
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 93.41
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 93.4
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 93.4
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 93.39
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 93.39
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 93.36
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 93.35
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 93.33
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 93.31
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; 93.31
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 93.3
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 93.3
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 93.28
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 93.25
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 93.24
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 93.2
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 93.19
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 93.19
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 93.14
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 93.13
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 93.13
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 93.08
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 93.07
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 93.01
1q7z_A 566 5-methyltetrahydrofolate S-homocysteine methyltran 93.0
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structu 92.99
3lg3_A435 Isocitrate lyase; conserved, CD, proteomics eviden 92.96
1sfl_A238 3-dehydroquinate dehydratase; 3-dehydroquinase, en 92.91
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 92.87
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 92.87
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 92.85
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 92.83
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 92.83
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 92.82
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 92.82
2fiq_A420 Putative tagatose 6-phosphate kinase 1; structural 92.81
1zuw_A272 Glutamate racemase 1; (R)-glutamate, peptidoglycan 92.81
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 92.79
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 92.78
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 92.74
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 92.72
3oa3_A288 Aldolase; structural genomics, seattle structural 92.7
2hmc_A344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 92.68
1w5q_A337 Delta-aminolevulinic acid dehydratase; synthase, e 92.68
3txv_A450 Probable tagatose 6-phosphate kinase; structural g 92.65
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 92.64
1l6s_A323 Porphobilinogen synthase; dehydratase, lyase; HET: 92.63
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 92.6
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 92.57
1f6y_A262 5-methyltetrahydrofolate corrinoid/iron sulfur PR 92.57
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 92.56
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 92.51
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 92.51
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 92.48
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 92.45
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 92.43
2gl5_A410 Putative dehydratase protein; structural genomics, 92.4
3ij6_A312 Uncharacterized metal-dependent hydrolase; structu 92.38
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 92.38
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 92.36
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 92.36
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 92.33
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 92.33
3eol_A433 Isocitrate lyase; seattle structural center for in 92.32
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 92.3
2vvt_A290 Glutamate racemase; isomerase, peptidoglycan synth 92.29
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 92.26
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 92.25
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 92.23
2r91_A286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 92.19
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 92.17
1f8m_A429 Isocitrate lyase, ICL; alpha-beta barrel, helix-sw 92.11
3tha_A252 Tryptophan synthase alpha chain; structural genomi 92.08
1tzz_A392 Hypothetical protein L1841; structural genomics, m 92.04
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 92.03
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 92.02
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 91.97
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 91.95
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 91.87
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 91.85
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 91.84
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 91.8
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 91.8
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 91.76
3q94_A288 Fructose-bisphosphate aldolase, class II; structur 91.67
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 91.65
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 91.61
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 91.61
2nuw_A288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 91.6
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 91.58
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 91.56
2pcq_A283 Putative dihydrodipicolinate synthase; lyase, lysi 91.53
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 91.5
4hb7_A270 Dihydropteroate synthase; transferase; 1.95A {Stap 91.43
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 91.42
3ldv_A255 Orotidine 5'-phosphate decarboxylase; structural g 91.39
2poz_A392 Putative dehydratase; octamer, structural genomics 91.39
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 91.38
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 91.37
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 91.36
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 91.36
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 91.34
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 91.31
1h7n_A342 5-aminolaevulinic acid dehydratase; lyase, aldolas 91.28
3qvl_A245 Putative hydantoin racemase; isomerase; HET: 5HY; 91.24
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 91.2
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 91.15
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 91.13
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 91.12
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 91.11
2oz8_A389 MLL7089 protein; structural genomics, unknown func 91.1
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 91.1
3ble_A337 Citramalate synthase from leptospira interrogans; 91.08
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 91.08
3nur_A357 Amidohydrolase; TIM barrel; 1.75A {Staphylococcus 91.05
3obk_A356 Delta-aminolevulinic acid dehydratase; ssgcid, str 91.03
3out_A268 Glutamate racemase; structural genomics, center fo 91.03
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 90.97
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 90.96
3tr2_A239 Orotidine 5'-phosphate decarboxylase; purines, pyr 90.93
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 90.93
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 90.92
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 90.91
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 90.87
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 90.87
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 90.85
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 90.81
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 90.81
2jfq_A286 Glutamate racemase; cell WALL, isomerase, cell sha 90.77
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 90.76
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 90.71
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 90.64
1pv8_A330 Delta-aminolevulinic acid dehydratase; porphobilin 90.63
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 90.6
4inf_A373 Metal-dependent hydrolase; amidohydrolase, metal b 90.6
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 90.59
2dgd_A223 223AA long hypothetical arylmalonate decarboxylas; 90.47
2xed_A273 Putative maleate isomerase; nicotinic acid catabol 90.45
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthas 90.44
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 90.31
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 90.3
3o07_A 291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 90.27
1w1z_A328 Delta-aminolevulinic acid dehydratase; synthase, t 90.26
3v3w_A424 Starvation sensing protein RSPA; enolase, enzyme f 90.11
3sz8_A285 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgci 90.08
3fst_A304 5,10-methylenetetrahydrofolate reductase; TIM barr 90.08
3vcn_A425 Mannonate dehydratase; enolase, magnesium binding 90.08
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 90.01
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 90.0
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 89.89
2yr1_A257 3-dehydroquinate dehydratase; amino acid biosynthe 89.89
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 89.87
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 89.86
3ivs_A423 Homocitrate synthase, mitochondrial; TIM barrel, m 89.81
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 89.81
2h9a_B310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur 89.76
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 89.74
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 89.71
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 89.69
2gwg_A350 4-oxalomesaconate hydratase; TIM-barrel like prote 89.68
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 89.63
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 89.61
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 89.58
4ay7_A348 Methylcobalamin\: coenzyme M methyltransferase; TI 89.57
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 89.55
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 89.53
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 89.52
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 89.5
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 89.5
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 89.38
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 89.21
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 89.18
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 89.16
3qvl_A245 Putative hydantoin racemase; isomerase; HET: 5HY; 89.16
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 89.08
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 89.07
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 89.05
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 89.03
3s81_A268 Putative aspartate racemase; structural genomics, 88.98
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 88.97
1gvf_A286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 88.89
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 88.81
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 88.75
2oz8_A389 MLL7089 protein; structural genomics, unknown func 88.72
3ojc_A231 Putative aspartate/glutamate racemase; structural 88.71
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 88.67
3kts_A192 Glycerol uptake operon antiterminator regulatory; 88.64
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 88.43
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 88.41
3dxi_A320 Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX 88.38
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 88.38
3ble_A337 Citramalate synthase from leptospira interrogans; 88.35
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 88.24
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 88.22
2zsk_A226 PH1733, 226AA long hypothetical aspartate racemase 88.18
3eez_A378 Putative mandelate racemase/muconate lactonizing e 88.15
3r0u_A379 Enzyme of enolase superfamily; structural genomics 88.04
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 88.03
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 87.95
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 87.87
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 87.83
1w1z_A328 Delta-aminolevulinic acid dehydratase; synthase, t 87.82
3vc5_A441 Mandelate racemase/muconate lactonizing protein; d 87.81
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 87.81
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 87.77
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 87.74
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 87.74
2gzm_A267 Glutamate racemase; enzyme, isomerase; HET: DGL; 1 87.69
2eq5_A228 228AA long hypothetical hydantoin racemase; struct 87.64
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 87.61
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 87.6
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 87.56
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 87.55
2jfz_A255 Glutamate racemase; cell WALL, isomerase, cell sha 87.49
1l6s_A323 Porphobilinogen synthase; dehydratase, lyase; HET: 87.47
3vdg_A445 Probable glucarate dehydratase; enolase, magnesium 87.28
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 87.22
3apt_A310 Methylenetetrahydrofolate reductase; TIM barrel, o 87.18
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 87.18
3tji_A422 Mandelate racemase/muconate lactonizing enzyme, N 87.17
2vef_A314 Dihydropteroate synthase; antibiotic resistance, t 87.05
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 87.03
2wm1_A336 2-amino-3-carboxymuconate-6-semialdehyde decarboxy 87.03
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 86.94
3rmj_A370 2-isopropylmalate synthase; LEUA, truncation, neis 86.92
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 86.8
3ist_A269 Glutamate racemase; structural genomics, cell WALL 86.69
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 86.6
2pcq_A283 Putative dihydrodipicolinate synthase; lyase, lysi 86.52
3va8_A445 Probable dehydratase; enolase, magnesium binding s 86.48
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 86.46
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 86.36
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 86.31
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 86.31
2hbv_A334 2-amino-3-carboxymuconate 6-semialdehyde decarbox; 86.29
3tcs_A388 Racemase, putative; PSI-biology, nysgrc, structura 86.28
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 86.23
3q94_A288 Fructose-bisphosphate aldolase, class II; structur 86.19
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 86.15
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 86.14
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 86.14
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 86.12
1jfl_A228 Aspartate racemase; alpha-beta structure, HOMO-dim 86.08
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 86.05
4dzi_A423 Putative TIM-barrel metal-dependent hydrolase; ami 85.98
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 85.92
3out_A268 Glutamate racemase; structural genomics, center fo 85.87
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 85.81
3tml_A288 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 85.76
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 85.72
2oho_A273 Glutamate racemase; isomerase; 2.25A {Streptococcu 85.67
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 85.59
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 85.45
3cjp_A272 Predicted amidohydrolase, dihydroorotase family; s 85.42
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 85.39
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 85.37
1b73_A254 Glutamate racemase; isomerase; 2.30A {Aquifex pyro 85.2
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 85.18
2y5s_A294 DHPS, dihydropteroate synthase; transferase, folat 85.05
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 84.97
3uhf_A274 Glutamate racemase; structural genomics, center fo 84.94
3rmj_A370 2-isopropylmalate synthase; LEUA, truncation, neis 84.89
2f6k_A307 Metal-dependent hydrolase; metal dependent hydroly 84.84
1vli_A385 Spore coat polysaccharide biosynthesis protein SP; 84.79
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 84.72
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 84.71
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 84.68
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 84.57
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 84.54
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 84.53
1zuw_A272 Glutamate racemase 1; (R)-glutamate, peptidoglycan 84.42
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
Probab=100.00  E-value=2.4e-97  Score=717.82  Aligned_cols=278  Identities=45%  Similarity=0.778  Sum_probs=243.9

Q ss_pred             ccccccCCCCCCCCCCCCCCCCCCCCCHHHHHHhhhCCCcEEEEecCChHHHHHHHHcCCCEEEecchhhhhhccCCCCc
Q 016682           54 LVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTL  133 (384)
Q Consensus        54 ~~r~~s~~~~~~~~~~~~~~~~~~~~t~~~lr~~k~~g~~I~mlTAyD~~sA~iae~AGiD~IlVGDSl~mv~lG~~dT~  133 (384)
                      ++|+++++|.    + ..   +++|+|+.+|+++|++|+||+|+||||++||+++|++|||+||||||++|+++||+||+
T Consensus         4 ~~~~~~~~~~----~-~~---~~~~~t~~~lr~~k~~g~~i~~~tayDa~sA~l~e~aG~d~ilvGdSl~~~~lG~~dt~   75 (281)
T 1oy0_A            4 QTIYGANTPG----G-SG---PRTKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTV   75 (281)
T ss_dssp             ----------------------CCCCCHHHHHHHHHHTCCEEEEECCSHHHHHHHHTTTCCEEEECTTHHHHTTCCSSSS
T ss_pred             ccccCCCCCC----C-CC---CCCCcCHHHHHHHHhCCCcEEEEeCcCHHHHHHHHHcCCCEEEECHHHHHHHcCCCCCC
Confidence            4567777664    2 11   24679999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHcccCCCcEEEeCCCCCCcCCHHHHHHHHHHHHHHhCCCEEEeCCCccchHHHHHHHHHcCCceee
Q 016682          134 PITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMG  213 (384)
Q Consensus       134 ~VtldeMl~h~raV~Rga~~~~vvaDmPfgsY~~s~e~av~nA~rl~keaGAdaVKLEgg~~e~~~~I~alv~aGIPV~g  213 (384)
                      +||+|||++|+++|+|++++|||++|||||||+.|++++++|+.|+|+|+||++|||||| .|++++|++++++||||||
T Consensus        76 ~vTldemi~h~~aV~r~~~~~~vvaD~pfgsy~~s~~~a~~na~rl~~eaGa~aVklEdg-~e~~~~I~al~~agIpV~g  154 (281)
T 1oy0_A           76 PISIDELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATRFLKDGGAHAVKLEGG-ERVAEQIACLTAAGIPVMA  154 (281)
T ss_dssp             SCCGGGTHHHHHHHHHHCTTSEEEEECCTTSSTTCHHHHHHHHHHHHHTTCCSEEEEEBS-GGGHHHHHHHHHHTCCEEE
T ss_pred             CCCHHHHHHHHHHHHhcCCCCeEEEECCCCcccCCHHHHHHHHHHHHHHhCCeEEEECCc-HHHHHHHHHHHHCCCCEEe
Confidence            999999999999999999999999999999998899999999999999899999999999 9999999999999999999


Q ss_pred             eccCCcccccccCCccccCCCHHHHHHHHHHHHHHHHcCCcEEEecCCCHHHHHHHHhhcCCCEEEEcCCCCCCchhhhH
Q 016682          214 HVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVY  293 (384)
Q Consensus       214 HiGLtPQ~~~~lgGfrvqGrt~~~a~~ll~rAkAleeAGAf~IvlE~Vp~ela~~It~~l~IPtIGIGAG~~cDGQvLV~  293 (384)
                      |||||||+++++|||++||||+ +++++|+||++|++||||+||+||+|.+++++|+++++|||||||||++|||||||+
T Consensus       155 HiGLtPqsv~~~ggf~v~grt~-~a~~~i~rA~a~~eAGA~~ivlE~vp~~~a~~it~~l~iP~igIGaG~~~dgQvLV~  233 (281)
T 1oy0_A          155 HIGFTPQSVNTLGGFRVQGRGD-AAEQTIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVW  233 (281)
T ss_dssp             EEECCC--------------CH-HHHHHHHHHHHHHHHTCSEEEEESCCHHHHHHHHHHCSSCEEEESSCSCSSEEEECH
T ss_pred             eecCCcceecccCCeEEEeCcH-HHHHHHHHHHHHHHcCCcEEEEecCCHHHHHHHHHhCCCCEEEeCCCCCCCcceeeH
Confidence            9999999999999999999999 999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhcCCCCCCCCCCCcchhhhhhhhHHHHHHHHHHHHHHhccCCCCCCCCCCc
Q 016682          294 HDLLGMMQHPHHAKVTPKFCKQFARVGDVINKALLEYKEEVTNGSFPGPSHSPY  347 (384)
Q Consensus       294 ~DlLG~~~~P~~~~~~PkFvk~y~~~~~~~~~A~~~y~~eV~~g~FP~~~h~~y  347 (384)
                      |||||++     .++.|||+|+|+|+++.+.+|+++|++|||+|.||.++|+ |
T Consensus       234 ~D~lG~~-----~~~~pkf~k~y~~~~~~~~~a~~~y~~~V~~~~fP~~~h~-~  281 (281)
T 1oy0_A          234 QDMAGFS-----GAKTARFVKRYADVGGELRRAAMQYAQEVAGGVFPADEHS-F  281 (281)
T ss_dssp             HHHTTCS-----CSCCCTTCCCCCCHHHHHHHHHHHHHHHHHTTCSSCSCC---
T ss_pred             hhhcCCC-----CCCCCCchhhhhhhHHHHHHHHHHHHHHHhcCCCCCcccC-C
Confidence            9999999     5789999999999999999999999999999999999998 6
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>3i4e_A Isocitrate lyase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.69A {Burkholderia pseudomallei} Back     alignment and structure
>3eol_A Isocitrate lyase; seattle structural center for infectious disease, ssgcid; 2.00A {Brucella melitensis} PDB: 3oq8_A 3e5b_A 3p0x_A* Back     alignment and structure
>1f8m_A Isocitrate lyase, ICL; alpha-beta barrel, helix-swapping, closed conformation, bromopyuvate modification, structural genomics; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.1.12.7 PDB: 1f61_A 1f8i_A Back     alignment and structure
>3lg3_A Isocitrate lyase; conserved, CD, proteomics evidence (cytopl periplasmic), drug target functions; 1.40A {Yersinia pestis} SCOP: c.1.12.7 PDB: 1igw_A Back     alignment and structure
>1dqu_A Isocitrate lyase; beta barrel; 2.80A {Emericella nidulans} SCOP: c.1.12.7 Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>3i4e_A Isocitrate lyase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.69A {Burkholderia pseudomallei} Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1lt8_A Betaine-homocysteine methyltransferase; homocysteine metabolism, homocysteinemia, zinc, thiol alkyl transfer; HET: CBH CIT; 2.05A {Homo sapiens} SCOP: c.1.26.1 PDB: 1lt7_A* 1umy_A Back     alignment and structure
>2eq5_A 228AA long hypothetical hydantoin racemase; structural genomics, NPPSFA, national project on P structural and functional analyses; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>2dwu_A Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis} Back     alignment and structure
>4djd_D C/Fe-SP, corrinoid/iron-sulfur protein small subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_D* 4djf_D* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>3tfx_A Orotidine 5'-phosphate decarboxylase; PSI-biology, nysgrc, 000529, structural genomics, NEW YORK S genomics research consortium; 2.19A {Lactobacillus acidophilus} Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>2nwr_A 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KDO8P, KDO8PS, PEP, A5P, transferase; HET: PEP; 1.50A {Aquifex aeolicus} PDB: 2nws_A* 2nx1_A* 3e0i_A* 1fwn_A* 1fwt_A* 1fws_A* 1fx6_A 1fww_A 1fxq_A* 1fy6_A* 1jcx_A* 1jcy_A* 1pck_A* 1pcw_A* 1fxp_A* 2a21_A* 2a2i_A* 1pe1_A* 3e12_A* 2nx3_A* ... Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 KDO8PS; 1.75A {Neisseria meningitidis serogroup B} PDB: 3stf_A 3qpy_A 3ste_A 3qpz_A 3qq0_A 3fyo_A* 3qq1_A 3fyp_A* 3stc_A 3stg_A 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>3lg3_A Isocitrate lyase; conserved, CD, proteomics evidence (cytopl periplasmic), drug target functions; 1.40A {Yersinia pestis} SCOP: c.1.12.7 PDB: 1igw_A Back     alignment and structure
>1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>2fiq_A Putative tagatose 6-phosphate kinase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics; 2.25A {Escherichia coli} SCOP: c.1.10.7 Back     alignment and structure
>1zuw_A Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesi isomerase; HET: DGL; 1.75A {Bacillus subtilis} Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>1w5q_A Delta-aminolevulinic acid dehydratase; synthase, evolution, metalloenzyme, porphobilinogen synthase, protein engineering,; 1.4A {Pseudomonas aeruginosa} PDB: 1w5p_A* 1w5o_A 1w5n_A 1w56_A 1w5m_A 1w54_A 1gzg_A* 1b4k_A 2woq_A* 2c14_A* 2c16_A* 2c19_A* 2c15_A* 2c18_A* 2c13_A* Back     alignment and structure
>3txv_A Probable tagatose 6-phosphate kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1l6s_A Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli} SCOP: c.1.10.3 PDB: 1i8j_A* 1l6y_A* 1b4e_A Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>3ij6_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structure initiative; 2.00A {Lactobacillus acidophilus} Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>3eol_A Isocitrate lyase; seattle structural center for infectious disease, ssgcid; 2.00A {Brucella melitensis} PDB: 3oq8_A 3e5b_A 3p0x_A* Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>2vvt_A Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A* Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>1f8m_A Isocitrate lyase, ICL; alpha-beta barrel, helix-swapping, closed conformation, bromopyuvate modification, structural genomics; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.1.12.7 PDB: 1f61_A 1f8i_A Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>2pcq_A Putative dihydrodipicolinate synthase; lyase, lysine biosynthesis, dihydrodipicoliante, S genomics, NPPSFA; 2.10A {Thermus thermophilus} Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>4hb7_A Dihydropteroate synthase; transferase; 1.95A {Staphylococcus aureus} PDB: 1ad1_A 1ad4_A* Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1h7n_A 5-aminolaevulinic acid dehydratase; lyase, aldolase, TIM barrel, tetrapyrrole synthesis; HET: SHF; 1.6A {Saccharomyces cerevisiae} SCOP: c.1.10.3 PDB: 1h7p_A* 1h7r_A* 1ohl_A* 1qml_A 1qnv_A 1w31_A* 1h7o_A* 1eb3_A* 1gjp_A* 1ylv_A* 1aw5_A Back     alignment and structure
>3qvl_A Putative hydantoin racemase; isomerase; HET: 5HY; 1.82A {Klebsiella pneumoniae subsp} PDB: 3qvk_A* 3qvj_A Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>3nur_A Amidohydrolase; TIM barrel; 1.75A {Staphylococcus aureus} Back     alignment and structure
>3obk_A Delta-aminolevulinic acid dehydratase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; HET: PBG; 2.50A {Toxoplasma gondii ME49} Back     alignment and structure
>3out_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, MURI, cell envelope; HET: MSE DGL; 1.65A {Francisella tularensis subsp} Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>3tr2_A Orotidine 5'-phosphate decarboxylase; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.00A {Coxiella burnetii} Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>2jfq_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus} Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>1pv8_A Delta-aminolevulinic acid dehydratase; porphobilinogen synthase, tetrapyrrole biosynthesis, reactio intermediate, lyase; HET: PB1; 2.20A {Homo sapiens} SCOP: c.1.10.3 PDB: 1e51_A* 2z0i_A 2z1b_A Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>4inf_A Metal-dependent hydrolase; amidohydrolase, metal binding site, enzyme functi initiative, EFI; 1.48A {Novosphingobium aromaticivorans} PDB: 4ing_A* Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>2dgd_A 223AA long hypothetical arylmalonate decarboxylas; octamer, alpha/beta structure, lyase; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>2xed_A Putative maleate isomerase; nicotinic acid catabolism, cofactor-independent CIS-trans isomerase; 1.95A {Nocardia farcinica} PDB: 2xec_A Back     alignment and structure
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>1w1z_A Delta-aminolevulinic acid dehydratase; synthase, tetrapyrrole biosynthesis, ALAD, porphyrin biosynt heme biosynthesis, lyase; 2.6A {Prosthecochloris vibrioformis} SCOP: c.1.10.3 PDB: 2c1h_A* Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>3sz8_A 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Burkholderia pseudomallei} PDB: 3tmq_A* 3und_A* Back     alignment and structure
>3fst_A 5,10-methylenetetrahydrofolate reductase; TIM barrel, flavin, amino-acid biosynthesis, FAD, flavoprotein, methionine biosynthesis, NAD; HET: FAD MRY; 1.65A {Escherichia coli k-12} PDB: 3fsu_A* 1zp3_A* 1zpt_A* 1zrq_A* 1zp4_A* 2fmn_A* 2fmo_A* 1b5t_A* Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_B* Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>2gwg_A 4-oxalomesaconate hydratase; TIM-barrel like protein, structural genomics, PSI, protein S initiative; 1.80A {Rhodopseudomonas palustris} SCOP: c.1.9.15 Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>4ay7_A Methylcobalamin\: coenzyme M methyltransferase; TIM barrel; 1.80A {Methanosarcina mazei} PDB: 4ay8_A Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3qvl_A Putative hydantoin racemase; isomerase; HET: 5HY; 1.82A {Klebsiella pneumoniae subsp} PDB: 3qvk_A* 3qvj_A Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>3s81_A Putative aspartate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta fold, cytosol; 1.80A {Salmonella enterica subsp} PDB: 3s7z_A Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>3ojc_A Putative aspartate/glutamate racemase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 1.75A {Yersinia pestis} Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2zsk_A PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>1w1z_A Delta-aminolevulinic acid dehydratase; synthase, tetrapyrrole biosynthesis, ALAD, porphyrin biosynt heme biosynthesis, lyase; 2.6A {Prosthecochloris vibrioformis} SCOP: c.1.10.3 PDB: 2c1h_A* Back     alignment and structure
>3vc5_A Mandelate racemase/muconate lactonizing protein; dehydratase, magnesium binding, enzyme function initiative, enolase, isomerase; 1.50A {Thermobispora bispora} PDB: 3vc6_A 4dhg_A Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} Back     alignment and structure
>2eq5_A 228AA long hypothetical hydantoin racemase; structural genomics, NPPSFA, national project on P structural and functional analyses; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>2jfz_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A* Back     alignment and structure
>1l6s_A Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli} SCOP: c.1.10.3 PDB: 1i8j_A* 1l6y_A* 1b4e_A Back     alignment and structure
>3vdg_A Probable glucarate dehydratase; enolase, magnesium binding site, lyase; 1.90A {Mycobacterium smegmatis str} PDB: 3vfc_A* Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>3apt_A Methylenetetrahydrofolate reductase; TIM barrel, oxidoreductase, flavin; HET: FAD; 1.85A {Thermus thermophilus} PDB: 3apy_A* 1v93_A* Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>2vef_A Dihydropteroate synthase; antibiotic resistance, transferase, folate biosynthesis; 1.8A {Streptococcus pneumoniae} PDB: 2veg_A* Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2wm1_A 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; neurological disorders, metal-dependent amidohydrolase, kynurenine pathway; HET: 13P; 2.01A {Homo sapiens} Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>3ist_A Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A* Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>2pcq_A Putative dihydrodipicolinate synthase; lyase, lysine biosynthesis, dihydrodipicoliante, S genomics, NPPSFA; 2.10A {Thermus thermophilus} Back     alignment and structure
>3va8_A Probable dehydratase; enolase, magnesium binding site, lyase; 2.00A {Gibberella zeae} Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>2hbv_A 2-amino-3-carboxymuconate 6-semialdehyde decarbox; ACMSD, TIM-barrel, decarboxylase, metaloenzyme, lyase; 1.65A {Pseudomonas fluorescens} SCOP: c.1.9.15 PDB: 2hbx_A Back     alignment and structure
>3tcs_A Racemase, putative; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, TIM barrel; HET: PG4; 1.88A {Roseobacter denitrificans} PDB: 3u4f_A 3t9p_A 3t8q_A Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>1jfl_A Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomer; 1.90A {Pyrococcus horikoshii} SCOP: c.78.2.1 c.78.2.1 PDB: 2dx7_A* 1iu9_A Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>4dzi_A Putative TIM-barrel metal-dependent hydrolase; amidohydrolase, bimetal binding site, enzyme FUNC initiative, EFI; HET: SO4; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>3out_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, MURI, cell envelope; HET: MSE DGL; 1.65A {Francisella tularensis subsp} Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>3tml_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.90A {Burkholderia cenocepacia} PDB: 3t4c_A Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>2oho_A Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A* Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3cjp_A Predicted amidohydrolase, dihydroorotase family; structural genomics, protein structure initiative; 1.85A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1b73_A Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus} SCOP: c.78.2.1 c.78.2.1 PDB: 1b74_A* Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>2y5s_A DHPS, dihydropteroate synthase; transferase, folate biosynthesis; HET: 78H; 1.95A {Burkholderia cenocepacia} PDB: 2y5j_A* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>3uhf_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich fold, isomerase; HET: DGL; 1.83A {Campylobacter jejuni} PDB: 3uho_A* 3uhp_A Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>2f6k_A Metal-dependent hydrolase; metal dependent hydrolyse, aminohydro_2, ACMDS, ACMS, trypto metabolism, quinolinic acid, QUIN; 2.50A {Lactobacillus plantarum} SCOP: c.1.9.15 Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>1zuw_A Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesi isomerase; HET: DGL; 1.75A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 384
d1oy0a_262 c.1.12.8 (A:) Ketopantoate hydroxymethyltransferas 3e-70
d1m3ua_262 c.1.12.8 (A:) Ketopantoate hydroxymethyltransferas 1e-69
d1o66a_260 c.1.12.8 (A:) Ketopantoate hydroxymethyltransferas 8e-67
d2p10a1197 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 1e-07
d1muma_289 c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichi 6e-06
d1s2wa_275 c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mus 1e-04
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 262 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Phosphoenolpyruvate/pyruvate domain
family: Ketopantoate hydroxymethyltransferase PanB
domain: Ketopantoate hydroxymethyltransferase PanB
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score =  219 bits (559), Expect = 3e-70
 Identities = 114/267 (42%), Positives = 161/267 (60%), Gaps = 7/267 (2%)

Query: 78  RVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITL 137
           ++   HL++   +G    M+TAYDY +A   D AGI + LVGDSAA VV+G+DTT+PI++
Sbjct: 3   KIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISI 62

Query: 138 EEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSR 197
           +E++   R V RGA   L+V DLPFG+YE+    A+  A R LK+GG  A+K   G    
Sbjct: 63  DELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATRFLKDGGAHAVK-LEGGERV 121

Query: 198 ITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVV 257
                 +  AGI VM H+G TPQ+++ LGGFR QG+   +   + +  +A+ E G F+VV
Sbjct: 122 AEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRGDAAEQTIADA-IAVAEAGAFAVV 180

Query: 258 LECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQFA 317
           +E VP  +A   T  L IPT+GIGAGP C GQVLV+ D+ G          T +F K++A
Sbjct: 181 MEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVWQDMAGFSGAK-----TARFVKRYA 235

Query: 318 RVGDVINKALLEYKEEVTNGSFPGPSH 344
            VG  + +A ++Y +EV  G FP   H
Sbjct: 236 DVGGELRRAAMQYAQEVAGGVFPADEH 262
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Length = 262 Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Length = 260 Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Length = 197 Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Length = 289 Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Length = 275 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query384
d1oy0a_262 Ketopantoate hydroxymethyltransferase PanB {Mycoba 100.0
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 100.0
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 100.0
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 99.96
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 99.95
d1f61a_418 Isocitrate lyase {Mycobacterium tuberculosis [TaxI 99.78
d1igwa_416 Isocitrate lyase {Escherichia coli [TaxId: 562]} 99.75
d2p10a1197 Uncharacterized protein Mll9387 {Mesorhizobium lot 99.71
d1dqua_ 519 Isocitrate lyase {Aspergillus nidulans [TaxId: 162 99.17
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 96.96
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 96.15
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 96.1
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 96.0
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 95.97
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 95.96
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 95.96
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 95.89
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 95.83
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 95.75
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 95.59
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 95.49
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 95.36
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 95.19
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 95.08
d1izca_299 Macrophomate synthase {Macrophoma commelinae [TaxI 95.02
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 94.91
d1jfla1115 Aspartate racemase {Archaeon Pyrococcus horikoshii 94.75
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 94.7
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 94.55
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 94.5
d1w3ia_293 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus 94.43
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 94.39
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 94.39
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 94.38
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 94.11
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 94.02
d2c1ha1319 5-aminolaevulinate dehydratase, ALAD (porphobilino 93.91
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 93.52
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 93.45
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 93.24
d2dvta1325 Thermophilic reversible gamma-resorcylate decarbox 93.22
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 93.17
d2f6ka1306 Putative amidohydrolase LP2961 {Lactobacillus plan 92.93
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 92.85
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 92.81
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 92.72
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 92.7
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 92.6
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 92.53
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 92.35
d1qwga_251 (2r)-phospho-3-sulfolactate synthase ComA {Archaeo 92.28
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 92.28
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 92.26
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 92.11
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 92.09
d2gwga1342 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas 92.05
d1gzga_329 5-aminolaevulinate dehydratase, ALAD (porphobilino 91.6
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 91.57
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 91.47
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 91.38
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 91.21
d1lt7a_361 Betaine-homocysteine S-methyltransferase {Human (H 91.2
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 91.1
d2c1ha1319 5-aminolaevulinate dehydratase, ALAD (porphobilino 91.1
d1gzga_329 5-aminolaevulinate dehydratase, ALAD (porphobilino 90.92
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 90.9
d2hbva1331 2-amino-3-carboxymuconate 6-semialdehyde decarboxy 90.85
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 90.72
d1oy0a_262 Ketopantoate hydroxymethyltransferase PanB {Mycoba 90.35
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 90.22
d1l6sa_323 5-aminolaevulinate dehydratase, ALAD (porphobilino 89.99
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 89.95
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 89.43
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 89.35
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 88.4
d1h7na_340 5-aminolaevulinate dehydratase, ALAD (porphobilino 88.21
d1igwa_416 Isocitrate lyase {Escherichia coli [TaxId: 562]} 88.01
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 88.01
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 87.72
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 87.4
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 87.4
d1h7na_340 5-aminolaevulinate dehydratase, ALAD (porphobilino 86.95
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 86.89
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 86.77
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 86.45
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 86.42
d1v93a_292 Methylenetetrahydrofolate reductase {Thermus therm 86.3
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 86.07
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 85.83
d1lt7a_361 Betaine-homocysteine S-methyltransferase {Human (H 85.53
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 84.03
d1pv8a_320 5-aminolaevulinate dehydratase, ALAD (porphobilino 83.47
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 83.4
d1u83a_249 (2r)-phospho-3-sulfolactate synthase ComA {Bacillu 83.37
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 83.33
d1ad1a_264 Dihydropteroate synthetase {Staphylococcus aureus 83.32
d1pv8a_320 5-aminolaevulinate dehydratase, ALAD (porphobilino 83.31
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 82.88
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 82.72
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 82.14
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 81.97
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 81.71
d2mnra1227 Mandelate racemase {Pseudomonas putida [TaxId: 303 81.66
d1sfla_236 Type I 3-dehydroquinate dehydratase {Staphylococcu 80.3
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 80.29
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 80.04
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 80.04
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Phosphoenolpyruvate/pyruvate domain
family: Ketopantoate hydroxymethyltransferase PanB
domain: Ketopantoate hydroxymethyltransferase PanB
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=1.8e-95  Score=696.62  Aligned_cols=262  Identities=45%  Similarity=0.794  Sum_probs=242.7

Q ss_pred             CCCCCHHHHHHhhhCCCcEEEEecCChHHHHHHHHcCCCEEEecchhhhhhccCCCCcCCCHHHHHHHHHHHHcccCCCc
Q 016682           76 NQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPL  155 (384)
Q Consensus        76 ~~~~t~~~lr~~k~~g~~I~mlTAyD~~sA~iae~AGiD~IlVGDSl~mv~lG~~dT~~VtldeMl~h~raV~Rga~~~~  155 (384)
                      ++|+|+.+|+++|++|+||+|+||||+++|+++|++|+|+||||||+||+++||++|.+||+|||++|+++|+||++++|
T Consensus         1 r~k~ti~~l~~~K~~g~ki~~lTaYD~~~A~~~~~agiDiiLVGDSlgmv~~G~~~T~~Vt~d~m~~H~~aV~rga~~~~   80 (262)
T d1oy0a_           1 RTKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLVRGVVRGAPHAL   80 (262)
T ss_dssp             CCCCCHHHHHHHHHHTCCEEEEECCSHHHHHHHHTTTCCEEEECTTHHHHTTCCSSSSSCCGGGTHHHHHHHHHHCTTSE
T ss_pred             CCcccHHHHHHHHhCCCcEEEEeCCCHHHHHHHHHcCCCEEEEcCchhhhhcCCCCcceeeHHHHHHHHHHHHhccccce
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeCCCCCCcCCHHHHHHHHHHHHHHhCCCEEEeCCCccchHHHHHHHHHcCCceeeeccCCcccccccCCccccCCCH
Q 016682          156 LVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNV  235 (384)
Q Consensus       156 vvaDmPfgsY~~s~e~av~nA~rl~keaGAdaVKLEgg~~e~~~~I~alv~aGIPV~gHiGLtPQ~~~~lgGfrvqGrt~  235 (384)
                      +++|||||+|+.|++++++||.|+++++||++|||||+ .+..+.|++|+++|||||||||||||+.+++||||+|||++
T Consensus        81 iv~DmPf~s~~~s~~~a~~nA~r~~~~~ga~avkleg~-~~~~~~I~~L~~~gIPV~gHiGLtPQ~~~~~Gg~r~~Gk~~  159 (262)
T d1oy0a_          81 VVADLPFGSYEAGPTAALAAATRFLKDGGAHAVKLEGG-ERVAEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRGD  159 (262)
T ss_dssp             EEEECCTTSSTTCHHHHHHHHHHHHHTTCCSEEEEEBS-GGGHHHHHHHHHHTCCEEEEEECCC--------------CH
T ss_pred             eEecchhhhcccchHHHHHHHHHHHhccccceeeechh-hhhHHHHHHHHhcCCceEEeeeecceeeeecCccceeccch
Confidence            99999999999999999999999999999999999999 89999999999999999999999999999999999999996


Q ss_pred             HHHHHHHHHHHHHHHcCCcEEEecCCCHHHHHHHHhhcCCCEEEEcCCCCCCchhhhHhhhhcCCCCCCCCCCCcchhhh
Q 016682          236 TSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVLVYHDLLGMMQHPHHAKVTPKFCKQ  315 (384)
Q Consensus       236 ~~a~~ll~rAkAleeAGAf~IvlE~Vp~ela~~It~~l~IPtIGIGAG~~cDGQvLV~~DlLG~~~~P~~~~~~PkFvk~  315 (384)
                      + +.+++++|++||+||||+|+|||||++++++||++++|||||||||++|||||||+|||||++     +++.|||+|+
T Consensus       160 ~-~~~l~~da~~le~AGa~~ivlE~Vp~~la~~It~~~~IPtIGIGAG~~cDGQvLV~~DiLG~~-----~~~~Pkf~K~  233 (262)
T d1oy0a_         160 A-AEQTIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVWQDMAGFS-----GAKTARFVKR  233 (262)
T ss_dssp             H-HHHHHHHHHHHHHHTCSEEEEESCCHHHHHHHHHHCSSCEEEESSCSCSSEEEECHHHHTTCS-----CSCCCTTCCC
T ss_pred             h-hhHhHHHHHHHHhCCcEEEecccccHhHHHHHHhhCCceEEEeccCCCCCeeEEeHHhhhCCC-----CCCCCchHHH
Confidence            5 579999999999999999999999999999999999999999999999999999999999999     5788999999


Q ss_pred             hhhhHHHHHHHHHHHHHHhccCCCCCCCC
Q 016682          316 FARVGDVINKALLEYKEEVTNGSFPGPSH  344 (384)
Q Consensus       316 y~~~~~~~~~A~~~y~~eV~~g~FP~~~h  344 (384)
                      |+|+++.+.+|+++|++||++|.||+++|
T Consensus       234 y~~~~~~~~~A~~~y~~~V~~g~FP~~eh  262 (262)
T d1oy0a_         234 YADVGGELRRAAMQYAQEVAGGVFPADEH  262 (262)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHTTCSSCSCC
T ss_pred             HhhHHHHHHHHHHHHHHHHhcCCCCCcCC
Confidence            99999999999999999999999999988
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1f61a_ c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1igwa_ c.1.12.7 (A:) Isocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1dqua_ c.1.12.7 (A:) Isocitrate lyase {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jfla1 c.78.2.1 (A:1-115) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c1ha1 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2dvta1 c.1.9.15 (A:1-325) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2f6ka1 c.1.9.15 (A:2-307) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gwga1 c.1.9.15 (A:1-342) 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1gzga_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lt7a_ c.1.26.1 (A:) Betaine-homocysteine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2c1ha1 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]} Back     information, alignment and structure
>d1gzga_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2hbva1 c.1.9.15 (A:3-333) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1l6sa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h7na_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1igwa_ c.1.12.7 (A:) Isocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h7na_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v93a_ c.1.23.1 (A:) Methylenetetrahydrofolate reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lt7a_ c.1.26.1 (A:) Betaine-homocysteine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u83a_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1sfla_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure