Citrus Sinensis ID: 016726

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380----
MDIKLQLEGAESNLEMGSLDDRSMHEFEDESLFTPEAESEKIQRVHGLQNGSVSGDFPSSGNKILQNSVCRSIKTVVFSNKLNLLMPFGPLAIMVHNLTGHKGWVFFLSLLGITPLAERLGYATEQLTFFTGATVGGLLNATFGNATELIISIYALKSGMIRVVQLSLLGSILSNMLLVLGCAFFCGGLICCKKEQVFNKASAVVNSGLLLMAVMGLVFPAVLHYTHTEVHFGKSELALSRFSSCIMLVAYGAYLFFQLRGQTELYVPLSEDENQTGNDADHGGNHDDNEAPEISKWESLIWLAIMTAWISILSQYVVDAIEVTFGFSTSLCCSDVYHKISMVYDFMDNCPPLFIICDGKWVLRLGNTRTPPPPFFLCYAVNVF
ccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHHHHHcccccCEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEccccccccHHHHHHHccccEEEECccccccccEEEEEEEEcc
***************************************************************ILQNSVCRSIKTVVFSNKLNLLMPFGPLAIMVHNLTGHKGWVFFLSLLGITPLAERLGYATEQLTFFTGATVGGLLNATFGNATELIISIYALKSGMIRVVQLSLLGSILSNMLLVLGCAFFCGGLICCKKEQVFNKASAVVNSGLLLMAVMGLVFPAVLHYTHTEVHFGKSELALSRFSSCIMLVAYGAYLFFQLRGQTELYVPLSEDENQTGNDADHGGNHDDNEAPEISKWESLIWLAIMTAWISILSQYVVDAIEVTFGFSTSLCCSDVYHKISMVYDFMDNCPPLFIICDGKWVLRLGNTRTPPPPFFLCYAVNVF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIKLQLEGAESNLEMGSLDDRSMHEFEDESLFTPEAESEKIQRVHGLQNGSVSGDFPSSGNKILQNSVCRSIKTVVFSNKLNLLMPFGPLAIMVHNLTGHKGWVFFLSLLGITPLAERLGYATEQLTFFTGATVGGLLNATFGNATELIISIYALKSGMIRVVQLSLLGSILSNMLLVLGCAFFCGGLICCKKEQVFNKASAVVNSGLLLMAVMGLVFPAVLHYTHTEVHFGKSELALSRFSSCIMLVAYGAYLFFQLRGQTELYVPLSEDENQTGNDADHGGNHDDNEAPEISKWESLIWLAIMTAWISILSQYVVDAIEVTFGFSTSLCCSDVYHKISMVYDFMDNCPPLFIICDGKWVLRLGNTRTPPPPFFLCYAVNVF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar cation/proton exchanger 5 Vacuolar cation/proton exchanger (CAX). Translocates Ca(2+) and other metal ions into vacuoles using the proton gradient formed by H(+)-ATPase and H(+)-pyrophosphatase.probableQ8L783
Vacuolar cation/proton exchanger 3 Vacuolar cation/proton exchanger (CAX). Translocates Ca(2+) and other metal ions into vacuoles using the proton gradient formed by H(+)-ATPase and H(+)-pyrophosphatase.probableQ6K1C4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V5U, chain A
Confidence level:very confident
Coverage over the Query: 117-223,236-264,291-369
View the alignment between query and template
View the model in PyMOL