Citrus Sinensis ID: 016781

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380---

MGAGGRMAVPSTPMKVDSDPLKRVPCSKPPFTLSQVKKAIPPHCFERSVLRSFSYVVHDLTIAFVFYYIADTYIHQLPHPLSYLAWPVYWALQGCILTGVWVVAHECGHHAFSDYQWLDDTVGLILHSCLLVPYFSWKYSHRRHHSNTGSLDRDEVFVPKQKTAIGWYAKYLNNPLGRVITLTVTLTLGWPLYLAFNVSGRPYDRFACHFDPYGPIYSDRERLQIFISDAGILAMIYSLYCLVAAKGLVYVFCIYGGPLLVVNGFLVLITLLQHTHPSLPHYHSSEWDWFRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQFDGTPFYKAMWREAKECLYVEPDEGDQNKGVFWYRNKI

ccccccccccccccccccccccccccccccccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHccccEEEccccccccccEEEEEccc

****************************PPFTLSQVKKAIPPHCFERSVLRSFSYVVHDLTIAFVFYYIADTYIHQLPHPLSYLAWPVYWALQGCILTGVWVVAHECGHHAFSDYQWLDDTVGLILHSCLLVPYFSWKYSHRRHHSNTGSLDRDEVFVPKQKTAIGWYAKYLNNPLGRVITLTVTLTLGWPLYLAFNVSGRPYDRFACHFDPYGPIYSDRERLQIFISDAGILAMIYSLYCLVAAKGLVYVFCIYGGPLLVVNGFLVLITLLQHTHPSLPHYHSSEWDWFRGALATVDRDYGILNKVFHNITDTHVAHHLFSTMPHYHAMEATKAIKPILGEYYQFDGTPFYKAMWREAKECLYVEPDEGDQNKGVFWYRNKI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 2	ER (microsomal) omega-6 fatty acid desaturase introduces the second double bond in the biosynthesis of 18:3 fatty acids, important constituents of plant membranes. It is thought to use cytochrome b5 as an electron donor and to act on fatty acids esterified to phosphatidylcholine and, possibly, other phospholipids.	confident	P48631
Omega-6 fatty acid desaturase, endoplasmic reticulum	ER (microsomal) omega-6 fatty acid desaturase introduces the second double bond in the biosynthesis of 18:3 fatty acids, important constituents of plant membranes. It is thought to use cytochrome b5 as an electron donor and to act on fatty acids esterified to phosphatidylcholine and, possibly, other phospholipids.	confident	P46313
Omega-6 fatty acid desaturase, endoplasmic reticulum	ER (microsomal) omega-6 fatty acid desaturase introduces the second double bond in the biosynthesis of 18:3 fatty acids, important constituents of plant membranes. It is thought to use cytochrome b5 as an electron donor and to act on fatty acids esterified to phosphatidylcholine and, possibly, other phospholipids.	probable	Q39287

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted