Citrus Sinensis ID: 016795

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380--
MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIARFFLWKHGFWWRMRCAG
ccHHHHHHHHHHHHHHHcEEcccccccccccccEEEEEEEcccccEEEEEEcccccccccccEEEEEEcccccccccEEEEEccccccccccccccccccccccccccccEEEEcccccccEEEccEEEEEEEEEccccEEEEEEEccccccEEEEEEccccccccccccccEEEEcccccEEEEEEEEcccccccccEEEEEcccccccEEccccEEEEcccccccccccccccccccEEEEEEcccccccEEEEEccEEccccccccccEEEEEccccccccccEEEEEEcccccccccccccccccccccHHHHHHHHHHcccccEEEEEccEEcccccHHHHHHHHHHHHHHHccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHcccccccccHEEEEEEEEEcccccEEEEccHHcccccccccEEEEEEcccccccccEEEEEccccccccccccccccccccccccccEEEEEEEcccccccccccEEEEEEEEEccccEEEEEEEccccccEEEEEcccEEEccccccccEEEEEcccccEEEEEEEcccccccccEEEEEcccccccEEcccccEEEcccccccccccccccccccEEEEEEEcccccccEEEEEEcccccccccccccEEEEEcccccccccccEEEEEEcccccccccccHHHHcccccHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHccccEEEcccccccccccccccccc
MRELRSICLGILLVLGAFRltishedqplskIAIHKAVFalddnayikaspsilgmkgqnsdwltveynspnpsvgdwigvfspsnfssstcpaenprvyppllcsapikfqyanysspqykstgkgslkLQLINQRSDFSFVLftngllnpkVVAVSNkvtftnpnapvyprlaqgkvwNEMTVTWTsgygineaepfvewgpkggdrtyspagtltfgrgsmcgapartvgwrdpgyihtgflrelwpnamytYKLGHRLFNGTYiwsseyqfkaspypgqdslqQVIIFGdmgkdeadgsneynnfqrgslNTTRQLIQDLKNIDIVFHIGDIcyangyisqwDQFTAqiepiastvPYMIARFFLWKHGFWWRMRCAG
MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVtftnpnapvyprlaqgkvWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIARFFLWKHGFWWRMRCAG
MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIARFFLWKHGFWWRMRCAG
****RSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNF****C*AENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDM****************GSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIARFFLWKHGFWWRMRC**
**ELRSICLGILLVLGAFRLTI***DQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIARFFLWKHGFWWRM*C**
MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSN********ENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIARFFLWKHGFWWRMRCAG
*RELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIARFFLWKHGFWWRMR***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQNSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSPQYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIASTVPYMIARFFLWKHGFWWRMRCAG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query382 2.2.26 [Sep-21-2011]
Q9LMX4 613 Probable inactive purple yes no 0.955 0.595 0.726 1e-162
Q5MAU8 611 Probable inactive purple no no 0.926 0.579 0.642 1e-133
Q8H1R2 615 Probable inactive purple no no 0.887 0.551 0.609 1e-123
Q687E1 368 Nucleotide pyrophosphatas N/A no 0.267 0.277 0.647 4e-35
Q9LMG7 656 Probable inactive purple no no 0.767 0.446 0.295 2e-25
Q9ZQ81 651 Probable inactive purple no no 0.751 0.440 0.307 9e-25
Q8BX37 438 Iron/zinc purple acid pho yes no 0.390 0.340 0.288 1e-06
A5D6U8 443 Iron/zinc purple acid pho yes no 0.392 0.338 0.309 3e-06
Q6ZNF0 438 Iron/zinc purple acid pho yes no 0.269 0.235 0.290 3e-05
>sp|Q9LMX4|PPA1_ARATH Probable inactive purple acid phosphatase 1 OS=Arabidopsis thaliana GN=PAP1 PE=2 SV=1 Back     alignment and function desciption
 Score =  572 bits (1475), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 266/366 (72%), Positives = 311/366 (84%), Gaps = 1/366 (0%)

Query: 1   MRE-LRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQ 59
           MRE L +I + ++ VLGA     SHEDQPLS IA+HK  F L++ AY+KASP++LG  GQ
Sbjct: 1   MRESLVAILVTVISVLGAIHQVKSHEDQPLSGIAVHKITFGLNEKAYVKASPTVLGSNGQ 60

Query: 60  NSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSP 119
           +S+ + V+Y+SP PS  DWIGVFSP++F++STCP +N  V PP LCSAP+KFQYAN+S+P
Sbjct: 61  HSELVLVQYSSPKPSDDDWIGVFSPADFNASTCPGDNKMVQPPRLCSAPVKFQYANFSNP 120

Query: 120 QYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKV 179
           +Y +TG GSLKLQLINQRSDFSF LF+ GLLNPK+VA+SNKV F NPNAPVYPRLA GK 
Sbjct: 121 RYTNTGTGSLKLQLINQRSDFSFALFSGGLLNPKLVAISNKVAFENPNAPVYPRLALGKE 180

Query: 180 WNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGY 239
           W+EMTVTWTSGYG+N AEP VEWG KGG+R  SPAGTLTF R SMCGAPARTVGWRDPGY
Sbjct: 181 WDEMTVTWTSGYGLNLAEPVVEWGVKGGERKLSPAGTLTFARNSMCGAPARTVGWRDPGY 240

Query: 240 IHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDE 299
           IHT FL+ELWPN+ YTY++GHRL NG  IWS EYQFK+SP+PGQ+S+QQV+IFGDMGK E
Sbjct: 241 IHTAFLKELWPNSKYTYRVGHRLSNGALIWSKEYQFKSSPFPGQNSVQQVVIFGDMGKAE 300

Query: 300 ADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIAST 359
            DGS+EYN+FQR SLNTT+QLI+DLK  D VFHIGDICYANGY+SQWDQF AQIEPIAST
Sbjct: 301 VDGSSEYNDFQRASLNTTKQLIKDLKKTDAVFHIGDICYANGYLSQWDQFIAQIEPIAST 360

Query: 360 VPYMIA 365
           VPYMIA
Sbjct: 361 VPYMIA 366

Arabidopsis thaliana (taxid: 3702)
>sp|Q5MAU8|PPA27_ARATH Probable inactive purple acid phosphatase 27 OS=Arabidopsis thaliana GN=PAP27 PE=2 SV=1 Back     alignment and function description
>sp|Q8H1R2|PPA24_ARATH Probable inactive purple acid phosphatase 24 OS=Arabidopsis thaliana GN=PAP24 PE=2 SV=1 Back     alignment and function description
>sp|Q687E1|NPP_HORVU Nucleotide pyrophosphatase/phosphodiesterase (Fragments) OS=Hordeum vulgare GN=npp PE=1 SV=2 Back     alignment and function description
>sp|Q9LMG7|PPA2_ARATH Probable inactive purple acid phosphatase 2 OS=Arabidopsis thaliana GN=PAP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZQ81|PPA9_ARATH Probable inactive purple acid phosphatase 9 OS=Arabidopsis thaliana GN=PAP9 PE=2 SV=1 Back     alignment and function description
>sp|Q8BX37|PAPL_MOUSE Iron/zinc purple acid phosphatase-like protein OS=Mus musculus GN=Papl PE=2 SV=2 Back     alignment and function description
>sp|A5D6U8|PAPL_DANRE Iron/zinc purple acid phosphatase-like protein OS=Danio rerio GN=papl PE=2 SV=1 Back     alignment and function description
>sp|Q6ZNF0|PAPL_HUMAN Iron/zinc purple acid phosphatase-like protein OS=Homo sapiens GN=PAPL PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query382
224112110 614 predicted protein [Populus trichocarpa] 0.955 0.594 0.778 1e-171
297738089 672 unnamed protein product [Vitis vinifera] 0.955 0.543 0.775 1e-171
359472541 612 PREDICTED: probable inactive purple acid 0.955 0.596 0.775 1e-171
449452841 612 PREDICTED: probable inactive purple acid 0.955 0.596 0.761 1e-167
18075960 612 putative metallophosphatase [Lupinus lut 0.955 0.596 0.745 1e-166
356526862 616 PREDICTED: probable inactive purple acid 0.926 0.574 0.771 1e-166
224098974 621 predicted protein [Populus trichocarpa] 0.955 0.587 0.736 1e-165
356567597 611 PREDICTED: probable inactive purple acid 0.926 0.579 0.771 1e-165
18075958 615 diphosphonucleotide phosphatase 1 [Lupin 0.952 0.591 0.745 1e-164
357487749 945 U-box domain-containing protein [Medicag 0.934 0.377 0.740 1e-163
>gi|224112110|ref|XP_002316086.1| predicted protein [Populus trichocarpa] gi|222865126|gb|EEF02257.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  607 bits (1564), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 285/366 (77%), Positives = 320/366 (87%), Gaps = 1/366 (0%)

Query: 1   MRELRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQN 60
           MR L  +   ILLVL   ++  SH +QPLS+IA+H     L +NA IKASPS+LG+KGQN
Sbjct: 2   MRGLELVFFAILLVLATLQVANSHGEQPLSRIAVHNTRLQLFENADIKASPSVLGLKGQN 61

Query: 61  SDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTC-PAENPRVYPPLLCSAPIKFQYANYSSP 119
           S+W+T+EY SPNPS  DWIGVFSP+NFS+STC P +  +  PP LC+APIK+QYANYSSP
Sbjct: 62  SEWVTLEYASPNPSNDDWIGVFSPANFSASTCNPDDGSKQAPPFLCTAPIKYQYANYSSP 121

Query: 120 QYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKV 179
            Y+  GKGSL+LQLINQRSDFSFVLF+ GL NPKVVAVSNKV FTNPNAPVYPRLAQGK+
Sbjct: 122 GYRKEGKGSLRLQLINQRSDFSFVLFSGGLTNPKVVAVSNKVAFTNPNAPVYPRLAQGKI 181

Query: 180 WNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGY 239
           WNEMTVTWTSGYGINEAEPFVEWG K GD   SPAGTLTF R SMCGAPARTVGWRDPG+
Sbjct: 182 WNEMTVTWTSGYGINEAEPFVEWGRKDGDHMRSPAGTLTFNRNSMCGAPARTVGWRDPGF 241

Query: 240 IHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDE 299
           IHT FL+ELWPN++YTYKLGH+LFNGTY+WS  YQF+ASPYPGQ S+Q+V+IFGDMGKDE
Sbjct: 242 IHTSFLKELWPNSVYTYKLGHKLFNGTYVWSQVYQFRASPYPGQSSVQRVVIFGDMGKDE 301

Query: 300 ADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIAST 359
           ADGSNEYNNFQRGSLNTT+QLIQDLKNIDIVFHIGDICYANGY+SQWDQFTAQ+EPIAST
Sbjct: 302 ADGSNEYNNFQRGSLNTTKQLIQDLKNIDIVFHIGDICYANGYLSQWDQFTAQVEPIAST 361

Query: 360 VPYMIA 365
           VPYMIA
Sbjct: 362 VPYMIA 367

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297738089|emb|CBI27290.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359472541|ref|XP_002274118.2| PREDICTED: probable inactive purple acid phosphatase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449452841|ref|XP_004144167.1| PREDICTED: probable inactive purple acid phosphatase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18075960|emb|CAD12837.1| putative metallophosphatase [Lupinus luteus] Back     alignment and taxonomy information
>gi|356526862|ref|XP_003532035.1| PREDICTED: probable inactive purple acid phosphatase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|224098974|ref|XP_002311341.1| predicted protein [Populus trichocarpa] gi|222851161|gb|EEE88708.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356567597|ref|XP_003552004.1| PREDICTED: probable inactive purple acid phosphatase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|18075958|emb|CAD12836.1| diphosphonucleotide phosphatase 1 [Lupinus luteus] Back     alignment and taxonomy information
>gi|357487749|ref|XP_003614162.1| U-box domain-containing protein [Medicago truncatula] gi|355515497|gb|AES97120.1| U-box domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query382
TAIR|locus:2023870 613 AT1G13750 [Arabidopsis thalian 0.955 0.595 0.726 9.8e-151
TAIR|locus:2177547 611 PAP27 "purple acid phosphatase 0.924 0.577 0.644 1.3e-125
TAIR|locus:2117353 615 PAP24 "purple acid phosphatase 0.931 0.578 0.591 4.2e-118
TAIR|locus:2014839 656 PAP2 "AT1G13900" [Arabidopsis 0.772 0.449 0.301 9.5e-27
TAIR|locus:2063777 651 PAP9 "purple acid phosphatase 0.793 0.465 0.310 3.2e-26
DICTYBASE|DDB_G0281861 594 DDB_G0281861 [Dictyostelium di 0.557 0.358 0.322 1.6e-20
DICTYBASE|DDB_G0282559 431 dduA "N-terminal purple acid p 0.471 0.417 0.303 1.4e-09
FB|FBgn0030245 458 CG1637 [Drosophila melanogaste 0.285 0.237 0.320 7.7e-07
UNIPROTKB|Q6ZNF0 438 PAPL "Iron/zinc purple acid ph 0.274 0.239 0.317 0.0002
UNIPROTKB|E2RE14 435 PAPL "Uncharacterized protein" 0.274 0.241 0.317 0.00042
TAIR|locus:2023870 AT1G13750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1471 (522.9 bits), Expect = 9.8e-151, P = 9.8e-151
 Identities = 266/366 (72%), Positives = 311/366 (84%)

Query:     1 MRE-LRSICLGILLVLGAFRLTISHEDQPLSKIAIHKAVFALDDNAYIKASPSILGMKGQ 59
             MRE L +I + ++ VLGA     SHEDQPLS IA+HK  F L++ AY+KASP++LG  GQ
Sbjct:     1 MRESLVAILVTVISVLGAIHQVKSHEDQPLSGIAVHKITFGLNEKAYVKASPTVLGSNGQ 60

Query:    60 NSDWLTVEYNSPNPSVGDWIGVFSPSNFSSSTCPAENPRVYPPLLCSAPIKFQYANYSSP 119
             +S+ + V+Y+SP PS  DWIGVFSP++F++STCP +N  V PP LCSAP+KFQYAN+S+P
Sbjct:    61 HSELVLVQYSSPKPSDDDWIGVFSPADFNASTCPGDNKMVQPPRLCSAPVKFQYANFSNP 120

Query:   120 QYKSTGKGSLKLQLINQRSDFSFVLFTNGLLNPKVVAVSNKVTFTNPNAPVYPRLAQGKV 179
             +Y +TG GSLKLQLINQRSDFSF LF+ GLLNPK+VA+SNKV F NPNAPVYPRLA GK 
Sbjct:   121 RYTNTGTGSLKLQLINQRSDFSFALFSGGLLNPKLVAISNKVAFENPNAPVYPRLALGKE 180

Query:   180 WNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGY 239
             W+EMTVTWTSGYG+N AEP VEWG KGG+R  SPAGTLTF R SMCGAPARTVGWRDPGY
Sbjct:   181 WDEMTVTWTSGYGLNLAEPVVEWGVKGGERKLSPAGTLTFARNSMCGAPARTVGWRDPGY 240

Query:   240 IHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDE 299
             IHT FL+ELWPN+ YTY++GHRL NG  IWS EYQFK+SP+PGQ+S+QQV+IFGDMGK E
Sbjct:   241 IHTAFLKELWPNSKYTYRVGHRLSNGALIWSKEYQFKSSPFPGQNSVQQVVIFGDMGKAE 300

Query:   300 ADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQWDQFTAQIEPIAST 359
              DGS+EYN+FQR SLNTT+QLI+DLK  D VFHIGDICYANGY+SQWDQF AQIEPIAST
Sbjct:   301 VDGSSEYNDFQRASLNTTKQLIKDLKKTDAVFHIGDICYANGYLSQWDQFIAQIEPIAST 360

Query:   360 VPYMIA 365
             VPYMIA
Sbjct:   361 VPYMIA 366
GO:0003993 "acid phosphatase activity" evidence=IEA
GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0016787 "hydrolase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0006569 "tryptophan catabolic process" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
TAIR|locus:2177547 PAP27 "purple acid phosphatase 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117353 PAP24 "purple acid phosphatase 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014839 PAP2 "AT1G13900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063777 PAP9 "purple acid phosphatase 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281861 DDB_G0281861 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282559 dduA "N-terminal purple acid phosphatase domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0030245 CG1637 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZNF0 PAPL "Iron/zinc purple acid phosphatase-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE14 PAPL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LMX4PPA1_ARATHNo assigned EC number0.72670.95540.5954yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.X.825.1
annotation not avaliable (604 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query382
cd00839 294 cd00839, MPP_PAPs, purple acid phosphatases of the 5e-17
PLN02533 427 PLN02533, PLN02533, probable purple acid phosphata 2e-04
>gnl|CDD|163615 cd00839, MPP_PAPs, purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information 
 Score = 80.4 bits (199), Expect = 5e-17
 Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 13/81 (16%)

Query: 287 QQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYISQ- 345
            +  +FGDMG++  +           S NT   L ++L N D + H+GD+ YA+GY +  
Sbjct: 5   FKFAVFGDMGQNTNN-----------STNTLDHLEKELGNYDAILHVGDLAYADGYNNGS 53

Query: 346 -WDQFTAQIEPIASTVPYMIA 365
            WD F  QIEP+AS VPYM+ 
Sbjct: 54  RWDTFMRQIEPLASYVPYMVT 74

Purple acid phosphatases (PAPs) belong to a diverse family of binuclear metallohydrolases that have been identified and characterized in plants, animals, and fungi. PAPs contain a binuclear metal center and their characteristic pink or purple color derives from a charge-transfer transition between a tyrosine residue and a chromophoric ferric ion within the binuclear center. PAPs catalyze the hydrolysis of a wide range of activated phosphoric acid mono- and di-esters and anhydrides. PAPs are distinguished from the other phosphatases by their insensitivity to L-(+) tartrate inhibition and are therefore also known as tartrate resistant acid phosphatases (TRAPs). While only a few copies of PAP-like genes are present in mammalian and fungal genomes, multiple copies are present in plant genomes. PAPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 294
>gnl|CDD|215292 PLN02533, PLN02533, probable purple acid phosphatase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 382
KOG1378 452 consensus Purple acid phosphatase [Carbohydrate tr 100.0
PLN02533 427 probable purple acid phosphatase 100.0
cd00839 294 MPP_PAPs purple acid phosphatases of the metalloph 99.5
PF09423 453 PhoD: PhoD-like phosphatase; InterPro: IPR018946 T 99.27
COG3540 522 PhoD Phosphodiesterase/alkaline phosphatase D [Ino 99.09
cd07378 277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 98.94
cd07399 214 MPP_YvnB Bacillus subtilis YvnB and related protei 98.69
cd07395 262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 98.57
PF00149 200 Metallophos: Calcineurin-like phosphoesterase; Int 98.54
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 98.4
cd07396 267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 98.32
cd07402 240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 98.22
PRK11148 275 cyclic 3',5'-adenosine monophosphate phosphodieste 98.13
PTZ00422 394 glideosome-associated protein 50; Provisional 98.13
KOG1432 379 consensus Predicted DNA repair exonuclease SIA1 [G 98.09
cd07385 223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 98.04
cd00840 223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 97.99
KOG2679 336 consensus Purple (tartrate-resistant) acid phospha 97.96
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 97.86
cd00842 296 MPP_ASMase acid sphingomyelinase and related prote 97.85
PRK11340 271 phosphodiesterase YaeI; Provisional 97.81
cd07401 256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 97.8
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 97.75
cd00838131 MPP_superfamily metallophosphatase superfamily, me 97.64
cd07388 224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 97.52
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 97.39
COG1409 301 Icc Predicted phosphohydrolases [General function 97.28
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 97.27
TIGR00619 253 sbcd exonuclease SbcD. This family is based on the 97.16
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 97.13
cd07393 232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 97.11
cd07392 188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 97.02
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 96.96
TIGR03729 239 acc_ester putative phosphoesterase. Members of thi 96.96
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 96.95
cd08163 257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 96.94
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 96.87
PRK05340 241 UDP-2,3-diacylglucosamine hydrolase; Provisional 96.85
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 96.84
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 96.81
PRK09453182 phosphodiesterase; Provisional 96.76
PRK10966 407 exonuclease subunit SbcD; Provisional 96.61
TIGR01854 231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 96.56
cd07397 238 MPP_DevT Myxococcus xanthus DevT and related prote 96.56
COG0420 390 SbcD DNA repair exonuclease [DNA replication, reco 96.51
cd07424 207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 96.48
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 96.47
PRK00166 275 apaH diadenosine tetraphosphatase; Reviewed 96.36
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 96.34
cd07423 234 MPP_PrpE Bacillus subtilis PrpE and related protei 96.31
PHA02546 340 47 endonuclease subunit; Provisional 96.31
TIGR00024 225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 96.23
KOG3662 410 consensus Cell division control protein/predicted 96.23
cd07394 178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 96.14
PHA02239 235 putative protein phosphatase 96.11
cd07425 208 MPP_Shelphs Shewanella-like phosphatases, metallop 96.03
PRK13625 245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 96.02
TIGR00583 405 mre11 DNA repair protein (mre11). All proteins in 95.99
KOG4221 1381 consensus Receptor mediating netrin-dependent axon 95.95
PRK09968 218 serine/threonine-specific protein phosphatase 2; P 95.9
cd07413 222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 95.84
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 95.78
PRK11439 218 pphA serine/threonine protein phosphatase 1; Provi 95.62
cd07386 243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 95.59
cd0006393 FN3 Fibronectin type 3 domain; One of three types 95.58
COG1408 284 Predicted phosphohydrolases [General function pred 95.28
PRK04036 504 DNA polymerase II small subunit; Validated 95.24
cd07422 257 MPP_ApaH Escherichia coli ApaH and related protein 95.14
PF14582 255 Metallophos_3: Metallophosphoesterase, calcineurin 94.93
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 94.9
cd07421 304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 94.77
cd07398 217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 94.77
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 94.61
cd00144 225 MPP_PPP_family phosphoprotein phosphatases of the 94.49
KOG3770 577 consensus Acid sphingomyelinase and PHM5 phosphate 93.83
cd00844 262 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t 93.65
cd07389 228 MPP_PhoD Bacillus subtilis PhoD and related protei 93.27
TIGR00668 279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 92.86
cd00845 252 MPP_UshA_N_like Escherichia coli UshA-like family, 92.75
smart0006083 FN3 Fibronectin type 3 domain. One of three types 92.19
cd07420 321 MPP_RdgC Drosophila melanogaster RdgC and related 92.15
KOG35131051 consensus Neural cell adhesion molecule L1 [Signal 91.39
cd07412 288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 90.79
cd07408 257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 90.56
cd07382 255 MPP_DR1281 Deinococcus radiodurans DR1281 and rela 90.16
cd07406 257 MPP_CG11883_N Drosophila melanogaster CG11883 and 89.99
COG0622172 Predicted phosphoesterase [General function predic 89.99
cd07418 377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 89.87
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 89.55
KOG4221 1381 consensus Receptor mediating netrin-dependent axon 89.19
smart00156 271 PP2Ac Protein phosphatase 2A homologues, catalytic 88.76
cd07416 305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 88.49
cd07411 264 MPP_SoxB_N Thermus thermophilus SoxB and related p 87.71
cd07415 285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 87.58
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 87.53
cd07419 311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 86.22
TIGR00282 266 metallophosphoesterase, MG_246/BB_0505 family. A m 86.06
cd07410 277 MPP_CpdB_N Escherichia coli CpdB and related prote 85.78
COG2129 226 Predicted phosphoesterases, related to the Icc pro 85.52
cd07414 293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 85.24
PTZ00239 303 serine/threonine protein phosphatase 2A; Provision 85.21
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 83.42
COG2908 237 Uncharacterized protein conserved in bacteria [Fun 82.57
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 82.43
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 82.42
PTZ00244 294 serine/threonine-protein phosphatase PP1; Provisio 82.27
cd07417 316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 82.09
PTZ00480 320 serine/threonine-protein phosphatase; Provisional 81.17
COG1692 266 Calcineurin-like phosphoesterase [General function 80.58
>KOG1378 consensus Purple acid phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-39  Score=327.09  Aligned_cols=181  Identities=40%  Similarity=0.617  Sum_probs=146.5

Q ss_pred             CCCCcccEeecCCCCCeEEEEEEeCCCCCCCccEEEEeecCCCCccccccceEEeccccCCCCcccccccCCCcEEEEEe
Q 016795          166 PNAPVYPRLAQGKVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGSMCGAPARTVGWRDPGYIHTGFL  245 (382)
Q Consensus       166 ~~~P~qihLa~~~d~~~m~VtW~T~~~t~~~~~~V~yG~~~~~~~~~~a~t~ty~~~~mc~~PA~t~g~rdpG~iH~a~L  245 (382)
                      .+.|+|+||+++++.++|+|+|.|.+.   ...+|+||...+......+   ......+|++...  .|++.|++|+|+|
T Consensus        42 ~~~peQvhlS~~~~~~~m~VswvT~~~---~~~~V~Yg~~~~~~~~~~~---~~~~~~~~~~y~~--~~~~sg~ih~~~~  113 (452)
T KOG1378|consen   42 VNSPEQVHLSFTDNLNEMRVSWVTGDG---EENVVRYGEVKDKLDNSAA---RGMTEAWTDGYAN--GWRDSGYIHDAVM  113 (452)
T ss_pred             CCCCCeEEEeccCCCCcEEEEEeCCCC---CCceEEEeecCCCcccccc---ccceEEEeccccc--ccceeeeEeeeee
Confidence            368999999999988899999999985   3489999977655332221   1112223333322  5678999999999


Q ss_pred             cCCCCCCEEEEEEeeecCCCCccccceEEEEeCCCCCCCCCeEEEEEecCCCCCCCCCCcccccccCchHHHHHHHHhcC
Q 016795          246 RELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLK  325 (382)
Q Consensus       246 tgL~PgT~Y~YrVG~~~~dg~~~wS~~~sF~T~P~~g~~~~~~f~vfGDmG~~~~dgs~~~~~~qp~s~~t~~~l~~~~~  325 (382)
                      ++|+|+|+||||||++.     .||++|+|+|+|  +++.+.+|++|||||..+.+.             ++..++.+.+
T Consensus       114 ~~L~~~t~YyY~~Gs~~-----~wS~~f~F~t~p--~~~~~~~~~i~GDlG~~~~~~-------------s~~~~~~~~~  173 (452)
T KOG1378|consen  114 KNLEPNTRYYYQVGSDL-----KWSEIFSFKTPP--GQDSPTRAAIFGDMGCTEPYT-------------STLRNQEENL  173 (452)
T ss_pred             cCCCCCceEEEEeCCCC-----CcccceEeECCC--CccCceeEEEEcccccccccc-------------chHhHHhccc
Confidence            99999999999999983     599999999999  456789999999999987532             3344444445


Q ss_pred             CccEEEEcCccccccCch-HHHHHHHHhHHHhhcccceEEecccCccCCc
Q 016795          326 NIDIVFHIGDICYANGYI-SQWDQFTAQIEPIASTVPYMIARFFLWKHGF  374 (382)
Q Consensus       326 ~~dfvlh~GDisYa~G~~-~~WD~F~~~iepias~vPym~~~GNHE~~g~  374 (382)
                      ++|+|+|+|||+||+++. .+||+|++++||+|+++|||++.||||.+..
T Consensus       174 k~d~vlhiGDlsYa~~~~n~~wD~f~r~vEp~As~vPymv~~GNHE~d~~  223 (452)
T KOG1378|consen  174 KPDAVLHIGDLSYAMGYSNWQWDEFGRQVEPIASYVPYMVCSGNHEIDWP  223 (452)
T ss_pred             CCcEEEEecchhhcCCCCccchHHHHhhhhhhhccCceEEecccccccCC
Confidence            799999999999999998 6999999999999999999999999998755

>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>PF09423 PhoD: PhoD-like phosphatase; InterPro: IPR018946 This entry contains a number of putative proteins as well as Alkaline phosphatase D which catalyses the reaction: A phosphate monoester + H(2)O = an alcohol + phosphate ; PDB: 2YEQ_B Back     alignment and domain information
>COG3540 PhoD Phosphodiesterase/alkaline phosphatase D [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>PTZ00422 glideosome-associated protein 50; Provisional Back     alignment and domain information
>KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only] Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG2679 consensus Purple (tartrate-resistant) acid phosphatase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>KOG3662 consensus Cell division control protein/predicted DNA repair exonuclease [Replication, recombination and repair] Back     alignment and domain information
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>KOG4221 consensus Receptor mediating netrin-dependent axon guidance [Signal transduction mechanisms] Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>KOG3770 consensus Acid sphingomyelinase and PHM5 phosphate metabolism protein [Lipid transport and metabolism] Back     alignment and domain information
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07389 MPP_PhoD Bacillus subtilis PhoD and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG3513 consensus Neural cell adhesion molecule L1 [Signal transduction mechanisms] Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG4221 consensus Receptor mediating netrin-dependent axon guidance [Signal transduction mechanisms] Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>COG1692 Calcineurin-like phosphoesterase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query382
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 7e-37
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 2e-34
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
1ute_A 313 Protein (II purple acid phosphatase); tartrate res 1e-05
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Length = 426 Back     alignment and structure
 Score =  137 bits (346), Expect = 7e-37
 Identities = 38/206 (18%), Positives = 70/206 (33%), Gaps = 34/206 (16%)

Query: 165 NPNAPVYPRLAQGKVW-NEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLTFGRGS 223
             NAP    + QG      + ++WT+ Y    A     W      +  +    +T+   +
Sbjct: 21  GYNAPQQVHITQGDYEGRGVIISWTTPYDKAGANKVFYWSENSKSQKRAMGTVVTYKYYN 80

Query: 224 MCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQ 283
                          +IH   +++L  +  Y Y+LG            ++ F   P PG 
Sbjct: 81  YTS-----------AFIHHCTIKDLEYDTKYYYRLGFGD------AKRQFWFVTPPKPGP 123

Query: 284 DSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLIQDLKNIDIVFHIGDICYANGYI 343
           D      + GD+G+               S  T     Q+      V  +GD+ Y+N + 
Sbjct: 124 DVPYVFGLIGDIGQTHD------------SNTTLTHYEQNSAKGQAVLFMGDLSYSNRWP 171

Query: 344 ----SQWDQFTAQIEPIASTVPYMIA 365
               ++WD +    E   +  P++  
Sbjct: 172 NHDNNRWDTWGRFSERSVAYQPWIWT 197
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Length = 424 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Length = 313 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query382
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 100.0
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 100.0
2yeq_A 527 Apased, PHOD, alkaline phosphatase D; hydrolase, p 99.77
1ute_A 313 Protein (II purple acid phosphatase); tartrate res 98.69
3tgh_A 342 Glideosome-associated protein 50; phosphatase fold 98.47
3ib7_A 330 ICC protein; metallophosphoesterase, alpha-beta fo 98.38
2nxf_A 322 Putative dimetal phosphatase; dinuclear metal cent 98.19
1uf3_A 228 Hypothetical protein TT1561; metallo-dependent pho 98.16
3d03_A 274 Phosphohydrolase; glycerophosphodiesterase, metall 98.14
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 97.86
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 97.85
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 97.79
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 97.74
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 97.73
2yvt_A 260 Hypothetical protein AQ_1956; structural genomics, 97.7
2crz_A110 Fibronectin type-III domain containing protein 3A; 97.66
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 97.65
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 97.64
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 97.63
2q8u_A 336 Exonuclease, putative; structural genomics, joint 97.61
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 97.59
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 97.57
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 97.57
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 97.57
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 97.57
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 97.55
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 97.54
3av0_A 386 DNA double-strand break repair protein MRE11; DNA 97.52
1x4x_A106 Fibronectin type-III domain containing protein 3A; 97.52
3tho_B 379 Exonuclease, putative; adenosine triphosphate, bac 97.5
1x5x_A109 Fibronectin type-III domain containing protein 3A; 97.48
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 97.45
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 97.44
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 97.41
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 97.4
1ii7_A 333 MRE11 nuclease; RAD50, DNA double-strand break rep 97.4
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 97.38
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 97.37
1nnw_A 252 Hypothetical protein; structural genomics, PSI, pr 97.36
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 97.36
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 97.35
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 97.35
2crm_A120 Fibronectin type-III domain containing protein 3A; 97.35
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 97.34
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 97.34
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 97.32
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 97.26
1x3d_A118 Fibronectin type-III domain containing protein 3A; 97.2
3ck2_A 176 Conserved uncharacterized protein (predicted phosp 97.17
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 97.17
1z2w_A 192 Vacuolar protein sorting 29; VPS29, retromer, phos 97.14
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 97.12
3rl5_A 296 Metallophosphoesterase mpped2; alpha-beta fold, me 97.12
2a22_A 215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 97.1
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 97.1
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 97.08
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 97.08
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 97.06
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 97.06
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 97.04
3t1i_A 431 Double-strand break repair protein MRE11A; DNA rep 97.03
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 97.02
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 97.02
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 97.0
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 97.0
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 96.99
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 96.97
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 96.95
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 96.94
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 96.94
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 96.93
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 96.91
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 96.9
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 96.87
1xm7_A 195 Hypothetical protein AQ_1665; structural genomics, 96.87
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 96.84
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 96.84
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 96.83
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 96.81
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 96.8
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 96.79
3rqz_A 246 Metallophosphoesterase; PSI-biology, midwest cente 96.78
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 96.78
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 96.77
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 96.77
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 96.75
3qfm_A 270 SAPH, putative uncharacterized protein; sandwich f 96.74
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 96.73
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 96.72
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 96.7
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 96.68
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 96.68
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 96.67
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 96.67
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 96.64
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 96.64
4fbk_A 472 DNA repair and telomere maintenance protein NBS1, 96.61
4fbw_A 417 DNA repair protein RAD32; DNA double-strand break 96.57
1g5b_A 221 Serine/threonine protein phosphatase; bacteriophag 96.55
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 96.55
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 96.54
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 96.52
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 96.51
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 96.5
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 96.5
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 96.46
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 96.42
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 96.39
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 96.35
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 96.35
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 96.27
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 96.24
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 96.24
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 96.23
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 96.21
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 96.2
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 96.19
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 96.19
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 96.13
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 96.09
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 96.09
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 96.08
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 96.04
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 96.03
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 95.97
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 95.97
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 95.94
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 95.88
1eer_B227 Epobp, erythropoietin receptor; signal transductio 95.81
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 95.79
2qjc_A 262 Diadenosine tetraphosphatase, putative; putative d 95.79
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 95.72
2dfj_A 280 Diadenosinetetraphosphatase; helices and strands m 95.71
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 95.69
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 95.67
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 95.64
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 95.61
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 95.45
2z72_A 342 Protein-tyrosine-phosphatase; cold-active enzyme, 95.32
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 95.28
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 95.27
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 95.2
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 95.16
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 95.09
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 94.97
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 94.94
1oww_A98 FN, fibronectin first type III module, CIG; fibron 94.91
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 94.86
3k2m_C101 Monobody HA4; engineered binding protein, antibody 94.85
3t04_D103 Monobody 7C12; engineered binding protein, antibod 94.83
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 94.69
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 94.65
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 94.6
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 94.52
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 94.48
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 94.23
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 94.17
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 94.16
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 94.1
2ie4_C 309 PP2A-alpha;, serine/threonine-protein phosphatase 94.08
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 93.72
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 93.69
3icf_A 335 PPT, serine/threonine-protein phosphatase T; IRO m 93.51
3h63_A 315 Serine/threonine-protein phosphatase 5; metalloenz 93.2
1fjm_A 330 Protein serine/threonine phosphatase-1 (alpha ISO 93.13
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 93.05
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 93.05
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 92.56
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 92.49
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 92.29
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 92.27
3e7a_A 299 PP-1A, serine/threonine-protein phosphatase PP1-al 92.26
2gys_A 419 Cytokine receptor common beta chain; dimer of inte 91.96
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 91.95
3ll8_A 357 Serine/threonine-protein phosphatase 2B catalytic 91.72
2erj_C247 Cytokine receptor common gamma chain; immune syste 91.71
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 91.7
2lfe_A138 E3 ubiquitin-protein ligase HECW2; structural geno 91.66
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 91.02
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 91.0
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 90.95
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 90.77
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 90.66
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 90.1
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 90.02
2gys_A419 Cytokine receptor common beta chain; dimer of inte 89.77
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 89.71
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 88.91
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 88.68
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 88.19
3qfk_A 527 Uncharacterized protein; structural genomics, cent 88.04
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 87.73
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 87.56
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 87.56
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 87.16
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 85.78
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 85.13
3jyf_A 339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 84.78
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 84.04
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 83.99
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 83.27
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 82.91
1t70_A 255 Phosphatase; crystal, X-RAY crystallography, struc 81.48
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 81.47
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 81.47
2z06_A 252 Putative uncharacterized protein TTHA0625; metal b 80.26
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
Probab=100.00  E-value=2.1e-32  Score=276.23  Aligned_cols=178  Identities=21%  Similarity=0.315  Sum_probs=147.3

Q ss_pred             CCCCCcccEeecCCCC-CeEEEEEEeC-CCCCCCccEEEEeecCCCCccccccc-eEEeccccCCCCcccccccCCCcEE
Q 016795          165 NPNAPVYPRLAQGKVW-NEMTVTWTSG-YGINEAEPFVEWGPKGGDRTYSPAGT-LTFGRGSMCGAPARTVGWRDPGYIH  241 (382)
Q Consensus       165 ~~~~P~qihLa~~~d~-~~m~VtW~T~-~~t~~~~~~V~yG~~~~~~~~~~a~t-~ty~~~~mc~~PA~t~g~rdpG~iH  241 (382)
                      ++++|+|+||++++++ ++|+|+|+|. ..  .+.++|+||++++.+...+.++ .+|...+           ..+||+|
T Consensus        21 ~~~~p~~v~l~~~~~~~~~~~v~W~t~~~~--~~~~~V~y~~~~~~~~~~~~~~~~~~~~~~-----------~~~~~~~   87 (426)
T 1xzw_A           21 GYNAPQQVHITQGDYEGRGVIISWTTPYDK--AGANKVFYWSENSKSQKRAMGTVVTYKYYN-----------YTSAFIH   87 (426)
T ss_dssp             STTCCEEEEEEECSSSSSCEEEEEEESSCC--TTTTEEEEEETTCCCCEEEECEEECCEETT-----------EECCEEE
T ss_pred             CCCCCceEEEEECCCCCCeEEEEEEeCCCC--CCCCEEEEecCCCCCceEEEEEEEEEEecC-----------CcCCEEE
Confidence            5689999999999985 9999999998 53  4689999999877665544443 2344311           2468999


Q ss_pred             EEEecCCCCCCEEEEEEeeecCCCCccccceEEEEeCCCCCCCCCeEEEEEecCCCCCCCCCCcccccccCchHHHHHHH
Q 016795          242 TGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASPYPGQDSLQQVIIFGDMGKDEADGSNEYNNFQRGSLNTTRQLI  321 (382)
Q Consensus       242 ~a~LtgL~PgT~Y~YrVG~~~~dg~~~wS~~~sF~T~P~~g~~~~~~f~vfGDmG~~~~dgs~~~~~~qp~s~~t~~~l~  321 (382)
                      +|+|+||+|||+|+|||+++      .||++++|+|+|.+++..++||+++||+|....            +..+++++.
T Consensus        88 ~v~l~gL~p~t~Y~Yrv~~g------~~s~~~~f~T~p~~~~~~~~~f~~~gD~~~~~~------------~~~~l~~i~  149 (426)
T 1xzw_A           88 HCTIKDLEYDTKYYYRLGFG------DAKRQFWFVTPPKPGPDVPYVFGLIGDIGQTHD------------SNTTLTHYE  149 (426)
T ss_dssp             EEEECCCCTTCEEEEEECCG------GGCEEEEEECCCCCCTTCCEEEEEECSCTTBHH------------HHHHHHHHH
T ss_pred             EEEECCCCCCCEEEEEECCC------CccceeEEECCCCCCCCCCeEEEEEEeCCCCCc------------hHHHHHHHH
Confidence            99999999999999999973      489999999999877777899999999987421            245677777


Q ss_pred             HhcCCccEEEEcCccccccCc----hHHHHHHHHhHHHhhcccceEEecccCccCC
Q 016795          322 QDLKNIDIVFHIGDICYANGY----ISQWDQFTAQIEPIASTVPYMIARFFLWKHG  373 (382)
Q Consensus       322 ~~~~~~dfvlh~GDisYa~G~----~~~WD~F~~~iepias~vPym~~~GNHE~~g  373 (382)
                      +...++|||+|.||++|+++.    ..+|++|++.++++.+.+|+|+++||||...
T Consensus       150 ~~~~~~D~vl~~GD~~y~~~~~~~~~~~~~~~~~~l~~l~~~~P~~~v~GNHD~~~  205 (426)
T 1xzw_A          150 QNSAKGQAVLFMGDLSYSNRWPNHDNNRWDTWGRFSERSVAYQPWIWTAGNHEIDY  205 (426)
T ss_dssp             HCTTCCSEEEECSCCCCGGGSGGGCTHHHHHHHHHHHHHHTTSCEECCCCGGGCCC
T ss_pred             hCCCCCCEEEeCCChhhcccCCcccchHHHHHHHHHHHHHhcCCEEEecccccccc
Confidence            644589999999999999876    5789999999999999999999999999864
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>2lfe_A E3 ubiquitin-protein ligase HECW2; structural genomics, northeast structural genomics consortiu SGC; NMR {Homo sapiens} Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 382
d2qfra1112 b.1.12.1 (A:9-120) Purple acid phosphatase, N-term 1e-16
d1xzwa1119 b.1.12.1 (A:1-119) Purple acid phosphatase, N-term 3e-16
d2qfra2 312 d.159.1.1 (A:121-432) Plant purple acid phosphatas 1e-08
d1utea_ 302 d.159.1.1 (A:) Mammalian purple acid phosphatase { 3e-05
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 112 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Purple acid phosphatase, N-terminal domain
family: Purple acid phosphatase, N-terminal domain
domain: Purple acid phosphatase, N-terminal domain
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 73.0 bits (179), Expect = 1e-16
 Identities = 24/121 (19%), Positives = 39/121 (32%), Gaps = 22/121 (18%)

Query: 163 FTNP---NAPVYPRLAQG-KVWNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTLT 218
           F  P   NAP    + QG  V   M ++W +          V +  +   R     G ++
Sbjct: 10  FRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDEP--GSSAVRYWSEKNGRKRIAKGKMS 67

Query: 219 FGRGSMCGAPARTVGWRDPGYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKAS 278
                              G+IH   +R+L  N  Y Y++      G    +  + F   
Sbjct: 68  ----------TYRFFNYSSGFIHHTTIRKLKYNTKYYYEV------GLRNTTRRFSFITP 111

Query: 279 P 279
           P
Sbjct: 112 P 112
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Length = 119 Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 312 Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Length = 302 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query382
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 99.89
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 99.88
d2qfra2 312 Plant purple acid phosphatase, catalytic domain {K 99.6
d1utea_ 302 Mammalian purple acid phosphatase {Pig (Sus scrofa 99.02
d2hy1a1 256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 98.32
d1uf3a_ 228 Hypothetical protein TT1561 {Thermus thermophilus 98.08
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 98.05
d2nxfa1 320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 98.0
d1x5xa196 Fibronectin type-III domain containing protein 3a, 97.98
d1x4xa193 Fibronectin type-III domain containing protein 3a, 97.97
d3d03a1 271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 97.95
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 97.88
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 97.83
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 97.8
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 97.79
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.79
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.76
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 97.75
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 97.73
d2crza197 Fibronectin type-III domain containing protein 3a, 97.72
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 97.7
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 97.69
d2yvta1 257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 97.67
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 97.67
d1ii7a_ 333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.66
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 97.63
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 97.62
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 97.61
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 97.59
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 97.58
d1va9a1109 Down syndrome cell adhesion molecule-like protein 97.56
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 97.56
d1nnwa_ 251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 97.51
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 97.48
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 97.45
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.44
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 97.44
d1x3da1105 Fibronectin type-III domain containing protein 3a, 97.41
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 97.38
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.38
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 97.36
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 97.35
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 97.35
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.34
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 97.34
d2crma1107 Fibronectin type-III domain containing protein 3a, 97.32
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 97.31
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 97.19
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 97.16
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 97.15
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 97.13
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 97.1
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 97.08
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 97.07
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 97.01
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 97.0
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 96.98
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 96.98
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 96.97
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 96.96
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 96.94
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 96.93
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 96.93
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 96.92
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 96.91
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 96.9
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 96.87
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 96.87
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 96.85
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 96.83
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 96.83
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 96.82
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 96.79
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 96.75
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 96.75
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 96.74
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 96.73
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 96.73
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 96.69
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 96.66
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 96.65
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 96.47
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 96.42
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 96.29
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 96.22
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 96.14
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 96.02
d3ck2a1 173 Uncharacterized protein SP1879 {Streptococcus pneu 95.96
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 95.89
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 95.87
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 95.79
d2a22a1 193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 95.75
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 95.64
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 95.56
d1g5ba_ 219 lambda ser/thr protein phosphatase {Bacteriophage 95.46
d1z2wa1 182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 95.37
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 95.35
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 95.0
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 95.0
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 94.21
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 93.55
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 92.17
d3c9fa2 322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 91.85
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 85.65
d1usha2 337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 81.08
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Purple acid phosphatase, N-terminal domain
family: Purple acid phosphatase, N-terminal domain
domain: Purple acid phosphatase, N-terminal domain
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.89  E-value=2.3e-23  Score=173.32  Aligned_cols=98  Identities=26%  Similarity=0.437  Sum_probs=79.7

Q ss_pred             cCCC---CCCcccEeecCCC-CCeEEEEEEeCCCCCCCccEEEEeecCCCCccccccce-EEeccccCCCCcccccccCC
Q 016795          163 FTNP---NAPVYPRLAQGKV-WNEMTVTWTSGYGINEAEPFVEWGPKGGDRTYSPAGTL-TFGRGSMCGAPARTVGWRDP  237 (382)
Q Consensus       163 f~~~---~~P~qihLa~~~d-~~~m~VtW~T~~~t~~~~~~V~yG~~~~~~~~~~a~t~-ty~~~~mc~~PA~t~g~rdp  237 (382)
                      |.+|   ++|+||||+++++ .++|+|+|+|...  ...+.|+||++++.+...+.+.. +|.           .++.+.
T Consensus        10 ~~~p~~~~~P~qvhlt~~~~~~tsm~VsW~T~~~--~~~~~V~yg~~~~~~~~~a~~~~~~~~-----------~~~~~~   76 (112)
T d2qfra1          10 FRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDE--PGSSAVRYWSEKNGRKRIAKGKMSTYR-----------FFNYSS   76 (112)
T ss_dssp             GCCCCSTTCCEEEEEEECSSSSSCEEEEEEESSS--CCCCEEEEEESSSCCCEEEECEEECCB-----------CSSCBC
T ss_pred             ccCCCCCCCCccEEEeCcCCCCCEEEEEEECCCC--CCCcEEEEEECCCCCCcEEEEEEEEEE-----------ecccCC
Confidence            5554   7899999999986 5999999999764  46899999998887665554432 232           234467


Q ss_pred             CcEEEEEecCCCCCCEEEEEEeeecCCCCccccceEEEEeCC
Q 016795          238 GYIHTGFLRELWPNAMYTYKLGHRLFNGTYIWSSEYQFKASP  279 (382)
Q Consensus       238 G~iH~a~LtgL~PgT~Y~YrVG~~~~dg~~~wS~~~sF~T~P  279 (382)
                      +|+|+|+|+||+|||+|+||||++      +||++++|+|+|
T Consensus        77 ~~~h~v~Lt~L~P~T~Y~YrVG~~------~~S~~~~F~T~P  112 (112)
T d2qfra1          77 GFIHHTTIRKLKYNTKYYYEVGLR------NTTRRFSFITPP  112 (112)
T ss_dssp             CEEEEEEECSCCTTCEEEEEECCS------SSCEEEEEECCC
T ss_pred             cEEEEEEECCCCCCCEEEEEECCC------CceeeEEEEcCC
Confidence            899999999999999999999964      599999999987
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure