Citrus Sinensis ID: 016800

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380--

MRANFGKIHKSGKNKSPNFTQKFSTTQSSPEKSEDEVKRKMAPVLQSSQPWVEKYRPKQVKDVAHQEEVVRVLTNTLETANCPHMLFYGPPGTGKTTTALAIAHQLFGPELYKSRVLELNASDDRGINVVRTKIKTFAAVAVGSGQRRGGYPCPPYKIIILDEADSMTEDAQNALRRTMETYSKVTRFFFICNYISRIIEPLASRCAKFRFKPLSEEVMSSRVLHICNEEGLNLDAEALSTLSSISQGDLRRAITYLQGAARLFGSSITSKDLISVSGVIPPEVVEGLFAVCRSGDFDLANKEVNNIIAEGYPASLLLSQLFDVVVETEDISDEQQARICKCLAEVDKCLVDGADEYLQLLDVASNVIRAVCNMPEEFQYDC

cccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHcccccccccEEEEccccccccHHHHHHHHHHHHHccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHccccEECccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHccccc

*************************************************PWVEKYRPKQVKDVAHQEEVVRVLTNTLETANCPHMLFYGPPGTGKTTTALAIAHQLFGPELYKSRVLELNASDDRGINVVRTKIKTFAAVAVGSGQRRGGYPCPPYKIIILDEADSMTEDAQNALRRTMETYSKVTRFFFICNYISRIIEPLASRCAKFRFKPLSEEVMSSRVLHICNEEGLNLDAEALSTLSSISQGDLRRAITYLQGAARLFGSSITSKDLISVSGVIPPEVVEGLFAVCRSGDFDLANKEVNNIIAEGYPASLLLSQLFDVVVETEDISDEQQARICKCLAEVDKCLVDGADEYLQLLDVASNVIRAVCNMPEEFQYDC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Replication factor C subunit 4	The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1. This subunit may be involved in the elongation of the multiprimed DNA template.	probable	P35249
Replication factor C subunit 4	The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1. This subunit may be involved in the elongation of the multiprimed DNA template.	probable	Q99J62
Probable replication factor C subunit 4	The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit may be involved in the elongation of the multiprimed DNA template.	probable	Q54MD4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SXJ, chain D
Confidence level:very confident
Coverage over the Query: 50-369
View the alignment between query and template
View the model in PyMOL