Citrus Sinensis ID: 016829

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380--
MEPETQNHDHQSPETSPSPKCCAKCGGPTTFPPPPKSLYSDISPPPNYRPVRAPAINLPPNNHSQAIILAPVPQSQKVPTITAPFEFQTPSKKIQSPDDIRHFIDSDTGKNFLGFVVALSESIRGHKISDPCHESQTINTIVSILNELLQWAEEIPPLQQSARYGNLAYRTWHSRLTDNSESLMLRFLPNELQAAVIEIVPYFNDSFGNSSRIDYGTGHETNFASWLYCLARMGVIKEEDYHAVVSRVFAKYLELMRKLQLVYCLEPAGSHGVWGLDDYHFLPFIFGSSQLIDHKYMKPKSIHNQDILDNFADEYMYLSCIAFVKKVKKGLFAEHSPLLDDISGVPNWNKVNSGLLKMYKAEVLEKVPIMQHFLFGSLIRWE
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHcccccccccccccccccHHHHHHHcccccHHHHHHHHHHHccccccccccHHHcccccccHHHHHHHHHHHHHHHHccccccccccccccccccc
**************************************************************************************FQTPSKKIQSPDDIRHFIDSDTGKNFLGFVVALSESIRGHKISDPCHESQTINTIVSILNELLQWAEEIPPLQQSARYGNLAYRTWHSRLTDNSESLMLRFLPNELQAAVIEIVPYFNDSFGNSSRIDYGTGHETNFASWLYCLARMGVIKEEDYHAVVSRVFAKYLELMRKLQLVYCLEPAGSHGVWGLDDYHFLPFIFGSSQLIDHKYMKPKSIHNQDILDNFADEYMYLSCIAFVKKVKKGLFAEHSPLLDDISGVPNWNKVNSGLLKMYKAEVLEKVPIMQHFLFGSLIRWE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPETQNHDHQSPETSPSPKCCAKCGGPTTFPPPPKSLYSDISPPPNYRPVRAPAINLPPNNHSQAIILAPVPQSQKVPTITAPFEFQTPSKKIQSPDDIRHFIDSDTGKNFLGFVVALSESIRGHKISDPCHESQTINTIVSILNELLQWAEEIPPLQQSARYGNLAYRTWHSRLTDNSESLMLRFLPNELQAAVIEIVPYFNDSFGNSSRIDYGTGHETNFASWLYCLARMGVIKEEDYHAVVSRVFAKYLELMRKLQLVYCLEPAGSHGVWGLDDYHFLPFIFGSSQLIDHKYMKPKSIHNQDILDNFADEYMYLSCIAFVKKVKKGLFAEHSPLLDDISGVPNWNKVNSGLLKMYKAEVLEKVPIMQHFLFGSLIRWE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein phosphatase 2A activator PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts as a regulatory subunit for serine/threonine-protein phosphatase 2A (PP2A) modulating its activity or substrate specificity, probably by inducing a conformational change in the catalytic subunit, a proposed direct target of the PPIase. Can reactivate inactive phosphatase PP2A-phosphatase methylesterase complexes (PP2A(i)) in presence of ATP and Mg(2+). Reversibly stimulates the variable phosphotyrosyl phosphatase activity of PP2A core heterodimer PP2A(D) in presence of ATP and Mg(2+) (in vitro). The phosphotyrosyl phosphatase activity is dependent of an ATPase activty of the PP2A(D):PPP2R4 complex. Is involved in apoptosis; the function appears to be independent from PP2A.probableP58389
Serine/threonine-protein phosphatase 2A activator PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts as a regulatory subunit for serine/threonine-protein phosphatase 2A (PP2A) modulating its activity or substrate specificity, probably by inducing a conformational change in the catalytic subunit, a proposed direct target of the PPIase. Can reactivate inactive phosphatase PP2A-phosphatase methylesterase complexes (PP2A(i)) in presence of ATP and Mg(2+) (By similarity). Reversibly stimulates the variable phosphotyrosyl phosphatase activity of PP2A core heterodimer PP2A(D) in presence of ATP and Mg(2+) (in vitro). The phosphotyrosyl phosphatase activity is dependent of an ATPase activty of the PP2A(D):PPP2R4 complex. Is involved in apoptosis; the function appears to be independent from PP2A.probableQ2KJ44

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.2.-.-Cis-trans-isomerases.probable
5.2.1.-Cis-trans Isomerases.probable
5.2.1.8Peptidylprolyl isomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IXM, chain A
Confidence level:very confident
Coverage over the Query: 87-382
View the alignment between query and template
View the model in PyMOL