Citrus Sinensis ID: 016833

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380--

MFGRAPKKSDNTKYYEILGVSKKRFVLSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGSPFGGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVICTKCKGKGSKSGASMKCSGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRKQQAAQEAYDEDDDMQGGAQRVQCAQQ

ccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccHHHcccccccccccccccccccccccEEEEEEEcHHHHHcccEEEEEECcEEEccccccccccccccccccccccccEEEEEEECccccEEEEEECccccccCEEEEcccccccccccccEEEEEEEEEEEEccccccccEEEEccccccccccccccEEEEEEEccccccEECcccEEEEEEccHHHHccccEEEEEcccccEEEEEEccccccccccEEEEccccccccccccccccEEEEEEEEccccccHHHHHHHHHHccccccccccccccccCEEEccccccHHHHHHHHHHHHcccccccccccccccccccccc

*F*RAPKKSDNTKYYEILGVSKKRFVLSDPEKREIYDQ*********************IFQSF**********************IHPLKVSLEDLYNGTSKKLSLSRNVICTKCKG*GS***AS*KCSGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPG**DE*PDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPDQCKMLETVL***************CEETTL**************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Chaperone protein dnaJ 2	Have a continuous role in plant development probably in the structural organization of compartments.	confident	P42825
DnaJ protein homolog 2	Have a continuous role in plant development probably in the structural organization of compartments.	probable	P42824
DnaJ protein homolog	Have a continuous role in plant development probably in the structural organization of compartments.	probable	Q04960

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NLT, chain A
Confidence level:very confident
Coverage over the Query: 80-309
View the alignment between query and template
View the model in PyMOL

Template: 3LZ8, chain A
Confidence level:very confident
Coverage over the Query: 85-119,136-138,180-324
View the alignment between query and template
View the model in PyMOL

Template: 1XAO, chain A
Confidence level:very confident
Coverage over the Query: 229-349
View the alignment between query and template
View the model in PyMOL