Citrus Sinensis ID: 016854

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-
MKVIDQKLNELKTKGAPQKEITLFMKNLGTERAKLHGWPNTYVFTKTMGEMLMQQSKENLSLVIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVGETKVIMDVIPVDMVVNAMIVAMVAHAKQPSDANIYHVGSSLRNPVTLVSILDYGFVYFTKKPWINKQGKPVKVSKIILFSSIASFHGYMQIRYLLPLKGLQVANTVFHNFFKGVYNDLRKKVKFVMRVVEIYKPYFYFNGIFDDTNTEKLRMTARGSRTETDLFYFDPDSIEWSDYFMNTHIPGVEKLLQQKRSFPKTKVFRSGHVPSYKTITERVMPMTFIQSSRMGNTHFPVSNRDKTYFQRQRLSKMTLNVLRNQIGAAPICCWKPMSGIYAL
cccccEEEcccccccccHHHHHHHHHHcccHHHHHcccccHHHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccccccHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccHHccccccEEEcccccccccccccEEEEEEEEEcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccEEEEEEEEEcccHHHHHHHHccccccccccccccccccHHHHHHHHcHHHHHHHHccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccEEEEHHHHHHHHHHHHHHHccccccccccccccccc
ccccHHHHHHHHHHcccHHHHHHHHHHccccHHHHccccccHHHHHHHHHHHHHHHcccccEEEEEccEEEccccccccccccccccccEEEEEEcccEEEEEEcccccEEEEccHHHHHHHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHHHHHHHcccccccccccccccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccEEcccHHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcccHHHHHHHHHHHHHHHHHHHHccccccEcccccccEEEc
MKVIDQKLNelktkgapqKEITLFMKNLGTeraklhgwpntYVFTKTMGEMLMQQSKENLSlviirptvvsgtykepfpgwvedLKTINTLFVASAQGNLRCLVGETKVIMDVIPVDMVVNAMIVAMVAHakqpsdaniyhvgsslrnpvTLVSILDYGFVyftkkpwinkqgkpvkvSKIILFSSIASFHGYMQIRYLLPLKGLQVANTVFHNFFKGVYNDLRKKVKFVMRVVEIYkpyfyfngifddtntEKLRMTargsrtetdlfyfdpdsiewsdyfmnTHIPGVEKLLQQkrsfpktkvfrsghvpsyktitERVMPmtfiqssrmgnthfpvsnrdktyFQRQRLSKMTLNVLRNQigaapiccwkpmsgiyal
mkvidqklnelktkgapqkeITLFMKNLgteraklhgwPNTYVFTKTMGEMLMQQSKENLSLVIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVGETKVIMDVIPVDMVVNAMIVAMVAHAKQPSDANIYHVGSSLRNPVTLVSILDYGFVYFTKKpwinkqgkpvKVSKIILFSSIASFHGYMQIRYLLPLKGLQVANTVFHNFFKGVYNDLRKKVKFVMRVVEIYKpyfyfngifddtntEKLRMTargsrtetdlfyFDPDSIEWSDYFMNTHIPGVEKLLQQKRsfpktkvfrsghvpsyktiterVMPMTFIqssrmgnthfpvsnRDKTYFQRQRLSKMTLNVLRNQigaapiccwkPMSGIYAL
MKVIDQKLNELKTKGAPQKEITLFMKNLGTERAKLHGWPNTYVFTKTMGEMLMQQSKENLSLVIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVGETKvimdvipvdmvvnamivamvaHAKQPSDANIYHVGSSLRNPVTLVSILDYGFVYFTKKPWINKQGKPVKVSKIILFSSIASFHGYMQIRYLLPLKGLQVANTVFHNFFKGVYNDLRKKVKFVMRVVEIYKPYFYFNGIFDDTNTEKLRMTARGSRTETDLFYFDPDSIEWSDYFMNTHIPGVEKLLQQKRSFPKTKVFRSGHVPSYKTITERVMPMTFIQSSRMGNTHFPVSNRDKTYFQRQRLSKMTLNVLRNQIGAAPICCWKPMSGIYAL
********************ITLFMKNLGTERAKLHGWPNTYVFTKTMGEMLMQQSKENLSLVIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVGETKVIMDVIPVDMVVNAMIVAMVAHAKQPSDANIYHVGSSLRNPVTLVSILDYGFVYFTKKPWINKQGKPVKVSKIILFSSIASFHGYMQIRYLLPLKGLQVANTVFHNFFKGVYNDLRKKVKFVMRVVEIYKPYFYFNGIFDDTNTEKLRMTARGSRTETDLFYFDPDSIEWSDYFMNTHIPGVEKLLQQKRSFPKTKVFRSGHVPSYKTITERVMPMTFIQSSRMGNTHFPVSNRDKTYFQRQRLSKMTLNVLRNQIGAAPICCWKPMSGIY**
MKVIDQKLNELKTKGAPQKEITLFMKNLGTERAKLHGWPNTYVFTKTMGEMLMQQSKENLSLVIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVGETKVIMDVIPVDMVVNAMIVAMVAHAKQPSDANIYHVGSSLRNPVTLVSILDYGFVYFTKKPWINKQGKPVKVSKIILFSSIASFHGYMQIRYLLPLKGLQVANTVFHNFFKGVYNDLRKKVKFVMRVVEIYKPYFYFNGIFDDTNTEKLRMTARGSRTETDLFYFDPDSIEWSDYFMNTHIPGVEKLLQQKRSFPKTKVFRSGHVPSYKTITERVMPMTFIQSSRMGNTHFPVSNRDKTYFQRQRLSKMTLNVLRNQIGAAPICCWKPMSGIYAL
MKVIDQKLNELKTKGAPQKEITLFMKNLGTERAKLHGWPNTYVFTKTMGEMLMQQSKENLSLVIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVGETKVIMDVIPVDMVVNAMIVAMVAHAKQPSDANIYHVGSSLRNPVTLVSILDYGFVYFTKKPWINKQGKPVKVSKIILFSSIASFHGYMQIRYLLPLKGLQVANTVFHNFFKGVYNDLRKKVKFVMRVVEIYKPYFYFNGIFDDTNTEKLRMTARGSRTETDLFYFDPDSIEWSDYFMNTHIPGVEKLLQQKRSFPKTKVFRSGHVPSYKTITERVMPMTFIQSSRMGNTHFPVSNRDKTYFQRQRLSKMTLNVLRNQIGAAPICCWKPMSGIYAL
MKVIDQKLNELKTKGAPQKEITLFMKNLGTERAKLHGWPNTYVFTKTMGEMLMQQSKENLSLVIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVGETKVIMDVIPVDMVVNAMIVAMVAHAKQPSDANIYHVGSSLRNPVTLVSILDYGFVYFTKKPWINKQGKPVKVSKIILFSSIASFHGYMQIRYLLPLKGLQVANTVFHNFFKGVYNDLRKKVKFVMRVVEIYKPYFYFNGIFDDTNTEKLRMTARGSRTETDLFYFDPDSIEWSDYFMNTHIPGVEKLLQQKRSFPKTKVFRSGHVPSYKTITERVMPMTFIQSSRMGNTHFPVSNRDKTYFQRQRLSKMTLNVLRNQIGAAPICCWKPMSGIYAL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVIDQKLNELKTKGAPQKEITLFMKNLGTERAKLHGWPNTYVFTKTMGEMLMQQSKENLSLVIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVGETKVIMDVIPVDMVVNAMIVAMVAHAKQPSDANIYHVGSSLRNPVTLVSILDYGFVYFTKKPWINKQGKPVKVSKIILFSSIASFHGYMQIRYLLPLKGLQVANTVFHNFFKGVYNDLRKKVKFVMRVVEIYKPYFYFNGIFDDTNTEKLRMTARGSRTETDLFYFDPDSIEWSDYFMNTHIPGVEKLLQQKRSFPKTKVFRSGHVPSYKTITERVMPMTFIQSSRMGNTHFPVSNRDKTYFQRQRLSKMTLNVLRNQIGAAPICCWKPMSGIYAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query381 2.2.26 [Sep-21-2011]
Q9XGY7493 Alcohol-forming fatty acy N/A no 0.758 0.586 0.527 7e-91
Q93ZB9493 Fatty acyl-CoA reductase yes no 0.761 0.588 0.484 2e-85
Q9LXN3493 Probable fatty acyl-CoA r no no 0.761 0.588 0.477 1e-81
Q39152491 Fatty acyl-CoA reductase no no 0.750 0.582 0.498 6e-81
Q0WRB0496 Probable fatty acyl-CoA r no no 0.758 0.582 0.462 2e-74
Q1PEI6496 Fatty acyl-CoA reductase no no 0.758 0.582 0.441 7e-66
Q9FMQ9409 Putative fatty acyl-CoA r no no 0.708 0.660 0.405 5e-62
Q08891616 Fatty acyl-CoA reductase no no 0.745 0.461 0.335 5e-48
B9TSP7548 Fatty acyl-CoA reductase no no 0.687 0.478 0.305 2e-33
Q96K12515 Fatty acyl-CoA reductase yes no 0.671 0.497 0.276 1e-23
>sp|Q9XGY7|FAR_SIMCH Alcohol-forming fatty acyl-CoA reductase OS=Simmondsia chinensis PE=1 SV=1 Back     alignment and function desciption
 Score =  334 bits (856), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 153/290 (52%), Positives = 209/290 (72%), Gaps = 1/290 (0%)

Query: 2   KVIDQKLNELKTKGAPQKEITLFMKNLGTERAKLHGWPNTYVFTKTMGEMLMQQSKENLS 61
           K+++ K+NEL+  GA +K I   MK++G ERA+  GWPN YVFTK +GEML+ Q K ++ 
Sbjct: 198 KLVEAKINELQAAGATEKSIKSTMKDMGIERARHWGWPNVYVFTKALGEMLLMQYKGDIP 257

Query: 62  LVIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVGETKVIMDVIPVDMVVN 121
           L IIRPT+++ T+KEPFPGWVE ++TI+ + V   +G LRC++     I+D+IP DMVVN
Sbjct: 258 LTIIRPTIITSTFKEPFPGWVEGVRTIDNVPVYYGKGRLRCMLCGPSTIIDLIPADMVVN 317

Query: 122 AMIVAMVAHAKQP-SDANIYHVGSSLRNPVTLVSILDYGFVYFTKKPWINKQGKPVKVSK 180
           A IVAMVAHA Q   +   YHVGSS  NP+ L ++ +    YFTK PWIN    PV V +
Sbjct: 318 ATIVAMVAHANQRYVEPVTYHVGSSAANPMKLSALPEMAHRYFTKNPWINPDRNPVHVGR 377

Query: 181 IILFSSIASFHGYMQIRYLLPLKGLQVANTVFHNFFKGVYNDLRKKVKFVMRVVEIYKPY 240
            ++FSS ++FH Y+ + +LLPLK L++ANT+F  +FKG Y DL++K + ++R+V+IYKPY
Sbjct: 378 AMVFSSFSTFHLYLTLNFLLPLKVLEIANTIFCQWFKGKYMDLKRKTRLLLRLVDIYKPY 437

Query: 241 FYFNGIFDDTNTEKLRMTARGSRTETDLFYFDPDSIEWSDYFMNTHIPGV 290
            +F GIFDD NTEKLR+ A+ S  E D+FYFDP +I W DYF+ TH PGV
Sbjct: 438 LFFQGIFDDMNTEKLRIAAKESIVEADMFYFDPRAINWEDYFLKTHFPGV 487
NADPH-dependent alcohol-forming fatty acyl-coenzyme A reductase that catalyzes the reduction of fatty acyl-CoA to fatty alcohols. The recombinant enzyme accepts saturated and mono-unsaturated fatty acyl-CoAs of 16 to 22 carbons.
Simmondsia chinensis (taxid: 3999)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 8EC: 4
>sp|Q93ZB9|FACR3_ARATH Fatty acyl-CoA reductase 3 OS=Arabidopsis thaliana GN=FAR3 PE=2 SV=1 Back     alignment and function description
>sp|Q9LXN3|FACR4_ARATH Probable fatty acyl-CoA reductase 4 OS=Arabidopsis thaliana GN=FAR4 PE=2 SV=1 Back     alignment and function description
>sp|Q39152|FACR1_ARATH Fatty acyl-CoA reductase 1 OS=Arabidopsis thaliana GN=FAR1 PE=2 SV=1 Back     alignment and function description
>sp|Q0WRB0|FACR5_ARATH Probable fatty acyl-CoA reductase 5 OS=Arabidopsis thaliana GN=FAR5 PE=2 SV=1 Back     alignment and function description
>sp|Q1PEI6|FACR8_ARATH Fatty acyl-CoA reductase 8 OS=Arabidopsis thaliana GN=FAR8 PE=2 SV=1 Back     alignment and function description
>sp|Q9FMQ9|FACR7_ARATH Putative fatty acyl-CoA reductase 7 OS=Arabidopsis thaliana GN=FAR7 PE=3 SV=1 Back     alignment and function description
>sp|Q08891|FACR2_ARATH Fatty acyl-CoA reductase 2 OS=Arabidopsis thaliana GN=FAR2 PE=2 SV=2 Back     alignment and function description
>sp|B9TSP7|FACR6_ARATH Fatty acyl-CoA reductase 6, chloroplastic OS=Arabidopsis thaliana GN=FAR6 PE=2 SV=1 Back     alignment and function description
>sp|Q96K12|FACR2_HUMAN Fatty acyl-CoA reductase 2 OS=Homo sapiens GN=FAR2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query381
356543580 490 PREDICTED: fatty acyl-CoA reductase 3-li 0.758 0.589 0.582 1e-104
356550111 490 PREDICTED: fatty acyl-CoA reductase 3-li 0.758 0.589 0.582 1e-103
224078578378 predicted protein [Populus trichocarpa] 0.763 0.769 0.611 1e-103
356550113413 PREDICTED: fatty acyl-CoA reductase 3-li 0.758 0.699 0.582 1e-102
356542728 493 PREDICTED: fatty acyl-CoA reductase 3-li 0.763 0.590 0.597 1e-102
356542730416 PREDICTED: fatty acyl-CoA reductase 3-li 0.763 0.699 0.597 1e-102
449443606 492 PREDICTED: LOW QUALITY PROTEIN: fatty ac 0.761 0.589 0.568 1e-101
356541412 523 PREDICTED: fatty acyl-CoA reductase 3-li 0.763 0.556 0.587 1e-101
388491432 492 unknown [Medicago truncatula] 0.761 0.589 0.580 1e-101
357453013 492 Fatty acyl-CoA reductase [Medicago trunc 0.761 0.589 0.577 1e-100
>gi|356543580|ref|XP_003540238.1| PREDICTED: fatty acyl-CoA reductase 3-like [Glycine max] Back     alignment and taxonomy information
 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 169/290 (58%), Positives = 227/290 (78%), Gaps = 1/290 (0%)

Query: 3   VIDQKLNELKTKGAPQKEITLFMKNLGTERAKLHGWPNTYVFTKTMGEMLMQQSKENLSL 62
           ++  KL+EL+ +GA ++EI + MKNLG  RAK++GWPNTYVFTK +GEML++Q K +LS+
Sbjct: 198 IVCDKLDELREQGATEREIEIAMKNLGISRAKVYGWPNTYVFTKAVGEMLVEQLKGSLSV 257

Query: 63  VIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVGETKVIMDVIPVDMVVNA 122
           VI+RPT+V+ T +EPFPGW E ++TI++L V   +G L+C +G    ++DV+P DMVVNA
Sbjct: 258 VIMRPTIVTSTLREPFPGWAEGVRTIDSLAVTYGKGKLKCFLGNINGVVDVVPADMVVNA 317

Query: 123 MIVAMVAHAKQPSDANIYHVGSSLRNPVTLVSILDYGFVYFTKKPWINKQGKPVKVSKII 182
           M+VAMVAHAKQPSD  +YHVGSSLRNP+T +++ DYG  YFT KPWINK G PVKV ++ 
Sbjct: 318 MLVAMVAHAKQPSDI-VYHVGSSLRNPLTYLNLQDYGLKYFTAKPWINKDGTPVKVGRVT 376

Query: 183 LFSSIASFHGYMQIRYLLPLKGLQVANTVFHNFFKGVYNDLRKKVKFVMRVVEIYKPYFY 242
           + + + SF  YM IRYLLPLKGL++ANT    +F+G Y +L +K++ VMR+VE+Y+PY +
Sbjct: 377 VLTDMDSFQRYMFIRYLLPLKGLELANTALCQYFRGTYLELHRKIQVVMRMVELYRPYMF 436

Query: 243 FNGIFDDTNTEKLRMTARGSRTETDLFYFDPDSIEWSDYFMNTHIPGVEK 292
           F+G+FDD NTEKLRM A+ S TETDLFYFD   + W DYFM TH+PG+ K
Sbjct: 437 FDGVFDDMNTEKLRMAAKQSGTETDLFYFDTKEVNWDDYFMKTHLPGIVK 486

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356550111|ref|XP_003543433.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|224078578|ref|XP_002305561.1| predicted protein [Populus trichocarpa] gi|222848525|gb|EEE86072.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356550113|ref|XP_003543434.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356542728|ref|XP_003539817.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356542730|ref|XP_003539818.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|449443606|ref|XP_004139568.1| PREDICTED: LOW QUALITY PROTEIN: fatty acyl-CoA reductase 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356541412|ref|XP_003539171.1| PREDICTED: fatty acyl-CoA reductase 3-like [Glycine max] Back     alignment and taxonomy information
>gi|388491432|gb|AFK33782.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357453013|ref|XP_003596783.1| Fatty acyl-CoA reductase [Medicago truncatula] gi|355485831|gb|AES67034.1| Fatty acyl-CoA reductase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query381
TAIR|locus:2134278493 CER4 "ECERIFERUM 4" [Arabidops 0.761 0.588 0.446 1.6e-70
TAIR|locus:2076028493 FAR4 "fatty acid reductase 4" 0.761 0.588 0.439 2.4e-67
TAIR|locus:2171107491 FAR1 "fatty acid reductase 1" 0.766 0.594 0.452 9.4e-66
TAIR|locus:2076023496 FAR5 "fatty acid reductase 5" 0.758 0.582 0.421 3.1e-60
TAIR|locus:2076038496 FAR8 "fatty acid reductase 8" 0.758 0.582 0.407 7.3e-59
TAIR|locus:2176407409 FAR7 "fatty acid reductase 7" 0.732 0.682 0.368 4.6e-50
TAIR|locus:2088664616 MS2 "MALE STERILITY 2" [Arabid 0.753 0.465 0.301 4e-37
UNIPROTKB|F8VV73418 FAR2 "Fatty acyl-CoA reductase 0.301 0.275 0.327 1.7e-16
UNIPROTKB|Q96K12515 FAR2 "Fatty acyl-CoA reductase 0.301 0.223 0.327 4.6e-16
UNIPROTKB|F1SGA0515 FAR2 "Uncharacterized protein" 0.664 0.491 0.259 8.3e-16
TAIR|locus:2134278 CER4 "ECERIFERUM 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 714 (256.4 bits), Expect = 1.6e-70, P = 1.6e-70
 Identities = 130/291 (44%), Positives = 188/291 (64%)

Query:     2 KVIDQKLNELKTKGAPQKEITLFMKNLGTERAKLHGWPNTYVFTKTMGEMLMQQSKENLS 61
             K++ +KL++L+  GA  + IT  MK+LG  RAK++GWPNTYVFTK MGEM++   +ENLS
Sbjct:   201 KLVQEKLDQLRVIGAAPETITETMKDLGLRRAKMYGWPNTYVFTKAMGEMMVGTKRENLS 260

Query:    62 LVIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVGETKXXXXXXXXXXXXX 121
             LV++RP++++ T+KEPFPGW E ++TI++L V   +G L C + +               
Sbjct:   261 LVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGKLTCFLCDLDAVSDVMPADMVVN 320

Query:   122 XXXXXXXXHAKQPSDANIYHVGSSLRNPVTLVSILDYGFVYFTKKPWINKQGKPVKVSKI 181
                      A +  +  IYHVGSSLRNP+      +  + YF+ KPW NK+GK VKV  I
Sbjct:   321 SILVSMAAQAGKQEEI-IYHVGSSLRNPMKNSKFPELAYRYFSIKPWTNKEGKVVKVGAI 379

Query:   182 ILFSSIASFHGYMQIRYLLPLKGLQVANTVFHNFFKGVYNDLRKKVKFVMRVVEIYKPYF 241
              + SS+ SFH YM IRYL+ LKGL++ N +    F+  +    KK+ F+ R+V++Y+PY 
Sbjct:   380 EILSSMRSFHRYMTIRYLIALKGLELVNIILCKLFEKEFQYFNKKINFIFRLVDLYQPYL 439

Query:   242 YFNGIFDDTNTEKLRMTARGSRTETDLFYFDPDSIEWSDYFMNTHIPGVEK 292
             +F GIFDD+NTEKLR     +  E ++FYFDP  ++W DYF+NTH+ G+ K
Sbjct:   440 FFYGIFDDSNTEKLRKMVSKTGVENEMFYFDPKVLDWDDYFLNTHVIGLLK 490
GO:0000166 "nucleotide binding" evidence=IEA
GO:0009556 "microsporogenesis" evidence=ISS
GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0016627 "oxidoreductase activity, acting on the CH-CH group of donors" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0010025 "wax biosynthetic process" evidence=IMP
GO:0080019 "fatty-acyl-CoA reductase (alcohol-forming) activity" evidence=IDA;IMP
TAIR|locus:2076028 FAR4 "fatty acid reductase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171107 FAR1 "fatty acid reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076023 FAR5 "fatty acid reductase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076038 FAR8 "fatty acid reductase 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176407 FAR7 "fatty acid reductase 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088664 MS2 "MALE STERILITY 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F8VV73 FAR2 "Fatty acyl-CoA reductase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q96K12 FAR2 "Fatty acyl-CoA reductase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGA0 FAR2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query381
PLN02996491 PLN02996, PLN02996, fatty acyl-CoA reductase 1e-152
PLN02503605 PLN02503, PLN02503, fatty acyl-CoA reductase 2 7e-67
cd05236320 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (F 6e-48
pfam07993245 pfam07993, NAD_binding_4, Male sterility protein 6e-27
cd0907192 cd09071, FAR_C, C-terminal domain of fatty acyl Co 8e-13
pfam0301594 pfam03015, Sterile, Male sterility protein 3e-08
cd05263293 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens 2e-05
>gnl|CDD|215538 PLN02996, PLN02996, fatty acyl-CoA reductase Back     alignment and domain information 
 Score =  438 bits (1128), Expect = e-152
 Identities = 166/293 (56%), Positives = 212/293 (72%), Gaps = 1/293 (0%)

Query: 1   MKVIDQKLNELKTKGAPQKEITLFMKNLGTERAKLHGWPNTYVFTKTMGEMLMQQSKENL 60
            K++ +KL EL  + A ++EIT  MK+LG ERAKLHGWPNTYVFTK MGEML+   KENL
Sbjct: 195 KKLVKEKLKELNEQDASEEEITQAMKDLGMERAKLHGWPNTYVFTKAMGEMLLGNFKENL 254

Query: 61  SLVIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVGETKVIMDVIPVDMVV 120
            LVIIRPT+++ TYKEPFPGW+E L+TI+++ V   +G L C + +   ++DVIP DMVV
Sbjct: 255 PLVIIRPTMITSTYKEPFPGWIEGLRTIDSVIVGYGKGKLTCFLADPNSVLDVIPADMVV 314

Query: 121 NAMIVAMVAHAKQPSDANIYHVGSSLRNPVTLVSILDYGFVYFTKKPWINKQGKPVKVSK 180
           NAMIVAM AHA       IYHVGSSL+NPV   ++ D+ + YF+K PWINK+G PVKV K
Sbjct: 315 NAMIVAMAAHAGGQGSEIIYHVGSSLKNPVKFSNLHDFAYRYFSKNPWINKEGSPVKVGK 374

Query: 181 IILFSSIASFHGYMQIRYLLPLKGLQVANTVFHNFFKGVYNDLRKKVKFVMRVVEIYKPY 240
             + S++ASF  YM IRYLLPLK LQ+ N +    +   Y DL +K+K VMR+V++YKPY
Sbjct: 375 GTILSTMASFSLYMTIRYLLPLKALQLVNIILPKRYGDKYTDLNRKIKLVMRLVDLYKPY 434

Query: 241 FYFNGIFDDTNTEKLRMTARG-SRTETDLFYFDPDSIEWSDYFMNTHIPGVEK 292
            +F GIFDDTNTEKLR+  +   + E D+F FDP SI+W DY  N HIPG+ K
Sbjct: 435 VFFKGIFDDTNTEKLRIKRKETGKEEADMFDFDPKSIDWEDYMTNVHIPGLVK 487

Length = 491
>gnl|CDD|215279 PLN02503, PLN02503, fatty acyl-CoA reductase 2 Back     alignment and domain information
>gnl|CDD|187547 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (FARs), extended (e) SDRs Back     alignment and domain information
>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein Back     alignment and domain information
>gnl|CDD|176924 cd09071, FAR_C, C-terminal domain of fatty acyl CoA reductases Back     alignment and domain information
>gnl|CDD|111859 pfam03015, Sterile, Male sterility protein Back     alignment and domain information
>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like, extended (e) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 381
KOG1221467 consensus Acyl-CoA reductase [Lipid transport and 100.0
PLN02996491 fatty acyl-CoA reductase 100.0
PLN02503605 fatty acyl-CoA reductase 2 100.0
PF0301594 Sterile: Male sterility protein; InterPro: IPR0042 99.93
cd0907192 FAR_C C-terminal domain of fatty acyl CoA reductas 99.88
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.55
PRK07201 657 short chain dehydrogenase; Provisional 99.07
COG3320382 Putative dehydrogenase domain of multifunctional n 98.95
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 98.89
TIGR01746367 Thioester-redct thioester reductase domain. It has 98.86
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 98.8
PLN02427386 UDP-apiose/xylose synthase 98.79
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 98.76
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 98.74
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 98.71
PRK11908347 NAD-dependent epimerase/dehydratase family protein 98.7
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 98.68
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.68
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 98.67
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 98.62
PLN02260 668 probable rhamnose biosynthetic enzyme 98.6
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 98.59
PLN02166436 dTDP-glucose 4,6-dehydratase 98.58
PLN02572442 UDP-sulfoquinovose synthase 98.52
PLN02206442 UDP-glucuronate decarboxylase 98.52
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 98.52
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 98.5
PLN02214342 cinnamoyl-CoA reductase 98.5
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 98.48
PLN02695370 GDP-D-mannose-3',5'-epimerase 98.48
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 98.4
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 98.4
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 98.38
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 98.38
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 98.37
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 98.35
PLN02240352 UDP-glucose 4-epimerase 98.3
PLN00198338 anthocyanidin reductase; Provisional 98.29
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 98.25
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 98.21
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 98.21
PRK10675338 UDP-galactose-4-epimerase; Provisional 98.2
PLN00016378 RNA-binding protein; Provisional 98.19
PLN02650351 dihydroflavonol-4-reductase 98.18
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 98.15
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 98.13
PLN02896353 cinnamyl-alcohol dehydrogenase 98.11
PLN02583297 cinnamoyl-CoA reductase 98.11
PLN02686367 cinnamoyl-CoA reductase 98.05
PLN02653340 GDP-mannose 4,6-dehydratase 98.0
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 97.97
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 97.96
CHL00194317 ycf39 Ycf39; Provisional 97.96
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 97.85
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 97.84
PLN02778298 3,5-epimerase/4-reductase 97.79
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 97.73
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 97.66
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 97.53
PRK05865 854 hypothetical protein; Provisional 97.32
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 97.3
PLN02260668 probable rhamnose biosynthetic enzyme 96.8
PTZ00374 1108 dihydroxyacetone phosphate acyltransferase; Provis 96.62
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 96.57
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 96.4
KOG4288283 consensus Predicted oxidoreductase [General functi 95.95
PRK12320 699 hypothetical protein; Provisional 95.89
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 95.63
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 95.27
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 95.21
PRK06482276 short chain dehydrogenase; Provisional 95.16
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 94.98
PRK09135249 pteridine reductase; Provisional 94.89
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 94.63
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 93.83
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 92.54
PRK06914280 short chain dehydrogenase; Provisional 92.24
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 91.94
PRK07775274 short chain dehydrogenase; Provisional 91.63
PRK12829264 short chain dehydrogenase; Provisional 91.59
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.53
PRK05875276 short chain dehydrogenase; Provisional 91.26
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 91.25
PRK12746254 short chain dehydrogenase; Provisional 91.05
PRK08263275 short chain dehydrogenase; Provisional 90.95
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 90.71
PRK05876275 short chain dehydrogenase; Provisional 90.18
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 89.34
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 88.84
PRK07067257 sorbitol dehydrogenase; Provisional 88.53
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 88.34
PRK07806248 short chain dehydrogenase; Provisional 87.64
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.85
PRK12935247 acetoacetyl-CoA reductase; Provisional 86.72
PRK06138252 short chain dehydrogenase; Provisional 86.46
PRK07074257 short chain dehydrogenase; Provisional 85.69
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 84.57
PRK07774250 short chain dehydrogenase; Provisional 84.16
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 83.21
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 82.93
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 82.35
PRK07060245 short chain dehydrogenase; Provisional 81.95
PRK12827249 short chain dehydrogenase; Provisional 81.82
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 81.44
PRK08628258 short chain dehydrogenase; Provisional 81.41
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 81.34
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 81.33
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.3e-69  Score=545.71  Aligned_cols=263  Identities=37%  Similarity=0.646  Sum_probs=248.2

Q ss_pred             ccccccCCCCchHHHHHHHHHHHHHHhcCCCcEEEEccceeccCCCCCcCccccCCcchHHHHHHhhcCcccccccCCCc
Q 016854           30 TERAKLHGWPNTYVFTKTMGEMLMQQSKENLSLVIIRPTVVSGTYKEPFPGWVEDLKTINTLFVASAQGNLRCLVGETKV  109 (381)
Q Consensus        30 ~~~~~~~~~pNtYt~TK~lAE~lV~~~~~~LPi~IvRPsiV~~~~~eP~pGwid~~~g~~~~~~~~~~G~l~~~~~~~~~  109 (381)
                      ++++++++|||||||||++||++|.+++++||++|+|||||+++++||+|||+||++||+|++.++|+|++|++.+|++.
T Consensus       196 ~~~~l~~~~PNTYtfTKal~E~~i~~~~~~lPivIiRPsiI~st~~EP~pGWidn~~gp~g~i~g~gkGvlr~~~~d~~~  275 (467)
T KOG1221|consen  196 KAPKLLGGWPNTYTFTKALAEMVIQKEAENLPLVIIRPSIITSTYKEPFPGWIDNLNGPDGVIIGYGKGVLRCFLVDPKA  275 (467)
T ss_pred             hhHHhcCCCCCceeehHhhHHHHHHhhccCCCeEEEcCCceeccccCCCCCccccCCCCceEEEEeccceEEEEEEcccc
Confidence            47888899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccchHHHHHHHHHHHHHHhccCCC--CCcEEEeccCCCCCccHHHHHHHHhhhcccCCCCCCCCCcEEecceeeechh
Q 016854          110 IMDVIPVDMVVNAMIVAMVAHAKQPS--DANIYHVGSSLRNPVTLVSILDYGFVYFTKKPWINKQGKPVKVSKIILFSSI  187 (381)
Q Consensus       110 ~~diVPVD~Vvnaii~aa~~~~~~~~--~~~vYn~~s~~~npit~~~~~~~~~~~~~~~P~~~~~g~~i~~p~~~~~~~~  187 (381)
                      .+|+||||+|||++|+++|+++.+.+  +..|||++||..||+||+++.+.+.+++.++|+.+    .+|+|...+++|.
T Consensus       276 ~adiIPvD~vvN~~ia~~~~~~~~~~~~~~~IY~~tss~~Np~t~~~~~e~~~~~~~~~Pl~~----~iw~P~~~~~sn~  351 (467)
T KOG1221|consen  276 VADIIPVDMVVNAMIASAWQHAGNSKEKTPPIYHLTSSNDNPVTWGDFIELALRYFEKIPLEK----MIWYPFGTLTSNP  351 (467)
T ss_pred             ccceeeHHHHHHHHHHHHHHHhccCCCCCCcEEEecccccCcccHHHHHHHHHHhcccCCccc----ceeccCceeeecH
Confidence            99999999999999999998875433  37799999999999999999999999999999997    7999999999999


Q ss_pred             HHHHHHHHHHHhhhhhhHHHHHhhhccccchhHHHHHHHHHHHHHHHHhccccccceEEEechhHHHHHhhcCCCCCCCc
Q 016854          188 ASFHGYMQIRYLLPLKGLQVANTVFHNFFKGVYNDLRKKVKFVMRVVEIYKPYFYFNGIFDDTNTEKLRMTARGSRTETD  267 (381)
Q Consensus       188 ~~f~~~~~l~~~lPA~l~Dl~~~l~g~~~kp~~~kl~rki~~~~~~~~~~~~Ft~~eW~Fdn~N~~~L~~~Ls~eD~dr~  267 (381)
                      +.|.++++++|++||+++|+++++.|+  +|.+.+++++   +++..++++||++++|+||++|+.+|++.||++|  |+
T Consensus       352 ~~f~~~~~~~h~lPa~~~d~~~~i~g~--k~~~~k~~~k---i~~~~~~l~~f~~~~w~Fd~~n~~~L~~~~~~~d--~~  424 (467)
T KOG1221|consen  352 WLFNLAAFLYHTLPAYILDLLLRLLGK--KPRLVKLYRK---IHKLVKLLEPFSLFKWIFDNKNTEKLREKMSEED--KR  424 (467)
T ss_pred             hHHHHHHHHHHHhhHHHHHHHHHHhCC--ChhhhHHHHH---HHHHHHhhhhheeceEEecCccHHHHHHhCCHHH--Hh
Confidence            999999999999999999999988753  6777766666   6678889999999999999999999999999987  99


Q ss_pred             ccccCCCCCCHHHHHhhcchhHHHHHhhCCC--Ccccch
Q 016854          268 LFYFDPDSIEWSDYFMNTHIPGVEKLLQQKR--SFPKTK  304 (381)
Q Consensus       268 ~F~FD~~~IDW~~Y~~~~~i~GiRkYllKE~--~lp~ak  304 (381)
                      +|+||+.++||++|+.+ |++|+|+|++||+  ++|+||
T Consensus       425 ~f~fd~~~ldW~ey~~~-~i~G~r~~llKe~~e~l~~~r  462 (467)
T KOG1221|consen  425 LFNFDMKQLDWEEYFNR-HLLGLRKYLLKESPESLPQAR  462 (467)
T ss_pred             hcCCCcccCCHHHHHHH-HHHHHHHHHhcCChhhhHHHH
Confidence            99999999999999999 7999999999998  999999

>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PF03015 Sterile: Male sterility protein; InterPro: IPR004262 This family represents the C-terminal region of the male sterility protein in a number of organisms Back     alignment and domain information
>cd09071 FAR_C C-terminal domain of fatty acyl CoA reductases Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PTZ00374 dihydroxyacetone phosphate acyltransferase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query381
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 5e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 8e-06
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Length = 478 Back     alignment and structure
 Score = 66.1 bits (161), Expect = 5e-12
 Identities = 26/158 (16%), Positives = 51/158 (32%), Gaps = 23/158 (14%)

Query: 31  ERAKLHGWPNTYVFTKTMGEMLMQQ--SKENLSLVIIRPTVVSGTYKEPFPGWVEDLKTI 88
            R    GW   Y  +K  GE+L+++      L + + R  ++           + D   +
Sbjct: 238 TRTVDGGWAGGYGTSKWAGEVLLREANDLCALPVAVFRCGMILADTSYAGQLNMSDW--V 295

Query: 89  NTLFVASAQ--------GNLRCLVGETKVIMDVIPVDMVVNAMIVAMVAHAKQPSDAN-I 139
             + ++                     +   D +PV  V  A+ V     A         
Sbjct: 296 TRMVLSLMATGIAPRSFYEPDSEGNRQRAHFDGLPVTFVAEAIAVLGARVAGSSLAGFAT 355

Query: 140 YHVGSSLRNPVTLVSILDYGFVYFTKKPWINKQGKPVK 177
           YHV +   + + L   +D          W+ + G P++
Sbjct: 356 YHVMNPHDDGIGLDEYVD----------WLIEAGYPIR 383
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query381
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.15
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.02
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.01
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 98.99
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 98.99
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 98.97
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 98.95
4f6l_B508 AUSA reductase domain protein; thioester reductase 98.92
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 98.92
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 98.89
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 98.89
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 98.88
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 98.88
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 98.87
3ius_A286 Uncharacterized conserved protein; APC63810, silic 98.86
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 98.85
4f6c_A427 AUSA reductase domain protein; thioester reductase 98.85
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 98.84
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 98.82
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 98.82
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 98.79
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 98.79
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 98.78
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 98.76
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 98.76
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 98.76
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 98.76
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 98.76
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 98.75
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 98.74
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 98.74
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 98.74
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 98.72
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 98.72
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 98.71
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 98.7
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 98.69
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 98.67
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 98.65
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 98.62
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 98.58
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 98.56
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 98.55
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 98.54
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 98.54
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 98.53
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 98.49
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 98.48
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 98.44
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 98.42
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 98.41
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 98.4
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 98.39
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 98.39
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 98.39
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 98.38
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 98.36
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 98.36
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 98.35
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 98.34
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 98.32
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 98.32
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 98.31
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 98.31
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 98.3
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 98.17
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 98.15
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 98.08
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 98.08
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 98.07
1xq6_A253 Unknown protein; structural genomics, protein stru 97.98
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 97.95
2wm3_A299 NMRA-like family domain containing protein 1; unkn 97.92
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 97.89
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 97.85
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 97.82
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 97.81
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 97.79
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 97.77
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 97.7
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.66
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 97.63
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.49
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 97.33
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 97.32
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.21
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 96.34
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 96.18
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 96.13
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 95.21
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 95.01
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 94.52
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 94.45
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 94.32
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 93.91
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 93.31
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 92.96
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 92.81
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 92.16
1spx_A278 Short-chain reductase family member (5L265); paral 92.0
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 91.74
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 91.44
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 91.16
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 91.08
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 90.93
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 90.3
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 89.33
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 88.97
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 88.92
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 88.5
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 87.73
1xq1_A266 Putative tropinone reducatse; structural genomics, 87.61
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 87.03
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 86.42
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 86.33
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 86.29
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 85.8
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 85.61
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 85.43
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 85.25
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 84.87
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 84.43
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 84.42
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 84.32
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 84.27
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 84.26
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 83.6
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 83.15
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 82.95
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 82.85
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 82.67
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 81.91
1nff_A260 Putative oxidoreductase RV2002; directed evolution 81.4
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 81.31
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 80.68
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 80.31
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 80.3
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
Probab=99.15  E-value=7.8e-11  Score=120.23  Aligned_cols=121  Identities=21%  Similarity=0.351  Sum_probs=86.9

Q ss_pred             CCCCchHHHHHHHHHHHHHHhcC--CCcEEEEccceeccCCC-C---CcCccccCCcchHHHHHH-hhcCccc-ccccC-
Q 016854           36 HGWPNTYVFTKTMGEMLMQQSKE--NLSLVIIRPTVVSGTYK-E---PFPGWVEDLKTINTLFVA-SAQGNLR-CLVGE-  106 (381)
Q Consensus        36 ~~~pNtYt~TK~lAE~lV~~~~~--~LPi~IvRPsiV~~~~~-e---P~pGwid~~~g~~~~~~~-~~~G~l~-~~~~~-  106 (381)
                      ..++|.|+.||+.+|++++++..  +++++|+||+.|+|... .   +..+|+.      .++.. ...|..+ .++++ 
T Consensus       243 ~~~~~~Y~~sK~~~E~~~~~~~~~~gi~~~ivRpg~v~G~~~~~g~~~~~~~~~------~l~~~~~~~g~~P~~~~~~~  316 (478)
T 4dqv_A          243 GGWAGGYGTSKWAGEVLLREANDLCALPVAVFRCGMILADTSYAGQLNMSDWVT------RMVLSLMATGIAPRSFYEPD  316 (478)
T ss_dssp             TTSEECHHHHHHHHHHHHHHHHHHHCCCEEEEEECEEECCSSSSSCCCTTBHHH------HHHHHHHHHCEEESCSBCCC
T ss_pred             cccccchHHHHHHHHHHHHHHHHHhCCCeEEEECceeeCCCccCCcCCHHHHHH------HHHHHHHHcCcccccccccc
Confidence            45668899999999999998754  89999999999998643 1   2223322      22222 2345543 22222 


Q ss_pred             -----CCcccccchHHHHHHHHHHHHHHhcc-CCCCCcEEEeccCCCCCccHHHHHHHHhhh
Q 016854          107 -----TKVIMDVIPVDMVVNAMIVAMVAHAK-QPSDANIYHVGSSLRNPVTLVSILDYGFVY  162 (381)
Q Consensus       107 -----~~~~~diVPVD~Vvnaii~aa~~~~~-~~~~~~vYn~~s~~~npit~~~~~~~~~~~  162 (381)
                           .+...|.||||.||++++.++..... ....+.+||++++..+++||.|+.+.+.++
T Consensus       317 ~~G~~~~~~~~~v~vdDvA~ai~~~~~~~~~~~~~~~~~ynv~~~~~~~~s~~el~~~l~~~  378 (478)
T 4dqv_A          317 SEGNRQRAHFDGLPVTFVAEAIAVLGARVAGSSLAGFATYHVMNPHDDGIGLDEYVDWLIEA  378 (478)
T ss_dssp             TTSCCCCCCCCEEEHHHHHHHHHHHHHTTC-CCCCSEEEEEESCCCCSSCSHHHHHHHHHHT
T ss_pred             cccccccceeeeeeHHHHHHHHHHHHhhcccCCCCCCceEEecCCCCCCcCHHHHHHHHHHc
Confidence                 26788999999999999999875321 122567999999865669999999999886
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query381
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 98.86
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 98.84
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 98.8
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.75
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 98.74
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.69
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 98.64
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 98.64
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 98.62
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.37
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.33
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 98.32
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 98.29
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 98.27
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 98.18
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 98.15
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 98.14
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.14
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.07
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 98.07
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 97.91
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 97.83
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 97.74
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 97.5
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 97.45
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 97.29
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 96.99
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 96.28
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 95.57
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 94.65
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Polymyxin resistance protein ArnA (PrmI)
species: Escherichia coli [TaxId: 562]

Probab=98.86  E-value=6.2e-09  Score=97.98  Aligned_cols=126  Identities=16%  Similarity=0.197  Sum_probs=95.9

Q ss_pred             chHHHHHHHHHHHHHHhcC--CCcEEEEccceeccCCCCCcCccccCCcc-hHHHHHHhhcCcccccccCCCcccccchH
Q 016854           40 NTYVFTKTMGEMLMQQSKE--NLSLVIIRPTVVSGTYKEPFPGWVEDLKT-INTLFVASAQGNLRCLVGETKVIMDVIPV  116 (381)
Q Consensus        40 NtYt~TK~lAE~lV~~~~~--~LPi~IvRPsiV~~~~~eP~pGwid~~~g-~~~~~~~~~~G~l~~~~~~~~~~~diVPV  116 (381)
                      +.|+.||.+||+++..+..  ++|++|+||+.|++....+.-|-.++... ...++..+..|.--.++++++..-|++.|
T Consensus       146 ~~Y~~sK~~~E~~~~~~~~~~~~~~~i~r~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~g~~~r~~i~v  225 (342)
T d2blla1         146 WIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGKQKRCFTDI  225 (342)
T ss_dssp             GHHHHHHHHHHHHHHHHHHHHCCCEEEEEECSEECSSCCCTTCSBSCBCHHHHHHHHHHHHTCCEEEGGGSCCEEECEEH
T ss_pred             chhhhcccchhhhhhhhhcccCceeEEeeccccccccccccccccccccccchHHHHHHHhCCCccccCCCCeeeeeccc
Confidence            6799999999999988753  89999999999998766554443333322 33455566666655677888999999999


Q ss_pred             HHHHHHHHHHHHHhccCCCCCcEEEeccCCCCCccHHHHHHHHhhhcccCC
Q 016854          117 DMVVNAMIVAMVAHAKQPSDANIYHVGSSLRNPVTLVSILDYGFVYFTKKP  167 (381)
Q Consensus       117 D~Vvnaii~aa~~~~~~~~~~~vYn~~s~~~npit~~~~~~~~~~~~~~~P  167 (381)
                      |.+|++++.++.+... ...+.+||++++ .+++|+.++.+.+.+.....+
T Consensus       226 ~D~~~a~~~~~~~~~~-~~~g~~~Nig~~-~~~~t~~~l~~~i~~~~~~~~  274 (342)
T d2blla1         226 RDGIEALYRIIENAGN-RCDGEIINIGNP-ENEASIEELGEMLLASFEKHP  274 (342)
T ss_dssp             HHHHHHHHHHHHCGGG-TTTTEEEEECCT-TSEEEHHHHHHHHHHHHHTCT
T ss_pred             ccccceeeeehhhccc-cCCCeEEEEecc-cchhHHHHHHHHHHHHhCCCc
Confidence            9999999999875432 225789999875 467899999998888766544
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure