Citrus Sinensis ID: 016862


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-
MMLGEAHRPNPTILVPPWPQLPDDPTADNIFSPHSLNSNANGSPEYSNLYHIPETYAALHRYLPSNDPDLDSDSDMSGLDPDSPVDAYSCDHFRMYEFKVRKCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDFRKGSCKKGDACEFAHGVFECWLHPARYRTQPCKDGGGCKRRVCFFAHTPDQLRILPQQSPRSASASDSPSCAKTLPFLSSPESASPPPSPRTESPMSHSLSRSLGTSSINEMMASFRNLQLGKVKSLPSSWNIQVGGVGGSPGYGSPRGSMLRPGFCSLPSTPTRTPTRPGIGYPDIFNTCWEEEEEEPVMERVESGRDLRAKMFERLSKENSLERVDPYPTNAVDPDLGWITELVNEAK
cccccccccccEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccCEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHcc
*******RPNPTILVPPWPQ***************************NLYHIPETYAALHRYL**********************DAYSCDHFRMYEFKVRKCARGRSHDWTECPYAHPGEK*RRRDPRKYHYSGTACPDFRKGSCKKGDACEFAHGVFECWLHPARYRTQPCKDGGGCKRRVCFFAHTPDQLR********************************************************************************Q*GGV********************************GIGYPDIFNTCWE******************************************DPDLGWITELVNE**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMLGEAHRPNPTILVPPWPQLPDDPTADNIFSPHSLNSNANGSPEYSNLYHIPETYAALHRYLPSNDPDLDSDSDMSGLDPDSPVDAYSCDHFRMYEFKVRKCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDFRKGSCKKGDACEFAHGVFECWLHPARYRTQPCKDGGGCKRRVCFFAHTPDQLRILPQQSPRSASASDSPSCAKTLPFLSSPESASPPPSPRTESPMSHSLSRSLGTSSINEMMASFRNLQLGKVKSLPSSWNIQVGGVGGSPGYGSPRGSMLRPGFCSLPSTPTRTPTRPGIGYPDIFNTCWEEEEEEPVMERVESGRDLRAKMFERLSKENSLERVDPYPTNAVDPDLGWITELVNEAK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger CCCH domain-containing protein 20 probableO82199
Zinc finger CCCH domain-containing protein 2 Involved in leaf senescence delay. May repress jasmonic acid (JA) signaling role in promoting leaf senescence. May regulate panicle development and pollination/fertilization process.probableQ9FU27

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M9O, chain A
Confidence level:confident
Coverage over the Query: 96-128
View the alignment between query and template
View the model in PyMOL
Template: 1M9O, chain A
Confidence level:confident
Coverage over the Query: 131-164
View the alignment between query and template
View the model in PyMOL