Citrus Sinensis ID: 016876

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-
MRFPSNAKVSDVTMNCNAETVRFPVEAGETILLRIINSAMNQEHFFGVANHKLTVVGVDTSYTKPFPTSVIMIAPGQTTNVLLTADQPPARYYMAAHAYNTANAAFDNTTTTAILEYKSAPFNGKKGKSRSSAPIFPILPGFNDTATATAFTARIKSLHQVQVPTVIDENLFFTVGLGLINCSNPNSPRCQGPNGTRFAASINNISFVFPRRNSLMQAYIQGQPGIFTTDFPPVPPIIFDYTGNVSRGLWQPRKRTKLYKLKFGSRVQIVFQDTSIVSVEDHPMHLHGHEFYVVGSGLGNFNPSTDTAKFNLIDPPRRNTIGTPPGGWVAVRFVAENPGIWLLHCHIDSHLTWGLAMAFLVENGVGKLQTVQPPPLDLPRC
ccccccccccccccccccccEEEEECcccEEEEEEEEEcccccEEEEEccEEEEEEEEcccccccEEEcEEEEcccccEEEEEECcccccccEEEEEEEcccccccccccEEEEEEEccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccEEEEEEccccccccccccccccccccEEEEEEccEEEEcccccHHHHHHHccccccccccccccccCEccccccccccccccccccEEEEEEcccEEEEEEEcccccccccccEEccccccEEEECcccccccccccccccccccccccEEEEccccEEEEEEEccccEEEEEHHHHHHHHHcccEEEEEEEccccccccccccccccccc
*RFPSNAKVSDVTMNCNAETVRFPVEAGETILLRIINSAMNQEHFFGVANHKLTVVGVDTSYTKPFPTSVIMIAPGQTTNVLLTADQPPARYYMAAHAYNTANAAFDNTTTTAILEYKSAPF************IFPILPGFNDTATATAFTARIKSLHQVQVPTVIDENLFFTVGLGLINCSNPNSPRCQGPNGTRFAASINNISFVFPRRNSLMQAYIQGQPGIFTTDFPPVPPIIFDYTGNVSRGLWQPRKRTKLYKLKFGSRVQIVFQDTSIVSVEDHPMHLHGHEFYVVGSGLGNFNPSTDTAKFNLIDPPRRNTIGTPPGGWVAVRFVAENPGIWLLHCHIDSHLTWGLAMAFLVENGVGKL*TVQPPPLDLPRC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRFPSNAKVSDVTMNCNAETVRFPVEAGETILLRIINSAMNQEHFFGVANHKLTVVGVDTSYTKPFPTSVIMIAPGQTTNVLLTADQPPARYYMAAHAYNTANAAFDNTTTTAILEYKSAPFNGKKGKSRSSAPIFPILPGFNDTATATAFTARIKSLHQVQVPTVIDENLFFTVGLGLINCSNPNSPRCQGPNGTRFAASINNISFVFPRRNSLMQAYIQGQPGIFTTDFPPVPPIIFDYTGNVSRGLWQPRKRTKLYKLKFGSRVQIVFQDTSIVSVEDHPMHLHGHEFYVVGSGLGNFNPSTDTAKFNLIDPPRRNTIGTPPGGWVAVRFVAENPGIWLLHCHIDSHLTWGLAMAFLVENGVGKLQTVQPPPLDLPRC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Laccase-3 Lignin degradation and detoxification of lignin-derived products.probableQ56YT0
Laccase-3 Lignin degradation and detoxification of lignin-derived products.probableQ941X2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.10.-.-Acting on diphenols and related substances as donors.probable
1.10.3.-With oxygen as acceptor.probable
1.10.3.2Laccase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J5W, chain A
Confidence level:very confident
Coverage over the Query: 7-122
View the alignment between query and template
View the model in PyMOL
Template: 3ZX1, chain A
Confidence level:very confident
Coverage over the Query: 12-123,134-138,154-210,256-362
View the alignment between query and template
View the model in PyMOL
Template: 1AOZ, chain A
Confidence level:very confident
Coverage over the Query: 21-180,194-381
View the alignment between query and template
View the model in PyMOL