Citrus Sinensis ID: 016876
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 381 | ||||||
| 224126903 | 576 | predicted protein [Populus trichocarpa] | 0.981 | 0.649 | 0.789 | 1e-175 | |
| 255550591 | 577 | laccase, putative [Ricinus communis] gi| | 0.981 | 0.648 | 0.795 | 1e-173 | |
| 224146663 | 576 | predicted protein [Populus trichocarpa] | 0.981 | 0.649 | 0.792 | 1e-173 | |
| 297826415 | 570 | hypothetical protein ARALYDRAFT_481932 [ | 0.981 | 0.656 | 0.732 | 1e-163 | |
| 15227721 | 570 | laccase 3 [Arabidopsis thaliana] gi|1433 | 0.981 | 0.656 | 0.726 | 1e-162 | |
| 297806735 | 569 | laccase-13 precursor [Arabidopsis lyrata | 0.992 | 0.664 | 0.731 | 1e-158 | |
| 186520894 | 569 | laccase 13 [Arabidopsis thaliana] gi|753 | 0.992 | 0.664 | 0.728 | 1e-157 | |
| 297745817 | 1561 | unnamed protein product [Vitis vinifera] | 0.973 | 0.237 | 0.689 | 1e-153 | |
| 357491147 | 560 | Laccase-like multicopper oxidase [Medica | 0.963 | 0.655 | 0.713 | 1e-153 | |
| 356569486 | 573 | PREDICTED: laccase-3-like [Glycine max] | 0.976 | 0.649 | 0.684 | 1e-151 |
| >gi|224126903|ref|XP_002319955.1| predicted protein [Populus trichocarpa] gi|222858331|gb|EEE95878.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 619 bits (1596), Expect = e-175, Method: Compositional matrix adjust.
Identities = 297/376 (78%), Positives = 327/376 (86%), Gaps = 2/376 (0%)
Query: 6 NAKVSDVTMNCNAETVRFPVEAGETILLRIINSAMNQEHFFGVANHKLTVVGVDTSYTKP 65
N + D+ ETVRFPV +GETILLR+INSA+NQE FFGVANH LTVV VD +YTKP
Sbjct: 203 NGQPGDLYRCSKQETVRFPVGSGETILLRVINSALNQELFFGVANHILTVVAVDAAYTKP 262
Query: 66 FPTSVIMIAPGQTTNVLLTADQPPARYYMAAHAYNTANAAFDNTTTTAILEYKSAPFNGK 125
F TSVIMIAPGQTT+VLLTADQ P YYMAA AYN+ANA FDNTTTTAILEYK+AP N K
Sbjct: 263 FTTSVIMIAPGQTTDVLLTADQTPGHYYMAARAYNSANAPFDNTTTTAILEYKTAPRNAK 322
Query: 126 KGKSRSSAPIFPILPGFNDTATATAFTARIKSLHQVQVPTVIDENLFFTVGLGLINCSNP 185
KGK S PIFP LPGFNDT +A AFT+R++S +V+VP IDENLFFTVGLGLINC+NP
Sbjct: 323 KGKQ--STPIFPRLPGFNDTNSAIAFTSRLRSPSKVKVPLQIDENLFFTVGLGLINCTNP 380
Query: 186 NSPRCQGPNGTRFAASINNISFVFPRRNSLMQAYIQGQPGIFTTDFPPVPPIIFDYTGNV 245
NSPRCQGPNGTRFAASINN+SFV P+RNSLMQAY QGQPGIFTTDFPPVPP+ FDYTGNV
Sbjct: 381 NSPRCQGPNGTRFAASINNMSFVLPKRNSLMQAYYQGQPGIFTTDFPPVPPVKFDYTGNV 440
Query: 246 SRGLWQPRKRTKLYKLKFGSRVQIVFQDTSIVSVEDHPMHLHGHEFYVVGSGLGNFNPST 305
SRGLWQP K TKLYKLKFG++VQIV QDTSIV+VEDHPMHLHG+ F V+GSG GNFNP T
Sbjct: 441 SRGLWQPVKSTKLYKLKFGAKVQIVLQDTSIVTVEDHPMHLHGYHFAVIGSGFGNFNPQT 500
Query: 306 DTAKFNLIDPPRRNTIGTPPGGWVAVRFVAENPGIWLLHCHIDSHLTWGLAMAFLVENGV 365
D A+FNLIDPP RNTIGTPPGGWVA+RF A+NPGIW +HCH+DSHL WGL MAFLVENGV
Sbjct: 501 DPARFNLIDPPYRNTIGTPPGGWVAIRFEADNPGIWFMHCHLDSHLNWGLGMAFLVENGV 560
Query: 366 GKLQTVQPPPLDLPRC 381
GKLQ+VQPPPLDLPRC
Sbjct: 561 GKLQSVQPPPLDLPRC 576
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255550591|ref|XP_002516345.1| laccase, putative [Ricinus communis] gi|223544511|gb|EEF46029.1| laccase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224146663|ref|XP_002326089.1| predicted protein [Populus trichocarpa] gi|222862964|gb|EEF00471.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297826415|ref|XP_002881090.1| hypothetical protein ARALYDRAFT_481932 [Arabidopsis lyrata subsp. lyrata] gi|297326929|gb|EFH57349.1| hypothetical protein ARALYDRAFT_481932 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15227721|ref|NP_180580.1| laccase 3 [Arabidopsis thaliana] gi|143344116|sp|Q56YT0.2|LAC3_ARATH RecName: Full=Laccase-3; AltName: Full=Benzenediol:oxygen oxidoreductase 3; AltName: Full=Diphenol oxidase 3; AltName: Full=Urishiol oxidase 3; Flags: Precursor gi|2347188|gb|AAC16927.1| putative laccase [Arabidopsis thaliana] gi|20197103|gb|AAM14916.1| putative laccase [Arabidopsis thaliana] gi|330253264|gb|AEC08358.1| laccase 3 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297806735|ref|XP_002871251.1| laccase-13 precursor [Arabidopsis lyrata subsp. lyrata] gi|297317088|gb|EFH47510.1| laccase-13 precursor [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|186520894|ref|NP_196330.3| laccase 13 [Arabidopsis thaliana] gi|75335658|sp|Q9LYQ2.1|LAC13_ARATH RecName: Full=Laccase-13; AltName: Full=Benzenediol:oxygen oxidoreductase 13; AltName: Full=Diphenol oxidase 13; AltName: Full=Urishiol oxidase 13; Flags: Precursor gi|7546691|emb|CAB87269.1| laccase-like protein [Arabidopsis thaliana] gi|332003730|gb|AED91113.1| laccase 13 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297745817|emb|CBI15873.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357491147|ref|XP_003615861.1| Laccase-like multicopper oxidase [Medicago truncatula] gi|355517196|gb|AES98819.1| Laccase-like multicopper oxidase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356569486|ref|XP_003552931.1| PREDICTED: laccase-3-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 381 | ||||||
| TAIR|locus:2060879 | 570 | LAC3 "laccase 3" [Arabidopsis | 0.981 | 0.656 | 0.655 | 2.8e-137 | |
| TAIR|locus:2182895 | 569 | LAC13 "laccase 13" [Arabidopsi | 0.992 | 0.664 | 0.652 | 3.2e-136 | |
| TAIR|locus:2063109 | 580 | LAC5 "laccase 5" [Arabidopsis | 0.986 | 0.648 | 0.567 | 4.2e-118 | |
| TAIR|locus:2153469 | 565 | LAC12 "laccase 12" [Arabidopsi | 0.960 | 0.647 | 0.572 | 1e-116 | |
| TAIR|locus:2168128 | 577 | LAC17 "laccase 17" [Arabidopsi | 0.955 | 0.630 | 0.447 | 1.3e-84 | |
| TAIR|locus:2066117 | 573 | LAC2 "laccase 2" [Arabidopsis | 0.942 | 0.626 | 0.446 | 7.3e-84 | |
| TAIR|locus:2042842 | 558 | IRX12 "IRREGULAR XYLEM 12" [Ar | 0.923 | 0.630 | 0.447 | 9.1e-84 | |
| TAIR|locus:2143563 | 557 | LAC11 "laccase 11" [Arabidopsi | 0.918 | 0.628 | 0.447 | 1.2e-83 | |
| TAIR|locus:2154518 | 566 | LAC16 "laccase 16" [Arabidopsi | 0.929 | 0.625 | 0.437 | 9.4e-82 | |
| TAIR|locus:2150139 | 558 | LAC10 "laccase 10" [Arabidopsi | 0.926 | 0.632 | 0.430 | 2e-79 |
| TAIR|locus:2060879 LAC3 "laccase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1344 (478.2 bits), Expect = 2.8e-137, P = 2.8e-137
Identities = 247/377 (65%), Positives = 286/377 (75%)
Query: 6 NAKVSDVTMNCNAETVRFPVEAGETILLRIINSAMNQEHFFGVANHKLTVVGVDTSYTKP 65
N + D+ A T+RFP+ GET+ LR+IN+ MNQE FF VANH+ TVV D++YTKP
Sbjct: 196 NGQPGDLYRCSRAGTIRFPIFPGETVQLRVINAGMNQELFFSVANHQFTVVETDSAYTKP 255
Query: 66 FPTSVIMIAPGQTTNVLLTADQPPARXXXXXXXXXXXXXXXXXXXXXXILEYKSAPFNGK 125
F T+VIMI PGQTTNVLLTA+Q P R IL+Y +AP +
Sbjct: 256 FTTNVIMIGPGQTTNVLLTANQRPGRYYMAARAYNSANAPFDNTTTTAILQYVNAPT--R 313
Query: 126 KGKSRSS-APIFPILPGFNDXXXXXXXXXRIKSLHQVQVPTVIDENLFFTVGLGLINCSN 184
+G+ R AP+FP+LPGFND R++ + VP +DENLFFTVGLGLINC+N
Sbjct: 314 RGRGRGQIAPVFPVLPGFNDTATATAFTNRLRYWKRAPVPQQVDENLFFTVGLGLINCAN 373
Query: 185 PNSPRCQGPNGTRFAASINNISFVFPRRNSLMQAYIQGQPGIFTTDFPPVPPIIFDYTGN 244
PNSPRCQGPNGTRFAAS+NN+SFV PR NS+MQAY QG PGIFTTDFPPVPP+ FDYTGN
Sbjct: 374 PNSPRCQGPNGTRFAASMNNMSFVLPRSNSVMQAYYQGTPGIFTTDFPPVPPVQFDYTGN 433
Query: 245 VSRGLWQPRKRTKLYKLKFGSRVQIVFQDTSIVSVEDHPMHLHGHEFYVVGSGLGNFNPS 304
VSRGLWQP K TK YKLK+ S VQIV QDTSIV+ E+HPMHLHG++FYVVGSG GNFNP
Sbjct: 434 VSRGLWQPIKGTKAYKLKYKSNVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFNPR 493
Query: 305 TDTAKFNLIDPPRRNTIGTPPGGWVAVRFVAENPGIWLLHCHIDSHLTWGLAMAFLVENG 364
TD A+FNL DPP RNTIGTPPGGWVA+RFVA+NPG W +HCHIDSHL WGLAM FLVENG
Sbjct: 494 TDPARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVENG 553
Query: 365 VGKLQTVQPPPLDLPRC 381
G+LQ+VQ PPLDLPRC
Sbjct: 554 RGQLQSVQAPPLDLPRC 570
|
|
| TAIR|locus:2182895 LAC13 "laccase 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2063109 LAC5 "laccase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153469 LAC12 "laccase 12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2168128 LAC17 "laccase 17" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2066117 LAC2 "laccase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2042842 IRX12 "IRREGULAR XYLEM 12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2143563 LAC11 "laccase 11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2154518 LAC16 "laccase 16" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2150139 LAC10 "laccase 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 381 | |||
| TIGR03389 | 539 | TIGR03389, laccase, laccase, plant | 1e-176 | |
| TIGR03388 | 541 | TIGR03388, ascorbase, L-ascorbate oxidase, plant t | 4e-55 | |
| PLN02604 | 566 | PLN02604, PLN02604, oxidoreductase | 2e-45 | |
| pfam07731 | 135 | pfam07731, Cu-oxidase_2, Multicopper oxidase | 3e-45 | |
| PLN02191 | 574 | PLN02191, PLN02191, L-ascorbate oxidase | 4e-40 | |
| pfam00394 | 146 | pfam00394, Cu-oxidase, Multicopper oxidase | 4e-33 | |
| TIGR03390 | 538 | TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fu | 9e-28 | |
| PLN00044 | 596 | PLN00044, PLN00044, multi-copper oxidase-related p | 1e-18 | |
| PLN02991 | 543 | PLN02991, PLN02991, oxidoreductase | 8e-15 | |
| PLN02168 | 545 | PLN02168, PLN02168, copper ion binding / pectinest | 2e-14 | |
| PLN02354 | 552 | PLN02354, PLN02354, copper ion binding / oxidoredu | 4e-13 | |
| PLN02835 | 539 | PLN02835, PLN02835, oxidoreductase | 7e-13 | |
| TIGR01480 | 587 | TIGR01480, copper_res_A, copper-resistance protein | 1e-12 | |
| COG2132 | 451 | COG2132, SufI, Putative multicopper oxidases [Seco | 1e-11 | |
| PLN02792 | 536 | PLN02792, PLN02792, oxidoreductase | 0.002 | |
| TIGR01480 | 587 | TIGR01480, copper_res_A, copper-resistance protein | 0.003 | |
| PLN02792 | 536 | PLN02792, PLN02792, oxidoreductase | 0.003 |
| >gnl|CDD|234194 TIGR03389, laccase, laccase, plant | Back alignment and domain information |
|---|
Score = 501 bits (1291), Expect = e-176
Identities = 216/373 (57%), Positives = 267/373 (71%), Gaps = 19/373 (5%)
Query: 15 NCNA-ETVRFPVEAGETILLRIINSAMNQEHFFGVANHKLTVVGVDTSYTKPFPTSVIMI 73
NC++ +T + VE G+T LLRIIN+A+N E FF +ANH LTVV VD +YTKPF T I+I
Sbjct: 180 NCSSKDTFKLTVEPGKTYLLRIINAALNDELFFAIANHTLTVVEVDATYTKPFKTKTIVI 239
Query: 74 APGQTTNVLLTADQPPARYYMAAHAYNTANAAFDNTTTTAILEYKSAPFNGKKGKSRSSA 133
PGQTTNVLLTADQ P RY+MAA Y A AFDNTTTTAIL+YK G S S+
Sbjct: 240 GPGQTTNVLLTADQSPGRYFMAARPYMDAPGAFDNTTTTAILQYK--------GTSNSAK 291
Query: 134 PIFPILPGFNDTATATAFTARIKSLHQ----VQVPTVIDENLFFTVGLGLINCSNPNSPR 189
PI P LP +NDTA AT F+ +++SL+ VP ID LFFT+GLGL C +
Sbjct: 292 PILPTLPAYNDTAAATNFSNKLRSLNSAQYPANVPVTIDRRLFFTIGLGLDPCP---NNT 348
Query: 190 CQGPNGTRFAASINNISFVFPRRNSLMQAYIQGQPGIFTTDFPPVPPIIFDYTG-NVSRG 248
CQGPNGTRFAAS+NNISFV P +L+QA+ G G+FTTDFP PP F+YTG N+
Sbjct: 349 CQGPNGTRFAASMNNISFVMPT-TALLQAHYFGISGVFTTDFPANPPTKFNYTGTNLPNN 407
Query: 249 LWQPRKRTKLYKLKFGSRVQIVFQDTSIVSVEDHPMHLHGHEFYVVGSGLGNFNPSTDTA 308
L+ TK+ +LKF S V++V QDTSI+ E+HP+HLHG+ F+VVG+G GNF+P D A
Sbjct: 408 LFTTNG-TKVVRLKFNSTVELVLQDTSILGSENHPIHLHGYNFFVVGTGFGNFDPKKDPA 466
Query: 309 KFNLIDPPRRNTIGTPPGGWVAVRFVAENPGIWLLHCHIDSHLTWGLAMAFLVENGVGKL 368
KFNL+DPP RNT+G P GGW A+RFVA+NPG+W +HCH++ H TWGL MAFLV+NG G
Sbjct: 467 KFNLVDPPERNTVGVPTGGWAAIRFVADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPN 526
Query: 369 QTVQPPPLDLPRC 381
Q++ PPP DLP C
Sbjct: 527 QSLLPPPSDLPSC 539
|
Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate. Length = 539 |
| >gnl|CDD|234193 TIGR03388, ascorbase, L-ascorbate oxidase, plant type | Back alignment and domain information |
|---|
| >gnl|CDD|215324 PLN02604, PLN02604, oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|219541 pfam07731, Cu-oxidase_2, Multicopper oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|177843 PLN02191, PLN02191, L-ascorbate oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215896 pfam00394, Cu-oxidase, Multicopper oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|132431 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fungal type | Back alignment and domain information |
|---|
| >gnl|CDD|165622 PLN00044, PLN00044, multi-copper oxidase-related protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215536 PLN02991, PLN02991, oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|215113 PLN02168, PLN02168, copper ion binding / pectinesterase | Back alignment and domain information |
|---|
| >gnl|CDD|177987 PLN02354, PLN02354, copper ion binding / oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|178429 PLN02835, PLN02835, oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|233432 TIGR01480, copper_res_A, copper-resistance protein, CopA family | Back alignment and domain information |
|---|
| >gnl|CDD|225043 COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|178389 PLN02792, PLN02792, oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|233432 TIGR01480, copper_res_A, copper-resistance protein, CopA family | Back alignment and domain information |
|---|
| >gnl|CDD|178389 PLN02792, PLN02792, oxidoreductase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 381 | |||
| TIGR03389 | 539 | laccase laccase, plant. Members of this protein fa | 100.0 | |
| PLN00044 | 596 | multi-copper oxidase-related protein; Provisional | 100.0 | |
| PLN02792 | 536 | oxidoreductase | 100.0 | |
| PLN02991 | 543 | oxidoreductase | 100.0 | |
| KOG1263 | 563 | consensus Multicopper oxidases [Secondary metaboli | 100.0 | |
| PLN02354 | 552 | copper ion binding / oxidoreductase | 100.0 | |
| PLN02835 | 539 | oxidoreductase | 100.0 | |
| PLN02604 | 566 | oxidoreductase | 100.0 | |
| PLN02191 | 574 | L-ascorbate oxidase | 100.0 | |
| TIGR03388 | 541 | ascorbase L-ascorbate oxidase, plant type. Members | 100.0 | |
| PLN02168 | 545 | copper ion binding / pectinesterase | 100.0 | |
| TIGR03390 | 538 | ascorbOXfungal L-ascorbate oxidase, fungal type. T | 100.0 | |
| TIGR01480 | 587 | copper_res_A copper-resistance protein, CopA famil | 100.0 | |
| PRK10965 | 523 | multicopper oxidase; Provisional | 100.0 | |
| PRK10883 | 471 | FtsI repressor; Provisional | 100.0 | |
| COG2132 | 451 | SufI Putative multicopper oxidases [Secondary meta | 100.0 | |
| PF07731 | 138 | Cu-oxidase_2: Multicopper oxidase; InterPro: IPR01 | 99.96 | |
| PF00394 | 159 | Cu-oxidase: Multicopper oxidase; InterPro: IPR0011 | 99.93 | |
| TIGR02376 | 311 | Cu_nitrite_red nitrite reductase, copper-containin | 99.59 | |
| TIGR02376 | 311 | Cu_nitrite_red nitrite reductase, copper-containin | 99.55 | |
| PLN02604 | 566 | oxidoreductase | 99.13 | |
| PF07732 | 117 | Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 | 98.95 | |
| TIGR03388 | 541 | ascorbase L-ascorbate oxidase, plant type. Members | 98.69 | |
| TIGR03389 | 539 | laccase laccase, plant. Members of this protein fa | 98.6 | |
| PRK10883 | 471 | FtsI repressor; Provisional | 98.53 | |
| PLN02835 | 539 | oxidoreductase | 98.49 | |
| PF00394 | 159 | Cu-oxidase: Multicopper oxidase; InterPro: IPR0011 | 98.48 | |
| TIGR03095 | 148 | rusti_cyanin rusticyanin. Rusticyanin is a blue co | 98.42 | |
| PLN02354 | 552 | copper ion binding / oxidoreductase | 98.38 | |
| PLN02191 | 574 | L-ascorbate oxidase | 98.34 | |
| TIGR01480 | 587 | copper_res_A copper-resistance protein, CopA famil | 98.22 | |
| TIGR03390 | 538 | ascorbOXfungal L-ascorbate oxidase, fungal type. T | 98.12 | |
| PF07731 | 138 | Cu-oxidase_2: Multicopper oxidase; InterPro: IPR01 | 98.01 | |
| PLN02168 | 545 | copper ion binding / pectinesterase | 98.01 | |
| TIGR02656 | 99 | cyanin_plasto plastocyanin. Members of this family | 97.98 | |
| PRK10965 | 523 | multicopper oxidase; Provisional | 97.93 | |
| PLN02792 | 536 | oxidoreductase | 97.92 | |
| PLN00044 | 596 | multi-copper oxidase-related protein; Provisional | 97.87 | |
| PF00127 | 99 | Copper-bind: Copper binding proteins, plastocyanin | 97.71 | |
| PLN02991 | 543 | oxidoreductase | 97.7 | |
| KOG1263 | 563 | consensus Multicopper oxidases [Secondary metaboli | 97.65 | |
| TIGR03096 | 135 | nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de | 97.44 | |
| PRK02888 | 635 | nitrous-oxide reductase; Validated | 97.29 | |
| PF13473 | 104 | Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D | 97.06 | |
| PRK02710 | 119 | plastocyanin; Provisional | 97.01 | |
| COG4454 | 158 | Uncharacterized copper-binding protein [Inorganic | 96.72 | |
| COG2132 | 451 | SufI Putative multicopper oxidases [Secondary meta | 96.5 | |
| TIGR02375 | 116 | pseudoazurin pseudoazurin. Pseudoazurin, also call | 95.93 | |
| TIGR02657 | 83 | amicyanin amicyanin. Members of this family are am | 95.39 | |
| TIGR03096 | 135 | nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de | 95.38 | |
| TIGR03102 | 115 | halo_cynanin halocyanin domain. Halocyanins are bl | 95.12 | |
| PF13473 | 104 | Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D | 95.12 | |
| PF06525 | 196 | SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb | 95.05 | |
| PF07732 | 117 | Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 | 94.6 | |
| PF00116 | 120 | COX2: Cytochrome C oxidase subunit II, periplasmic | 94.14 | |
| TIGR02866 | 201 | CoxB cytochrome c oxidase, subunit II. Cytochrome | 93.18 | |
| TIGR03095 | 148 | rusti_cyanin rusticyanin. Rusticyanin is a blue co | 92.89 | |
| PF06525 | 196 | SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb | 92.82 | |
| COG3794 | 128 | PetE Plastocyanin [Energy production and conversio | 92.55 | |
| TIGR03094 | 195 | sulfo_cyanin sulfocyanin. Members of this family a | 92.29 | |
| TIGR02656 | 99 | cyanin_plasto plastocyanin. Members of this family | 86.98 | |
| COG4454 | 158 | Uncharacterized copper-binding protein [Inorganic | 86.02 | |
| PF14344 | 122 | DUF4397: Domain of unknown function (DUF4397) | 84.86 | |
| COG1622 | 247 | CyoA Heme/copper-type cytochrome/quinol oxidases, | 83.59 | |
| PF11142 | 63 | DUF2917: Protein of unknown function (DUF2917); In | 81.33 |
| >TIGR03389 laccase laccase, plant | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-66 Score=527.54 Aligned_cols=364 Identities=58% Similarity=1.046 Sum_probs=275.1
Q ss_pred CCcccCCcc---cCCCC-CCeeEEeeCCCEEEEEEEecCCCceeEEEEcCeeEEEEeeCCCccCceEeeEEEeccCcEEE
Q 016876 5 SNAKVSDVT---MNCNA-ETVRFPVEAGETILLRIINSAMNQEHFFGVANHKLTVVGVDTSYTKPFPTSVIMIAPGQTTN 80 (381)
Q Consensus 5 ~~~~~~~~~---~~~~~-~~~~~~v~~Gk~yRlRlINa~~~~~~~~~idgh~m~VIa~DG~~v~P~~v~~l~l~~GeRyd 80 (381)
.+..+||.. ++|+. ...+|+|++||+|||||||+|+.+.+.|+||||+|+|||+||.+++|++++.|.|++|||||
T Consensus 167 d~~liNG~~~~~~~~~~~~~~~i~v~~G~~~RlRlINa~~~~~~~~~idgH~~~VIa~DG~~~~P~~~~~l~i~~GqRyd 246 (539)
T TIGR03389 167 DAYTINGHPGPLYNCSSKDTFKLTVEPGKTYLLRIINAALNDELFFAIANHTLTVVEVDATYTKPFKTKTIVIGPGQTTN 246 (539)
T ss_pred ceEEECCCcCCCCCCCCCCceEEEECCCCEEEEEEEeccCCceEEEEECCCeEEEEEeCCcccCceEeCeEEecCCCEEE
Confidence 455666653 45665 66899999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEEeCCCCccceeeeeeccccccCCCCCceEEEEEecCCCCCCCCCCCCCCCCCCCCCCCCCCcccchhccccccccC-
Q 016876 81 VLLTADQPPARYYMAAHAYNTANAAFDNTTTTAILEYKSAPFNGKKGKSRSSAPIFPILPGFNDTATATAFTARIKSLH- 159 (381)
Q Consensus 81 VlV~~~~~~g~y~lr~~~~~~~~~~~~~~~~~ail~y~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~l~~l~- 159 (381)
|+|++++.+|+||||+.....|.....+....|||+|.++.... .+..+..+..++......+...++.+.
T Consensus 247 Vlv~a~~~~g~y~i~~~~~~~~~~~~~~~~~~ail~Y~~~~~~~--------~p~~~~~~~~~~~~~~~~~~~~l~~~~~ 318 (539)
T TIGR03389 247 VLLTADQSPGRYFMAARPYMDAPGAFDNTTTTAILQYKGTSNSA--------KPILPTLPAYNDTAAATNFSNKLRSLNS 318 (539)
T ss_pred EEEECCCCCceEEEEEeccccCccCCCCcceEEEEEECCCCCCC--------CCCCCCCCCCCchhhhhHHHhhcccccc
Confidence 99999988899999998765443223346689999998865411 111122222222221111112333332
Q ss_pred ---CCCCCcccceeEEEEeceeeeecCCCCCCCccCCCCCeEEEEecceeeecCCchhhHHHHHhCCCCcccCCCCCCCC
Q 016876 160 ---QVQVPTVIDENLFFTVGLGLINCSNPNSPRCQGPNGTRFAASINNISFVFPRRNSLMQAYIQGQPGIFTTDFPPVPP 236 (381)
Q Consensus 160 ---~~~~p~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~iN~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~p 236 (381)
+..+|..++.++.+.+++...... .......++..+.|+|||++|..|.+ |+|++.+..+++.+..+++..+|
T Consensus 319 ~~~~~~~p~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~w~in~~s~~~p~~-p~l~~~~~~~~~~~~~~~~~~~p 394 (539)
T TIGR03389 319 AQYPANVPVTIDRRLFFTIGLGLDPCP---NNTCQGPNGTRFAASMNNISFVMPTT-ALLQAHYFGISGVFTTDFPANPP 394 (539)
T ss_pred cCCCCCCCCCCCeEEEEEeecccccCc---ccccccCCCcEEEEEECCcccCCCCc-chhhhhhcccCCccccCCccCCC
Confidence 223344567776666554321100 00011123556889999999988877 56677666566666667788888
Q ss_pred cccCCCCCC-CCCcccCCCccceEEeecCCEEEEEEeecCCcCCCCCceeecCccEEEEEcCCCCCCCCCCCCccCCCCC
Q 016876 237 IIFDYTGNV-SRGLWQPRKRTKLYKLKFGSRVQIVFQDTSIVSVEDHPMHLHGHEFYVVGSGLGNFNPSTDTAKFNLIDP 315 (381)
Q Consensus 237 ~~~~~~~~~-~~~~~~~~~~~~~~~~~~g~~v~~~i~n~~~~~~~~Hp~HlHG~~f~v~~~~~g~~~~~~~~~~~n~~~p 315 (381)
+.|++++.. +..+. ...+++++.++.|++|+|+|.|.+.+....||||||||+|+|+++|.|.|+..+....+|+.||
T Consensus 395 ~~~~~~~~~~~~~~~-~~~~~~v~~~~~~~~V~ivi~n~~~~~~~~HP~HLHGh~F~Vlg~g~g~~~~~~~~~~~nl~nP 473 (539)
T TIGR03389 395 TKFNYTGTNLPNNLF-TTNGTKVVRLKFNSTVELVLQDTSILGSENHPIHLHGYNFFVVGTGFGNFDPKKDPAKFNLVDP 473 (539)
T ss_pred ccccCCCCCcccccc-cccCceEEEecCCCEEEEEEecCCcCCCCCCcEeEcCCceEEEEeccCCCCcccCccccccCCC
Confidence 888765531 21221 1336778999999999999999643335589999999999999999999987655557899999
Q ss_pred CccceEEeCCCcEEEEEEEeCCceeEEEEecchhhHhccceEEEEEecCCCcCCCCCCCCCCCCCC
Q 016876 316 PRRNTIGTPPGGWVAVRFVAENPGIWLLHCHIDSHLTWGLAMAFLVENGVGKLQTVQPPPLDLPRC 381 (381)
Q Consensus 316 ~~rDtv~v~~~~~~~i~f~~~~pG~w~~HCHi~~H~~~Gm~~~~~v~~~~~~~~~~~~~p~~~~~c 381 (381)
++|||+.|++++|++|||++||||.|+|||||+||++.||+++|.+..+++..++++++|..+|+|
T Consensus 474 ~rRDTv~vp~~g~vvirf~adNPG~W~~HCHi~~H~~~Gm~~~~~~~~~~~~~~~~~~~p~~~~~c 539 (539)
T TIGR03389 474 PERNTVGVPTGGWAAIRFVADNPGVWFMHCHLEVHTTWGLKMAFLVDNGKGPNQSLLPPPSDLPSC 539 (539)
T ss_pred CeeeeEEcCCCceEEEEEecCCCeEEEEEecccchhhhcceEEEEEccCCCCccccCCCCccCCCC
Confidence 999999999999999999999999999999999999999999999988877788899999999999
|
Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate. |
| >PLN00044 multi-copper oxidase-related protein; Provisional | Back alignment and domain information |
|---|
| >PLN02792 oxidoreductase | Back alignment and domain information |
|---|
| >PLN02991 oxidoreductase | Back alignment and domain information |
|---|
| >KOG1263 consensus Multicopper oxidases [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02354 copper ion binding / oxidoreductase | Back alignment and domain information |
|---|
| >PLN02835 oxidoreductase | Back alignment and domain information |
|---|
| >PLN02604 oxidoreductase | Back alignment and domain information |
|---|
| >PLN02191 L-ascorbate oxidase | Back alignment and domain information |
|---|
| >TIGR03388 ascorbase L-ascorbate oxidase, plant type | Back alignment and domain information |
|---|
| >PLN02168 copper ion binding / pectinesterase | Back alignment and domain information |
|---|
| >TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type | Back alignment and domain information |
|---|
| >TIGR01480 copper_res_A copper-resistance protein, CopA family | Back alignment and domain information |
|---|
| >PRK10965 multicopper oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK10883 FtsI repressor; Provisional | Back alignment and domain information |
|---|
| >COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF07731 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties | Back alignment and domain information |
|---|
| >PF00394 Cu-oxidase: Multicopper oxidase; InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties | Back alignment and domain information |
|---|
| >TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing | Back alignment and domain information |
|---|
| >TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing | Back alignment and domain information |
|---|
| >PLN02604 oxidoreductase | Back alignment and domain information |
|---|
| >PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties | Back alignment and domain information |
|---|
| >TIGR03388 ascorbase L-ascorbate oxidase, plant type | Back alignment and domain information |
|---|
| >TIGR03389 laccase laccase, plant | Back alignment and domain information |
|---|
| >PRK10883 FtsI repressor; Provisional | Back alignment and domain information |
|---|
| >PLN02835 oxidoreductase | Back alignment and domain information |
|---|
| >PF00394 Cu-oxidase: Multicopper oxidase; InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties | Back alignment and domain information |
|---|
| >TIGR03095 rusti_cyanin rusticyanin | Back alignment and domain information |
|---|
| >PLN02354 copper ion binding / oxidoreductase | Back alignment and domain information |
|---|
| >PLN02191 L-ascorbate oxidase | Back alignment and domain information |
|---|
| >TIGR01480 copper_res_A copper-resistance protein, CopA family | Back alignment and domain information |
|---|
| >TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type | Back alignment and domain information |
|---|
| >PF07731 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties | Back alignment and domain information |
|---|
| >PLN02168 copper ion binding / pectinesterase | Back alignment and domain information |
|---|
| >TIGR02656 cyanin_plasto plastocyanin | Back alignment and domain information |
|---|
| >PRK10965 multicopper oxidase; Provisional | Back alignment and domain information |
|---|
| >PLN02792 oxidoreductase | Back alignment and domain information |
|---|
| >PLN00044 multi-copper oxidase-related protein; Provisional | Back alignment and domain information |
|---|
| >PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] | Back alignment and domain information |
|---|
| >PLN02991 oxidoreductase | Back alignment and domain information |
|---|
| >KOG1263 consensus Multicopper oxidases [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR03096 nitroso_cyanin nitrosocyanin | Back alignment and domain information |
|---|
| >PRK02888 nitrous-oxide reductase; Validated | Back alignment and domain information |
|---|
| >PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D | Back alignment and domain information |
|---|
| >PRK02710 plastocyanin; Provisional | Back alignment and domain information |
|---|
| >COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR02375 pseudoazurin pseudoazurin | Back alignment and domain information |
|---|
| >TIGR02657 amicyanin amicyanin | Back alignment and domain information |
|---|
| >TIGR03096 nitroso_cyanin nitrosocyanin | Back alignment and domain information |
|---|
| >TIGR03102 halo_cynanin halocyanin domain | Back alignment and domain information |
|---|
| >PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D | Back alignment and domain information |
|---|
| >PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus | Back alignment and domain information |
|---|
| >PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties | Back alignment and domain information |
|---|
| >PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o | Back alignment and domain information |
|---|
| >TIGR02866 CoxB cytochrome c oxidase, subunit II | Back alignment and domain information |
|---|
| >TIGR03095 rusti_cyanin rusticyanin | Back alignment and domain information |
|---|
| >PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus | Back alignment and domain information |
|---|
| >COG3794 PetE Plastocyanin [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03094 sulfo_cyanin sulfocyanin | Back alignment and domain information |
|---|
| >TIGR02656 cyanin_plasto plastocyanin | Back alignment and domain information |
|---|
| >COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF14344 DUF4397: Domain of unknown function (DUF4397) | Back alignment and domain information |
|---|
| >COG1622 CyoA Heme/copper-type cytochrome/quinol oxidases, subunit 2 [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF11142 DUF2917: Protein of unknown function (DUF2917); InterPro: IPR021317 This bacterial family of proteins appears to be restricted to Proteobacteria | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 381 | ||||
| 1aoz_A | 552 | Refined Crystal Structure Of Ascorbate Oxidase At 1 | 2e-30 | ||
| 3sqr_A | 580 | Crystal Structure Of Laccase From Botrytis Aclada A | 1e-19 | ||
| 3v9e_A | 580 | Structure Of The L513m Mutant Of The Laccase From B | 2e-19 | ||
| 3dkh_A | 559 | L559a Mutant Of Melanocarpus Albomyces Laccase Leng | 3e-17 | ||
| 2q9o_A | 559 | Near-Atomic Resolution Structure Of A Melanocarpus | 3e-17 | ||
| 1gw0_A | 559 | Crystal Structure Of Laccase From Melanocarpus Albo | 3e-17 | ||
| 1v10_A | 521 | Structure Of Rigidoporus Lignosus Laccase From Hemi | 1e-15 | ||
| 3kw7_A | 502 | Crystal Structure Of Lacb From Trametes Sp. Ah28-2 | 5e-15 | ||
| 3pps_A | 604 | Crystal Structure Of An Ascomycete Fungal Laccase F | 8e-15 | ||
| 2hzh_A | 499 | Crystal Structure Of Laccase From Coriolus Zonatus | 1e-13 | ||
| 1gyc_A | 499 | Crystal Structure Determination At Room Temperature | 1e-13 | ||
| 2qt6_A | 498 | Crystal Structure Determination Of A Blue Laccase F | 2e-13 | ||
| 4a2f_A | 497 | Coriolopsis Gallica Laccase Collected At 12.65 Kev | 3e-12 | ||
| 4a2d_A | 496 | Coriolopsis Gallica Laccase T2 Copper Depleted At P | 3e-12 | ||
| 2hrg_A | 496 | Crystal Structure Of Blue Laccase From Trametes Tro | 4e-12 | ||
| 1hfu_A | 503 | Type-2 Cu-Depleted Laccase From Coprinus Cinereus A | 1e-11 | ||
| 1a65_A | 504 | Type-2 Cu-depleted Laccase From Coprinus Cinereus L | 1e-11 | ||
| 2xyb_A | 497 | Crystal Structure Of A Fully Functional Laccase Fro | 1e-11 | ||
| 1kya_A | 499 | Active Laccase From Trametes Versicolor Complexed W | 2e-10 | ||
| 3t6v_A | 495 | Crystal Structure Of Laccase From Steccherinum Ochr | 4e-10 | ||
| 3fpx_A | 499 | Native Fungus Laccase From Trametes Hirsuta Length | 2e-09 | ||
| 3pxl_A | 499 | Type-2 Cu-Depleted Fungus Laccase From Trametes Hir | 2e-09 | ||
| 3div_A | 499 | Crystal Structure Of Laccase From Cerrena Maxima At | 4e-09 | ||
| 2h5u_A | 499 | Crystal Structure Of Laccase From Cerrena Maxima At | 5e-09 | ||
| 1zpu_A | 534 | Crystal Structure Of Fet3p, A Multicopper Oxidase T | 2e-08 | ||
| 3zx1_A | 481 | Multicopper Oxidase From Campylobacter Jejuni: A Me | 2e-06 | ||
| 1kcw_A | 1046 | X-Ray Crystal Structure Of Human Ceruloplasmin At 3 | 1e-04 | ||
| 2j5w_A | 1065 | Ceruloplasmin Revisited: Structural And Functional | 2e-04 | ||
| 3t9w_A | 299 | Small Laccase From Amycolatopsis Sp. Atcc 39116 Len | 3e-04 |
| >pdb|1AOZ|A Chain A, Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution Length = 552 | Back alignment and structure |
|
| >pdb|3SQR|A Chain A, Crystal Structure Of Laccase From Botrytis Aclada At 1.67 A Resolution Length = 580 | Back alignment and structure |
| >pdb|3V9E|A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada Length = 580 | Back alignment and structure |
| >pdb|3DKH|A Chain A, L559a Mutant Of Melanocarpus Albomyces Laccase Length = 559 | Back alignment and structure |
| >pdb|2Q9O|A Chain A, Near-Atomic Resolution Structure Of A Melanocarpus Albomyces Laccase Length = 559 | Back alignment and structure |
| >pdb|1GW0|A Chain A, Crystal Structure Of Laccase From Melanocarpus Albomyces In Four Copper Form Length = 559 | Back alignment and structure |
| >pdb|1V10|A Chain A, Structure Of Rigidoporus Lignosus Laccase From Hemihedrally Twinned Crystals Length = 521 | Back alignment and structure |
| >pdb|3KW7|A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2 Length = 502 | Back alignment and structure |
| >pdb|3PPS|A Chain A, Crystal Structure Of An Ascomycete Fungal Laccase From Thielavia Arenaria Length = 604 | Back alignment and structure |
| >pdb|2HZH|A Chain A, Crystal Structure Of Laccase From Coriolus Zonatus At 2.6 A Resolution Length = 499 | Back alignment and structure |
| >pdb|1GYC|A Chain A, Crystal Structure Determination At Room Temperature Of A Laccase From Trametes Versicolor In Its Oxidised Form Containing A Full Complement Of Copper Ions Length = 499 | Back alignment and structure |
| >pdb|2QT6|A Chain A, Crystal Structure Determination Of A Blue Laccase From Lentinus Tigrinus Length = 498 | Back alignment and structure |
| >pdb|4A2F|A Chain A, Coriolopsis Gallica Laccase Collected At 12.65 Kev Length = 497 | Back alignment and structure |
| >pdb|4A2D|A Chain A, Coriolopsis Gallica Laccase T2 Copper Depleted At Ph 4.5 Length = 496 | Back alignment and structure |
| >pdb|2HRG|A Chain A, Crystal Structure Of Blue Laccase From Trametes Trogii Complexed With P-Methylbenzoate Length = 496 | Back alignment and structure |
| >pdb|1HFU|A Chain A, Type-2 Cu-Depleted Laccase From Coprinus Cinereus At 1.68 A Resolution Length = 503 | Back alignment and structure |
| >pdb|1A65|A Chain A, Type-2 Cu-depleted Laccase From Coprinus Cinereus Length = 504 | Back alignment and structure |
| >pdb|2XYB|A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus Length = 497 | Back alignment and structure |
| >pdb|1KYA|A Chain A, Active Laccase From Trametes Versicolor Complexed With 2,5-Xylidine Length = 499 | Back alignment and structure |
| >pdb|3T6V|A Chain A, Crystal Structure Of Laccase From Steccherinum Ochraceum Length = 495 | Back alignment and structure |
| >pdb|3FPX|A Chain A, Native Fungus Laccase From Trametes Hirsuta Length = 499 | Back alignment and structure |
| >pdb|3PXL|A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta Length = 499 | Back alignment and structure |
| >pdb|3DIV|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.76a Resolution Length = 499 | Back alignment and structure |
| >pdb|2H5U|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.9a Resolution Length = 499 | Back alignment and structure |
| >pdb|1ZPU|A Chain A, Crystal Structure Of Fet3p, A Multicopper Oxidase That Functions In Iron Import Length = 534 | Back alignment and structure |
| >pdb|3ZX1|A Chain A, Multicopper Oxidase From Campylobacter Jejuni: A Metallo-Oxidase Length = 481 | Back alignment and structure |
| >pdb|1KCW|A Chain A, X-Ray Crystal Structure Of Human Ceruloplasmin At 3.0 Angstroms Length = 1046 | Back alignment and structure |
| >pdb|2J5W|A Chain A, Ceruloplasmin Revisited: Structural And Functional Roles Of Various Metal Cation Binding Sites Length = 1065 | Back alignment and structure |
| >pdb|3T9W|A Chain A, Small Laccase From Amycolatopsis Sp. Atcc 39116 Length = 299 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 381 | |||
| 1aoz_A | 552 | Ascorbate oxidase; oxidoreductase(oxygen acceptor) | 1e-127 | |
| 1zpu_A | 534 | Iron transport multicopper oxidase FET3; ferroxida | 1e-109 | |
| 2q9o_A | 559 | Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct | 1e-108 | |
| 3pxl_A | 499 | Laccase; 4-copper protein, metal-binding, oxidored | 1e-106 | |
| 3sqr_A | 580 | Laccase; multicopper oxidase, glycosylation, oxido | 1e-105 | |
| 1v10_A | 521 | Laccase; multicopper blue oxidase, oxidase; 1.7A { | 1e-104 | |
| 1hfu_A | 503 | Laccase 1; oxidoreductase, blue multi-copper oxida | 1e-103 | |
| 3t6v_A | 495 | Laccase; beta barrel, oxidoreductase; HET: CBS; 2. | 1e-100 | |
| 2zwn_A | 339 | Two-domain type laccase; muticopper oxidase, oxido | 2e-32 | |
| 2zwn_A | 339 | Two-domain type laccase; muticopper oxidase, oxido | 8e-09 | |
| 3g5w_A | 318 | Multicopper oxidase type 1; two domain, laccase, n | 1e-31 | |
| 3g5w_A | 318 | Multicopper oxidase type 1; two domain, laccase, n | 2e-10 | |
| 2xu9_A | 439 | Laccase; oxidoreductase, multicopper oxidases; 1.5 | 6e-17 | |
| 2xu9_A | 439 | Laccase; oxidoreductase, multicopper oxidases; 1.5 | 4e-10 | |
| 3gdc_A | 288 | Multicopper oxidase; beta sandwich, plasmid, oxido | 3e-16 | |
| 3gdc_A | 288 | Multicopper oxidase; beta sandwich, plasmid, oxido | 9e-14 | |
| 3od3_A | 488 | Blue copper oxidase CUEO; multicopper oxidase, Cu( | 6e-16 | |
| 3zx1_A | 481 | Oxidoreductase, putative; laccase, metallo-oxidase | 7e-16 | |
| 3zx1_A | 481 | Oxidoreductase, putative; laccase, metallo-oxidase | 8e-08 | |
| 3zx1_A | 481 | Oxidoreductase, putative; laccase, metallo-oxidase | 7e-04 | |
| 2g23_A | 612 | PHS, phenoxazinone synthase; copper, metalloprotei | 7e-16 | |
| 3abg_A | 534 | Bilirubin oxidase; cleavage on PAIR of basic resid | 2e-15 | |
| 3abg_A | 534 | Bilirubin oxidase; cleavage on PAIR of basic resid | 2e-05 | |
| 3aw5_A | 448 | Multicopper oxidase; beta barrel, oxidoreductase; | 2e-15 | |
| 3aw5_A | 448 | Multicopper oxidase; beta barrel, oxidoreductase; | 3e-05 | |
| 2j5w_A | 1065 | Ceruloplasmin, ferroxidase; oxidoreductase, plasma | 2e-15 | |
| 2j5w_A | 1065 | Ceruloplasmin, ferroxidase; oxidoreductase, plasma | 1e-09 | |
| 2j5w_A | 1065 | Ceruloplasmin, ferroxidase; oxidoreductase, plasma | 8e-09 | |
| 2j5w_A | 1065 | Ceruloplasmin, ferroxidase; oxidoreductase, plasma | 7e-06 | |
| 2j5w_A | 1065 | Ceruloplasmin, ferroxidase; oxidoreductase, plasma | 7e-06 | |
| 1sdd_A | 306 | Coagulation factor V; copper-binding protein, cofa | 1e-14 | |
| 3cg8_A | 343 | Laccase; oxidoreductase, multicopper blue protein; | 2e-14 | |
| 3kw8_A | 276 | Laccase, putative copper oxidase; two-domain lacca | 4e-14 | |
| 2dv6_A | 447 | Nitrite reductase; electron transfer, reduction, d | 4e-12 | |
| 2dv6_A | 447 | Nitrite reductase; electron transfer, reduction, d | 4e-06 | |
| 2r7e_A | 742 | Coagulation factor VIII; ceruloplasmin fold, cuppe | 8e-12 | |
| 2r7e_A | 742 | Coagulation factor VIII; ceruloplasmin fold, cuppe | 3e-10 | |
| 2zoo_A | 442 | Probable nitrite reductase; electron transfer, ele | 1e-11 | |
| 2zoo_A | 442 | Probable nitrite reductase; electron transfer, ele | 1e-08 | |
| 2uxt_A | 451 | Protein SUFI, SUFI; oxidoreductase, periplasmic, c | 1e-11 | |
| 2uxt_A | 451 | Protein SUFI, SUFI; oxidoreductase, periplasmic, c | 1e-05 | |
| 1kbv_A | 327 | ANIA, major outer membrane protein PAN 1; ANIA[NO2 | 3e-11 | |
| 1kbv_A | 327 | ANIA, major outer membrane protein PAN 1; ANIA[NO2 | 3e-08 | |
| 2wsd_A | 513 | Spore coat protein A; oxidoreductase, multi-copper | 5e-11 | |
| 1oe1_A | 336 | Dissimilatory copper-containing nitrite reductase; | 3e-08 | |
| 1mzy_A | 333 | Copper-containing nitrite reductase; mutant M182T, | 1e-07 | |
| 2bw4_A | 340 | Copper-containing nitrite reductase; oxidoreductas | 2e-07 | |
| 2bw4_A | 340 | Copper-containing nitrite reductase; oxidoreductas | 3e-04 | |
| 1sdd_B | 647 | Coagulation factor V; copper-binding protein, cofa | 2e-04 |
| >1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Length = 552 | Back alignment and structure |
|---|
Score = 376 bits (968), Expect = e-127
Identities = 102/385 (26%), Positives = 164/385 (42%), Gaps = 36/385 (9%)
Query: 2 RFPSNAKVSDVTMNCNAETVRFPVEAGETILLRIINSAMNQEHFFGVANHKLTVVGVDTS 61
++ SN + + + + F V +T +RI ++ F + NH+L VV D +
Sbjct: 185 KYDSNLEPCKLKGSESCAPYIFHVSPKKTYRIRIASTTALAALNFAIGNHQLLVVEADGN 244
Query: 62 YTKPFPTSVIMIAPGQTTNVLLTADQPPAR-YYMAAHAYNTANAAFDNTTTTAILEYKSA 120
Y +PF TS I I G++ +VL+T DQ P+ Y+++ + +L Y
Sbjct: 245 YVQPFYTSDIDIYSGESYSVLITTDQNPSENYWVSVGTRAR---HPNTPPGLTLLNYLPN 301
Query: 121 PFNGKKGKSRSSAPIFPILPGFNDTATATAFTARIKSL-HQVQVPTVIDENLFFTVGLGL 179
S+ P P ++D + FT RI + + P + +F
Sbjct: 302 S------VSKLPTSPPPQTPAWDDFDRSKNFTYRITAAMGSPKPPVKFNRRIFLLN---- 351
Query: 180 INCSNPNSPRCQGPNGTRFAASINNISFVFPRRNSLMQAYIQGQPGIFTTDFPPVPPIIF 239
Q +IN++S P + A F + PP
Sbjct: 352 ----------TQNVINGYVKWAINDVSLALP-PTPYLGAMKYNLLHAFDQNPPP-EVFPE 399
Query: 240 DYTGNVSRGLWQPRKRTKLYKLKFGSRVQIVFQDTSIVSV---EDHPMHLHGHEFYVVGS 296
DY + + R +Y+ K G V ++ Q+ +++ E HP HLHGH+F+V+G
Sbjct: 400 DYDIDTPPTNEKTRIGNGVYQFKIGEVVDVILQNANMMKENLSETHPWHLHGHDFWVLGY 459
Query: 297 GLGNFNPSTDTAKFNLIDPPRRNTIGTPPGGWVAVRFVAENPGIWLLHCHIDSHLTWGLA 356
G G F+ + + NL +PP RNT+ P GW A+RFVA+NPG+W HCHI+ HL G+
Sbjct: 460 GDGKFSAE-EESSLNLKNPPLRNTVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGMG 518
Query: 357 MAFLVENGVGKLQTVQPPPLDLPRC 381
+ F + V P C
Sbjct: 519 VVFAEGV-----EKVGRIPTKALAC 538
|
| >1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Length = 534 | Back alignment and structure |
|---|
| >2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Length = 559 | Back alignment and structure |
|---|
| >3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Length = 499 | Back alignment and structure |
|---|
| >3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Length = 580 | Back alignment and structure |
|---|
| >1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Length = 521 | Back alignment and structure |
|---|
| >1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Length = 503 | Back alignment and structure |
|---|
| >3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Length = 495 | Back alignment and structure |
|---|
| >2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Length = 339 | Back alignment and structure |
|---|
| >2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Length = 339 | Back alignment and structure |
|---|
| >3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Length = 318 | Back alignment and structure |
|---|
| >3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Length = 318 | Back alignment and structure |
|---|
| >2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Length = 439 | Back alignment and structure |
|---|
| >2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Length = 439 | Back alignment and structure |
|---|
| >3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Length = 288 | Back alignment and structure |
|---|
| >3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Length = 288 | Back alignment and structure |
|---|
| >3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Length = 488 | Back alignment and structure |
|---|
| >3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Length = 481 | Back alignment and structure |
|---|
| >3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Length = 481 | Back alignment and structure |
|---|
| >3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Length = 481 | Back alignment and structure |
|---|
| >3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Length = 534 | Back alignment and structure |
|---|
| >3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Length = 534 | Back alignment and structure |
|---|
| >3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Length = 448 | Back alignment and structure |
|---|
| >3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Length = 448 | Back alignment and structure |
|---|
| >2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 | Back alignment and structure |
|---|
| >2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 | Back alignment and structure |
|---|
| >2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 | Back alignment and structure |
|---|
| >2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 | Back alignment and structure |
|---|
| >2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 | Back alignment and structure |
|---|
| >1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Length = 306 | Back alignment and structure |
|---|
| >3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Length = 343 | Back alignment and structure |
|---|
| >3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} Length = 276 | Back alignment and structure |
|---|
| >2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 | Back alignment and structure |
|---|
| >2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 | Back alignment and structure |
|---|
| >2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 | Back alignment and structure |
|---|
| >2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 | Back alignment and structure |
|---|
| >2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Length = 442 | Back alignment and structure |
|---|
| >2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Length = 442 | Back alignment and structure |
|---|
| >2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Length = 451 | Back alignment and structure |
|---|
| >2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Length = 451 | Back alignment and structure |
|---|
| >1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Length = 327 | Back alignment and structure |
|---|
| >1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Length = 327 | Back alignment and structure |
|---|
| >2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Length = 513 | Back alignment and structure |
|---|
| >1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Length = 336 | Back alignment and structure |
|---|
| >1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Length = 333 | Back alignment and structure |
|---|
| >2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Length = 340 | Back alignment and structure |
|---|
| >2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Length = 340 | Back alignment and structure |
|---|
| >1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Length = 647 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 381 | |||
| 1aoz_A | 552 | Ascorbate oxidase; oxidoreductase(oxygen acceptor) | 100.0 | |
| 3sqr_A | 580 | Laccase; multicopper oxidase, glycosylation, oxido | 100.0 | |
| 3pxl_A | 499 | Laccase; 4-copper protein, metal-binding, oxidored | 100.0 | |
| 1zpu_A | 534 | Iron transport multicopper oxidase FET3; ferroxida | 100.0 | |
| 1hfu_A | 503 | Laccase 1; oxidoreductase, blue multi-copper oxida | 100.0 | |
| 1v10_A | 521 | Laccase; multicopper blue oxidase, oxidase; 1.7A { | 100.0 | |
| 3t6v_A | 495 | Laccase; beta barrel, oxidoreductase; HET: CBS; 2. | 100.0 | |
| 2q9o_A | 559 | Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct | 100.0 | |
| 2xu9_A | 439 | Laccase; oxidoreductase, multicopper oxidases; 1.5 | 100.0 | |
| 3abg_A | 534 | Bilirubin oxidase; cleavage on PAIR of basic resid | 100.0 | |
| 2uxt_A | 451 | Protein SUFI, SUFI; oxidoreductase, periplasmic, c | 100.0 | |
| 3aw5_A | 448 | Multicopper oxidase; beta barrel, oxidoreductase; | 100.0 | |
| 2wsd_A | 513 | Spore coat protein A; oxidoreductase, multi-copper | 100.0 | |
| 3gyr_A | 612 | PHS, phenoxazinone synthase; metalloprotein, lacca | 100.0 | |
| 3zx1_A | 481 | Oxidoreductase, putative; laccase, metallo-oxidase | 100.0 | |
| 2g23_A | 612 | PHS, phenoxazinone synthase; copper, metalloprotei | 100.0 | |
| 3od3_A | 488 | Blue copper oxidase CUEO; multicopper oxidase, Cu( | 100.0 | |
| 2dv6_A | 447 | Nitrite reductase; electron transfer, reduction, d | 99.96 | |
| 3cg8_A | 343 | Laccase; oxidoreductase, multicopper blue protein; | 99.96 | |
| 2zwn_A | 339 | Two-domain type laccase; muticopper oxidase, oxido | 99.95 | |
| 3gdc_A | 288 | Multicopper oxidase; beta sandwich, plasmid, oxido | 99.94 | |
| 3kw8_A | 276 | Laccase, putative copper oxidase; two-domain lacca | 99.93 | |
| 3g5w_A | 318 | Multicopper oxidase type 1; two domain, laccase, n | 99.93 | |
| 3t9w_A | 299 | Small laccase, multi-copper oxidase; two-domain co | 99.93 | |
| 3tas_A | 313 | Small laccase, multi-copper oxidase; two-domain la | 99.92 | |
| 2j5w_A | 1065 | Ceruloplasmin, ferroxidase; oxidoreductase, plasma | 99.89 | |
| 2r7e_A | 742 | Coagulation factor VIII; ceruloplasmin fold, cuppe | 99.89 | |
| 2j5w_A | 1065 | Ceruloplasmin, ferroxidase; oxidoreductase, plasma | 99.88 | |
| 1sdd_B | 647 | Coagulation factor V; copper-binding protein, cofa | 99.88 | |
| 1sdd_A | 306 | Coagulation factor V; copper-binding protein, cofa | 99.88 | |
| 2bw4_A | 340 | Copper-containing nitrite reductase; oxidoreductas | 99.84 | |
| 1kbv_A | 327 | ANIA, major outer membrane protein PAN 1; ANIA[NO2 | 99.84 | |
| 2r7e_B | 770 | Coagulation factor VIII; ceruloplasmin fold, cuppe | 99.81 | |
| 1mzy_A | 333 | Copper-containing nitrite reductase; mutant M182T, | 99.78 | |
| 2r7e_A | 742 | Coagulation factor VIII; ceruloplasmin fold, cuppe | 99.76 | |
| 1oe1_A | 336 | Dissimilatory copper-containing nitrite reductase; | 99.73 | |
| 2zoo_A | 442 | Probable nitrite reductase; electron transfer, ele | 99.72 | |
| 1kbv_A | 327 | ANIA, major outer membrane protein PAN 1; ANIA[NO2 | 99.7 | |
| 2dv6_A | 447 | Nitrite reductase; electron transfer, reduction, d | 99.66 | |
| 2zwn_A | 339 | Two-domain type laccase; muticopper oxidase, oxido | 99.58 | |
| 2zoo_A | 442 | Probable nitrite reductase; electron transfer, ele | 99.57 | |
| 3g5w_A | 318 | Multicopper oxidase type 1; two domain, laccase, n | 99.51 | |
| 1mzy_A | 333 | Copper-containing nitrite reductase; mutant M182T, | 99.35 | |
| 2bw4_A | 340 | Copper-containing nitrite reductase; oxidoreductas | 99.29 | |
| 1oe1_A | 336 | Dissimilatory copper-containing nitrite reductase; | 99.29 | |
| 2aan_A | 139 | Auracyanin A; cupredoxin fold, electron transport; | 99.22 | |
| 3cvb_A | 105 | Plastocyanin; cupredoxin, SELF assembly, copper, e | 99.16 | |
| 3gdc_A | 288 | Multicopper oxidase; beta sandwich, plasmid, oxido | 99.15 | |
| 2xu9_A | 439 | Laccase; oxidoreductase, multicopper oxidases; 1.5 | 99.06 | |
| 1sdd_B | 647 | Coagulation factor V; copper-binding protein, cofa | 99.03 | |
| 3tas_A | 313 | Small laccase, multi-copper oxidase; two-domain la | 98.92 | |
| 2gim_A | 106 | Plastocyanin; beta sheet, Cu, helix, electron tran | 98.88 | |
| 2uxt_A | 451 | Protein SUFI, SUFI; oxidoreductase, periplasmic, c | 98.87 | |
| 2r7e_B | 770 | Coagulation factor VIII; ceruloplasmin fold, cuppe | 98.82 | |
| 1qhq_A | 140 | Protein (auracyanin); electron transfer, cupredoxi | 98.82 | |
| 3t9w_A | 299 | Small laccase, multi-copper oxidase; two-domain co | 98.82 | |
| 1aoz_A | 552 | Ascorbate oxidase; oxidoreductase(oxygen acceptor) | 98.79 | |
| 3kw8_A | 276 | Laccase, putative copper oxidase; two-domain lacca | 98.78 | |
| 1sdd_A | 306 | Coagulation factor V; copper-binding protein, cofa | 98.77 | |
| 1v10_A | 521 | Laccase; multicopper blue oxidase, oxidase; 1.7A { | 98.75 | |
| 3pxl_A | 499 | Laccase; 4-copper protein, metal-binding, oxidored | 98.73 | |
| 3cg8_A | 343 | Laccase; oxidoreductase, multicopper blue protein; | 98.71 | |
| 1hfu_A | 503 | Laccase 1; oxidoreductase, blue multi-copper oxida | 98.7 | |
| 1pcs_A | 98 | Plastocyanin; electron transport; 2.15A {Synechocy | 98.68 | |
| 3t6v_A | 495 | Laccase; beta barrel, oxidoreductase; HET: CBS; 2. | 98.64 | |
| 1bxv_A | 91 | Plastocyanin; copper protein, electron transfer; 1 | 98.63 | |
| 2plt_A | 98 | Plastocyanin; electron transport; 1.50A {Chlamydom | 98.62 | |
| 4hci_A | 100 | Cupredoxin 1; structural genomics, niaid, national | 98.58 | |
| 1b3i_A | 97 | PETE protein, protein (plastocyanin); electron tra | 98.57 | |
| 1iby_A | 112 | Nitrosocyanin; RED copper, cupredoxin, beta hairpi | 98.56 | |
| 1byp_A | 99 | Protein (plastocyanin); electron transfer, photosy | 98.44 | |
| 1kdj_A | 102 | Plastocyanin; electron transfer, photosystem, PAI- | 98.39 | |
| 3sqr_A | 580 | Laccase; multicopper oxidase, glycosylation, oxido | 98.37 | |
| 2q9o_A | 559 | Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct | 98.37 | |
| 2cal_A | 154 | Rusticyanin; iron respiratory electron transport c | 98.29 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 98.23 | |
| 3zx1_A | 481 | Oxidoreductase, putative; laccase, metallo-oxidase | 98.2 | |
| 3aw5_A | 448 | Multicopper oxidase; beta barrel, oxidoreductase; | 98.2 | |
| 1zpu_A | 534 | Iron transport multicopper oxidase FET3; ferroxida | 98.18 | |
| 1plc_A | 99 | Plastocyanin; electron transport; 1.33A {Populus n | 98.13 | |
| 3od3_A | 488 | Blue copper oxidase CUEO; multicopper oxidase, Cu( | 98.13 | |
| 2ov0_A | 105 | Amicyanin; beta-sandwich, electron transport; 0.75 | 98.04 | |
| 3abg_A | 534 | Bilirubin oxidase; cleavage on PAIR of basic resid | 97.96 | |
| 2wsd_A | 513 | Spore coat protein A; oxidoreductase, multi-copper | 97.62 | |
| 3tu6_A | 127 | Pseudoazurin (blue copper protein); cupredoxins, b | 97.58 | |
| 2g23_A | 612 | PHS, phenoxazinone synthase; copper, metalloprotei | 97.58 | |
| 3gyr_A | 612 | PHS, phenoxazinone synthase; metalloprotein, lacca | 97.57 | |
| 3erx_A | 123 | Pseudoazurin; copper protein, high-resolution, E t | 97.57 | |
| 1iuz_A | 98 | Plastocyanin; electron transport; 1.60A {Ulva pert | 97.54 | |
| 3ef4_A | 124 | Pseudoazurin, blue copper protein; electron transf | 97.44 | |
| 2aan_A | 139 | Auracyanin A; cupredoxin fold, electron transport; | 97.35 | |
| 1id2_A | 106 | Amicyanin; beta barrel, type-1 blue copper protein | 97.27 | |
| 1paz_A | 123 | Pseudoazurin precursor; electron transfer(cupropro | 97.2 | |
| 3c75_A | 132 | Amicyanin; copper proteins, electron transfer comp | 97.13 | |
| 3sbq_A | 638 | Nitrous-oxide reductase; beta-propeller, cupredoxi | 97.12 | |
| 1pmy_A | 123 | Pseudoazurin; electron transfer(cuproprotein); 1.5 | 97.1 | |
| 3ay2_A | 167 | Lipid modified azurin protein; beta sandwich, bact | 97.04 | |
| 1cuo_A | 129 | Protein (azurin ISO-2); beta barrel, periplasmic, | 96.75 | |
| 2cua_A | 135 | Protein (CUA); CUA center, electron transport; 1.6 | 96.66 | |
| 2ccw_A | 129 | Azurin II, AZN-2; electron transport (cuproprotein | 96.51 | |
| 1iby_A | 112 | Nitrosocyanin; RED copper, cupredoxin, beta hairpi | 96.49 | |
| 2iaa_C | 128 | Azurin; quinoprotein, tryptophan tryptophylquinone | 96.38 | |
| 2ux6_A | 122 | Pseudoazurin; type-1 copper, metal-binding, redox | 96.35 | |
| 1nwp_A | 128 | Azurin; electron transport, cupredoxin, electron t | 96.28 | |
| 1qhq_A | 140 | Protein (auracyanin); electron transfer, cupredoxi | 95.61 | |
| 3s8f_B | 168 | Cytochrome C oxidase subunit 2; complex IV, respir | 95.35 | |
| 2ccw_A | 129 | Azurin II, AZN-2; electron transport (cuproprotein | 95.32 | |
| 3fsa_A | 125 | Azurin; copper, cupredoxin fold, metal-binding, pr | 95.31 | |
| 1nwp_A | 128 | Azurin; electron transport, cupredoxin, electron t | 95.2 | |
| 4hci_A | 100 | Cupredoxin 1; structural genomics, niaid, national | 95.06 | |
| 3cvb_A | 105 | Plastocyanin; cupredoxin, SELF assembly, copper, e | 94.66 | |
| 3fsa_A | 125 | Azurin; copper, cupredoxin fold, metal-binding, pr | 94.39 | |
| 2iaa_C | 128 | Azurin; quinoprotein, tryptophan tryptophylquinone | 94.35 | |
| 3ay2_A | 167 | Lipid modified azurin protein; beta sandwich, bact | 94.2 | |
| 1cuo_A | 129 | Protein (azurin ISO-2); beta barrel, periplasmic, | 93.38 | |
| 2gim_A | 106 | Plastocyanin; beta sheet, Cu, helix, electron tran | 93.23 | |
| 2cal_A | 154 | Rusticyanin; iron respiratory electron transport c | 92.87 | |
| 1kdj_A | 102 | Plastocyanin; electron transfer, photosystem, PAI- | 91.32 | |
| 1b3i_A | 97 | PETE protein, protein (plastocyanin); electron tra | 90.91 | |
| 2plt_A | 98 | Plastocyanin; electron transport; 1.50A {Chlamydom | 90.28 | |
| 1bxv_A | 91 | Plastocyanin; copper protein, electron transfer; 1 | 89.53 | |
| 1iuz_A | 98 | Plastocyanin; electron transport; 1.60A {Ulva pert | 88.9 | |
| 1pcs_A | 98 | Plastocyanin; electron transport; 2.15A {Synechocy | 88.81 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 87.84 | |
| 2ov0_A | 105 | Amicyanin; beta-sandwich, electron transport; 0.75 | 87.0 | |
| 1plc_A | 99 | Plastocyanin; electron transport; 1.33A {Populus n | 83.65 | |
| 1byp_A | 99 | Protein (plastocyanin); electron transfer, photosy | 83.02 |
| >1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-61 Score=492.61 Aligned_cols=327 Identities=29% Similarity=0.519 Sum_probs=248.5
Q ss_pred eeEEeeCCCEEEEEEEecCCCceeEEEEcCeeEEEEeeCCCccCceEeeEEEeccCcEEEEEEEe-CCCCccceeeeeec
Q 016876 21 VRFPVEAGETILLRIINSAMNQEHFFGVANHKLTVVGVDTSYTKPFPTSVIMIAPGQTTNVLLTA-DQPPARYYMAAHAY 99 (381)
Q Consensus 21 ~~~~v~~Gk~yRlRlINa~~~~~~~~~idgh~m~VIa~DG~~v~P~~v~~l~l~~GeRydVlV~~-~~~~g~y~lr~~~~ 99 (381)
++++|++||+|||||||+|+.+.+.|+|+||+|+|||+||++++|+.++.|.|++||||||+|++ ++.+|+|||++...
T Consensus 204 ~~~~v~~G~~~RlRliNa~~~~~~~~~i~gh~~~vi~~DG~~~~P~~~~~l~i~pgqR~dvlv~~~~~~~g~y~i~~~~~ 283 (552)
T 1aoz_A 204 YIFHVSPKKTYRIRIASTTALAALNFAIGNHQLLVVEADGNYVQPFYTSDIDIYSGESYSVLITTDQNPSENYWVSVGTR 283 (552)
T ss_dssp CCEEECTTCEEEEEEEECCSSCEEEEEETTCCEEEEEETTEEEEEEEESCEEECTTCEEEEEEECCSCTTCCEEEEEEEE
T ss_pred eEEEEcCCCEEEEEEEcccccceEEEEEcCcEEEEEEECCcccCceEEeEEEEcCCcEEEEEEEcCCCCCCCEEEEEEcc
Confidence 38999999999999999999999999999999999999999999999999999999999999999 55679999999875
Q ss_pred cccccCCCCCceEEEEEecCCCCCCCCCCCCCCCCCCCCCCCCCCcccchhccccccccC---CCCCCcccceeEEEEec
Q 016876 100 NTANAAFDNTTTTAILEYKSAPFNGKKGKSRSSAPIFPILPGFNDTATATAFTARIKSLH---QVQVPTVIDENLFFTVG 176 (381)
Q Consensus 100 ~~~~~~~~~~~~~ail~y~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~l~~l~---~~~~p~~~d~~~~~~~~ 176 (381)
. |. .++....|+|+|.++..... +....|..+.+++......+ .++.+. +...|.++++++.+.++
T Consensus 284 ~-~~--~~~~~~~ail~y~~~~~~~~------p~~~~p~~p~~~~~~~~~~~--~l~~l~~~~~~~~~~~~~~~~~l~~~ 352 (552)
T 1aoz_A 284 A-RH--PNTPPGLTLLNYLPNSVSKL------PTSPPPQTPAWDDFDRSKNF--TYRITAAMGSPKPPVKFNRRIFLLNT 352 (552)
T ss_dssp S-SC--CCSCCEEEEEEETTSCTTSC------CSSCCCCCCCTTCHHHHHHH--HTTCCBCTTCCCCCSSCSEEEEEEEE
T ss_pred c-CC--CCCccEEEEEEECCCCCCCC------CCCCCCCCCccccccccccc--cccccccCCCCCCCCCCcEEEEEEEe
Confidence 4 21 13456899999987653111 11112333434433322211 223332 23345567888877765
Q ss_pred eeeeecCCCCCCCccCCCCCeEEEEecceeeecCCchhhHHHHHhCCCCcccCCCCCCCCc-ccCCCCCCCCCcccCCCc
Q 016876 177 LGLINCSNPNSPRCQGPNGTRFAASINNISFVFPRRNSLMQAYIQGQPGIFTTDFPPVPPI-IFDYTGNVSRGLWQPRKR 255 (381)
Q Consensus 177 ~~~~~~~~~~~~~~~~~~g~~~~~~iN~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~p~-~~~~~~~~~~~~~~~~~~ 255 (381)
++.. + ..+.|+|||++|..+.. |+|.+.+.++++.+..+++..++. .|+... +..+...+.+
T Consensus 353 ~~~~-------------~-~~~~w~iNg~s~~~p~~-P~L~~~~~~~~g~~~~~~p~~~~~~~~~~~~--~~~~~~~~~~ 415 (552)
T 1aoz_A 353 QNVI-------------N-GYVKWAINDVSLALPPT-PYLGAMKYNLLHAFDQNPPPEVFPEDYDIDT--PPTNEKTRIG 415 (552)
T ss_dssp EEEE-------------T-TEEEEEETTEEECCCSS-CHHHHHHTTCTTSSCCSCCCSCCCTTCCTTS--CCCCTTCEEE
T ss_pred eccC-------------C-CeEEEEECCCccCCCCC-CHHHHHhhcCccccccCCCcccccccccccc--cccccccccc
Confidence 5421 2 24679999999998877 777777777777666555543221 122221 1112122356
Q ss_pred cceEEeecCCEEEEEEeecCCcC---CCCCceeecCccEEEEEcCCCCCCCCCCCCccCCCCCCccceEEeCCCcEEEEE
Q 016876 256 TKLYKLKFGSRVQIVFQDTSIVS---VEDHPMHLHGHEFYVVGSGLGNFNPSTDTAKFNLIDPPRRNTIGTPPGGWVAVR 332 (381)
Q Consensus 256 ~~~~~~~~g~~v~~~i~n~~~~~---~~~Hp~HlHG~~f~v~~~~~g~~~~~~~~~~~n~~~p~~rDtv~v~~~~~~~i~ 332 (381)
+.++.++.|++|+|+|+|.+.+. ...||||||||+|+|+++|.|.|++ +....+|+.+|+|||||.|++++|++||
T Consensus 416 t~~~~~~~g~~v~ivi~N~~~~~~~~~~~HP~HLHGh~F~Vl~~g~G~~~~-~~~~~~n~~~p~~RDTv~vpp~g~v~Ir 494 (552)
T 1aoz_A 416 NGVYQFKIGEVVDVILQNANMMKENLSETHPWHLHGHDFWVLGYGDGKFSA-EEESSLNLKNPPLRNTVVIFPYGWTAIR 494 (552)
T ss_dssp CCCEEECTTCEEEEEEEECCCSSTTCCCCEEEEETTCCEEEEEEEESSCCG-GGGGGSCCSSCCEESEEEECTTEEEEEE
T ss_pred ceEEEecCCCEEEEEEeCCcccccccCCCCCEEEcCCceEEEecccCccCc-ccccccccCCCCccCeEEeCCCceEEEE
Confidence 78899999999999999976433 5679999999999999999899877 4456789999999999999999999999
Q ss_pred EEeCCceeEEEEecchhhHhccceEEEEEecCCCcCCCCCCCCCCCCCC
Q 016876 333 FVAENPGIWLLHCHIDSHLTWGLAMAFLVENGVGKLQTVQPPPLDLPRC 381 (381)
Q Consensus 333 f~~~~pG~w~~HCHi~~H~~~Gm~~~~~v~~~~~~~~~~~~~p~~~~~c 381 (381)
|++||||.|+|||||+||++.|||++|.|.+. +++++|.++++|
T Consensus 495 f~aDNPG~W~~HCHi~~H~~~GM~~~~~~~~~-----~~~~~P~~~~~C 538 (552)
T 1aoz_A 495 FVADNPGVWAFHCHIEPHLHMGMGVVFAEGVE-----KVGRIPTKALAC 538 (552)
T ss_dssp EECCSCEEEEEEESSHHHHHTTCEEEEEECGG-----GCCCCCHHHHSS
T ss_pred EEcCCCeEEEEEeeehhHhhCCCeEEEEeCch-----hhccCCcchhhh
Confidence 99999999999999999999999999987432 466688899999
|
| >3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} | Back alignment and structure |
|---|
| >3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* | Back alignment and structure |
|---|
| >1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* | Back alignment and structure |
|---|
| >1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 | Back alignment and structure |
|---|
| >3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* | Back alignment and structure |
|---|
| >2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* | Back alignment and structure |
|---|
| >2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A | Back alignment and structure |
|---|
| >3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* | Back alignment and structure |
|---|
| >2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A | Back alignment and structure |
|---|
| >3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} | Back alignment and structure |
|---|
| >2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A | Back alignment and structure |
|---|
| >3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} | Back alignment and structure |
|---|
| >3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... | Back alignment and structure |
|---|
| >2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} | Back alignment and structure |
|---|
| >3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} | Back alignment and structure |
|---|
| >3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* | Back alignment and structure |
|---|
| >3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} | Back alignment and structure |
|---|
| >3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* | Back alignment and structure |
|---|
| >2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* | Back alignment and structure |
|---|
| >2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* | Back alignment and structure |
|---|
| >2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* | Back alignment and structure |
|---|
| >1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 | Back alignment and structure |
|---|
| >1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 | Back alignment and structure |
|---|
| >2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... | Back alignment and structure |
|---|
| >1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A | Back alignment and structure |
|---|
| >2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* | Back alignment and structure |
|---|
| >1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A | Back alignment and structure |
|---|
| >2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* | Back alignment and structure |
|---|
| >1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... | Back alignment and structure |
|---|
| >2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} | Back alignment and structure |
|---|
| >1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A | Back alignment and structure |
|---|
| >2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} | Back alignment and structure |
|---|
| >2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} | Back alignment and structure |
|---|
| >2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} | Back alignment and structure |
|---|
| >3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A | Back alignment and structure |
|---|
| >2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... | Back alignment and structure |
|---|
| >1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... | Back alignment and structure |
|---|
| >2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A | Back alignment and structure |
|---|
| >3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} | Back alignment and structure |
|---|
| >2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A | Back alignment and structure |
|---|
| >1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 | Back alignment and structure |
|---|
| >3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* | Back alignment and structure |
|---|
| >2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A | Back alignment and structure |
|---|
| >2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A | Back alignment and structure |
|---|
| >2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* | Back alignment and structure |
|---|
| >1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A | Back alignment and structure |
|---|
| >3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} | Back alignment and structure |
|---|
| >1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* | Back alignment and structure |
|---|
| >3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* | Back alignment and structure |
|---|
| >1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 | Back alignment and structure |
|---|
| >1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 | Back alignment and structure |
|---|
| >3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* | Back alignment and structure |
|---|
| >3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* | Back alignment and structure |
|---|
| >1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A | Back alignment and structure |
|---|
| >3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* | Back alignment and structure |
|---|
| >1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A | Back alignment and structure |
|---|
| >2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 | Back alignment and structure |
|---|
| >4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A | Back alignment and structure |
|---|
| >1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* | Back alignment and structure |
|---|
| >1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A | Back alignment and structure |
|---|
| >1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A | Back alignment and structure |
|---|
| >1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A | Back alignment and structure |
|---|
| >3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} | Back alignment and structure |
|---|
| >2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* | Back alignment and structure |
|---|
| >2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} | Back alignment and structure |
|---|
| >1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A | Back alignment and structure |
|---|
| >3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... | Back alignment and structure |
|---|
| >2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... | Back alignment and structure |
|---|
| >3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* | Back alignment and structure |
|---|
| >2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A | Back alignment and structure |
|---|
| >3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} | Back alignment and structure |
|---|
| >3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A | Back alignment and structure |
|---|
| >1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A | Back alignment and structure |
|---|
| >3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 | Back alignment and structure |
|---|
| >2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 | Back alignment and structure |
|---|
| >1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* | Back alignment and structure |
|---|
| >3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A | Back alignment and structure |
|---|
| >1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 | Back alignment and structure |
|---|
| >3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A | Back alignment and structure |
|---|
| >2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* | Back alignment and structure |
|---|
| >2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A | Back alignment and structure |
|---|
| >1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A | Back alignment and structure |
|---|
| >2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* | Back alignment and structure |
|---|
| >2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A | Back alignment and structure |
|---|
| >1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A | Back alignment and structure |
|---|
| >1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A | Back alignment and structure |
|---|
| >3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... | Back alignment and structure |
|---|
| >2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A | Back alignment and structure |
|---|
| >3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... | Back alignment and structure |
|---|
| >1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A | Back alignment and structure |
|---|
| >4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A | Back alignment and structure |
|---|
| >3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A | Back alignment and structure |
|---|
| >3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... | Back alignment and structure |
|---|
| >2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* | Back alignment and structure |
|---|
| >3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A | Back alignment and structure |
|---|
| >2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A | Back alignment and structure |
|---|
| >2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A | Back alignment and structure |
|---|
| >1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A | Back alignment and structure |
|---|
| >1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* | Back alignment and structure |
|---|
| >2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 | Back alignment and structure |
|---|
| >1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A | Back alignment and structure |
|---|
| >1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A | Back alignment and structure |
|---|
| >1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... | Back alignment and structure |
|---|
| >1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A | Back alignment and structure |
|---|
| >1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 381 | ||||
| d1aoza3 | 214 | b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (C | 4e-43 | |
| d2q9oa3 | 216 | b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyce | 2e-28 | |
| d1gyca3 | 199 | b.6.1.3 (A:301-499) Laccase {Trametes versicolor, | 3e-28 | |
| d1aoza2 | 209 | b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (C | 6e-28 | |
| d1hfua3 | 200 | b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Copr | 2e-27 | |
| d1v10a2 | 168 | b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus | 5e-27 | |
| d1gyca2 | 170 | b.6.1.3 (A:131-300) Laccase {Trametes versicolor, | 4e-25 | |
| d2q9oa2 | 181 | b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyce | 1e-24 | |
| d1hfua2 | 172 | b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Copr | 1e-24 | |
| d1gska3 | 154 | b.6.1.3 (A:357-510) Spore coat protein A, CotA {Ba | 3e-24 | |
| d1v10a3 | 190 | b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus | 6e-24 | |
| d1kv7a3 | 181 | b.6.1.3 (A:336-516) multi-copper oxidase CueO {Esc | 2e-19 | |
| d1sddb2 | 139 | b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (B | 2e-14 | |
| d2j5wa5 | 149 | b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sa | 2e-13 | |
| d1gska2 | 174 | b.6.1.3 (A:183-356) Spore coat protein A, CotA {Ba | 8e-13 | |
| d1kcwa2 | 146 | b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sap | 1e-12 | |
| d1kv7a2 | 165 | b.6.1.3 (A:171-335) multi-copper oxidase CueO {Esc | 2e-12 | |
| d2j5wa2 | 145 | b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sap | 4e-11 | |
| d2bw4a2 | 173 | b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcali | 1e-10 | |
| d1sdda2 | 116 | b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos | 7e-10 | |
| d1kbva2 | 151 | b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisse | 2e-07 | |
| d1oe1a2 | 177 | b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcali | 6e-07 | |
| d1aoza1 | 129 | b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cuc | 3e-05 | |
| d1e30a_ | 153 | b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidan | 4e-05 | |
| d1gyca1 | 130 | b.6.1.3 (A:1-130) Laccase {Trametes versicolor, la | 2e-04 | |
| d2q9oa1 | 162 | b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces | 0.001 | |
| d1kbva1 | 151 | b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisser | 0.001 | |
| d1oe2a1 | 159 | b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcalige | 0.001 | |
| d2bw4a1 | 157 | b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcalige | 0.003 | |
| d1qhqa_ | 139 | b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus | 0.004 |
| >d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 214 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Cupredoxin-like superfamily: Cupredoxins family: Multidomain cupredoxins domain: Ascorbate oxidase species: Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]
Score = 147 bits (371), Expect = 4e-43
Identities = 61/195 (31%), Positives = 92/195 (47%), Gaps = 11/195 (5%)
Query: 190 CQGPNGTRFAASINNISFVFPRRNSLMQAYIQGQPGIFTTDFPPVPPIIFDYTGNVSRGL 249
Q +IN++S P + A F + PP DY +
Sbjct: 14 TQNVINGYVKWAINDVSLALPP-TPYLGAMKYNLLHAFDQNPPPEVFP-EDYDIDTPPTN 71
Query: 250 WQPRKRTKLYKLKFGSRVQIVFQDTSIV---SVEDHPMHLHGHEFYVVGSGLGNFNPSTD 306
+ R +Y+ K G V ++ Q+ +++ E HP HLHGH+F+V+G G G F+ +
Sbjct: 72 EKTRIGNGVYQFKIGEVVDVILQNANMMKENLSETHPWHLHGHDFWVLGYGDGKFSAEEE 131
Query: 307 TAKFNLIDPPRRNTIGTPPGGWVAVRFVAENPGIWLLHCHIDSHLTWGLAMAFLVENGVG 366
+ NL +PP RNT+ P GW A+RFVA+NPG+W HCHI+ HL G+ + F
Sbjct: 132 S-SLNLKNPPLRNTVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAEG---- 186
Query: 367 KLQTVQPPPLDLPRC 381
++ V P C
Sbjct: 187 -VEKVGRIPTKALAC 200
|
| >d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 216 | Back information, alignment and structure |
|---|
| >d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 199 | Back information, alignment and structure |
|---|
| >d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 209 | Back information, alignment and structure |
|---|
| >d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 200 | Back information, alignment and structure |
|---|
| >d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 168 | Back information, alignment and structure |
|---|
| >d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 170 | Back information, alignment and structure |
|---|
| >d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 181 | Back information, alignment and structure |
|---|
| >d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 172 | Back information, alignment and structure |
|---|
| >d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 154 | Back information, alignment and structure |
|---|
| >d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 190 | Back information, alignment and structure |
|---|
| >d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 181 | Back information, alignment and structure |
|---|
| >d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 139 | Back information, alignment and structure |
|---|
| >d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 174 | Back information, alignment and structure |
|---|
| >d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 146 | Back information, alignment and structure |
|---|
| >d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 165 | Back information, alignment and structure |
|---|
| >d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 173 | Back information, alignment and structure |
|---|
| >d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 116 | Back information, alignment and structure |
|---|
| >d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Length = 151 | Back information, alignment and structure |
|---|
| >d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 177 | Back information, alignment and structure |
|---|
| >d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 129 | Back information, alignment and structure |
|---|
| >d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Length = 153 | Back information, alignment and structure |
|---|
| >d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 130 | Back information, alignment and structure |
|---|
| >d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 162 | Back information, alignment and structure |
|---|
| >d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Length = 151 | Back information, alignment and structure |
|---|
| >d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 159 | Back information, alignment and structure |
|---|
| >d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 157 | Back information, alignment and structure |
|---|
| >d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Length = 139 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 381 | |||
| d1aoza3 | 214 | Ascorbate oxidase {Zucchini (Cucurbita pepo var. m | 100.0 | |
| d1hfua3 | 200 | Laccase {Inky cap fungus (Coprinus cinereus) [TaxI | 100.0 | |
| d1gyca3 | 199 | Laccase {Trametes versicolor, laccase 2 [TaxId: 53 | 99.98 | |
| d1v10a3 | 190 | Laccase {Rigidoporus lignosus [TaxId: 219653]} | 99.98 | |
| d2q9oa3 | 216 | Laccase {Melanocarpus albomyces [TaxId: 204285]} | 99.97 | |
| d1gska3 | 154 | Spore coat protein A, CotA {Bacillus subtilis [Tax | 99.97 | |
| d2q9oa2 | 181 | Laccase {Melanocarpus albomyces [TaxId: 204285]} | 99.96 | |
| d1gyca2 | 170 | Laccase {Trametes versicolor, laccase 2 [TaxId: 53 | 99.96 | |
| d1hfua2 | 172 | Laccase {Inky cap fungus (Coprinus cinereus) [TaxI | 99.96 | |
| d1v10a2 | 168 | Laccase {Rigidoporus lignosus [TaxId: 219653]} | 99.96 | |
| d1aoza2 | 209 | Ascorbate oxidase {Zucchini (Cucurbita pepo var. m | 99.95 | |
| d1kv7a3 | 181 | multi-copper oxidase CueO {Escherichia coli [TaxId | 99.94 | |
| d2j5wa5 | 149 | Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1sddb2 | 139 | Coagulation factor V {Cow (Bos taurus) [TaxId: 991 | 99.88 | |
| d2j5wa2 | 145 | Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1kcwa2 | 146 | Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1kbva2 | 151 | Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani | 99.84 | |
| d1sdda2 | 116 | Coagulation factor V {Cow (Bos taurus) [TaxId: 991 | 99.84 | |
| d1gska2 | 174 | Spore coat protein A, CotA {Bacillus subtilis [Tax | 99.83 | |
| d1kv7a2 | 165 | multi-copper oxidase CueO {Escherichia coli [TaxId | 99.81 | |
| d2bw4a2 | 173 | Nitrite reductase, NIR {Alcaligenes xylosoxidans [ | 99.71 | |
| d1oe1a2 | 177 | Nitrite reductase, NIR {Alcaligenes xylosoxidans [ | 99.68 | |
| d1e30a_ | 153 | Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 | 99.57 | |
| d1aoza1 | 129 | Ascorbate oxidase {Zucchini (Cucurbita pepo var. m | 99.5 | |
| d2q9oa1 | 162 | Laccase {Melanocarpus albomyces [TaxId: 204285]} | 99.43 | |
| d2bw4a1 | 157 | Nitrite reductase, NIR {Alcaligenes xylosoxidans [ | 99.39 | |
| d1mzya1 | 153 | Nitrite reductase, NIR {Rhodobacter sphaeroides [T | 99.38 | |
| d1oe2a1 | 159 | Nitrite reductase, NIR {Alcaligenes xylosoxidans [ | 99.34 | |
| d1kbva1 | 151 | Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani | 99.32 | |
| d1hfua1 | 131 | Laccase {Inky cap fungus (Coprinus cinereus) [TaxI | 99.16 | |
| d1qhqa_ | 139 | Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] | 99.12 | |
| d2j5wa1 | 192 | Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | 99.07 | |
| d1ibya_ | 112 | Red copper protein nitrosocyanin {Nitrosomonas eur | 99.05 | |
| d1kv7a1 | 140 | multi-copper oxidase CueO {Escherichia coli [TaxId | 99.05 | |
| d1gyca1 | 130 | Laccase {Trametes versicolor, laccase 2 [TaxId: 53 | 99.03 | |
| d1v10a1 | 136 | Laccase {Rigidoporus lignosus [TaxId: 219653]} | 98.92 | |
| d1kbva2 | 151 | Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani | 98.89 | |
| d1fwxa1 | 132 | Nitrous oxide reductase, C-terminal domain {Paraco | 98.77 | |
| d1sdda1 | 180 | Coagulation factor V {Cow (Bos taurus) [TaxId: 991 | 98.72 | |
| d1qnia1 | 131 | Nitrous oxide reductase, C-terminal domain {Pseudo | 98.55 | |
| d2j5wa3 | 207 | Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | 98.51 | |
| d2j5wa4 | 179 | Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | 98.44 | |
| d2j5wa5 | 149 | Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | 98.34 | |
| d1kv7a3 | 181 | multi-copper oxidase CueO {Escherichia coli [TaxId | 98.31 | |
| d2j5wa2 | 145 | Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | 98.25 | |
| d1sddb2 | 139 | Coagulation factor V {Cow (Bos taurus) [TaxId: 991 | 98.2 | |
| d1v10a2 | 168 | Laccase {Rigidoporus lignosus [TaxId: 219653]} | 98.14 | |
| d2bw4a2 | 173 | Nitrite reductase, NIR {Alcaligenes xylosoxidans [ | 98.06 | |
| d1sdda2 | 116 | Coagulation factor V {Cow (Bos taurus) [TaxId: 991 | 98.02 | |
| d1gska1 | 181 | Spore coat protein A, CotA {Bacillus subtilis [Tax | 98.02 | |
| d1kcwa2 | 146 | Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | 98.01 | |
| d2q9oa2 | 181 | Laccase {Melanocarpus albomyces [TaxId: 204285]} | 98.0 | |
| d1mzya2 | 178 | Nitrite reductase, NIR {Rhodobacter sphaeroides [T | 97.91 | |
| d1hfua2 | 172 | Laccase {Inky cap fungus (Coprinus cinereus) [TaxI | 97.88 | |
| d1oe1a2 | 177 | Nitrite reductase, NIR {Alcaligenes xylosoxidans [ | 97.76 | |
| d1gyca2 | 170 | Laccase {Trametes versicolor, laccase 2 [TaxId: 53 | 97.76 | |
| d2cuaa_ | 122 | Cytochrome c oxidase {Thermus thermophilus, ba3 ty | 97.75 | |
| d1aoza2 | 209 | Ascorbate oxidase {Zucchini (Cucurbita pepo var. m | 97.7 | |
| d2q5ba1 | 105 | Plastocyanin {Cyanobacterium (Phormidium laminosum | 97.6 | |
| d1gska3 | 154 | Spore coat protein A, CotA {Bacillus subtilis [Tax | 97.59 | |
| d2plta_ | 98 | Plastocyanin {Green alga (Chlamydomonas reinhardti | 97.5 | |
| d1pcsa_ | 98 | Plastocyanin {Cyanobacterium (Synechocystis sp.), | 97.47 | |
| d1pmya_ | 123 | Pseudoazurin {Methylobacterium extorquens, strain | 97.29 | |
| d1bxua_ | 91 | Plastocyanin {Cyanobacterium (Synechocystis sp.), | 97.26 | |
| d1e30a_ | 153 | Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 | 97.25 | |
| d1hfua3 | 200 | Laccase {Inky cap fungus (Coprinus cinereus) [TaxI | 97.16 | |
| d1sddb1 | 67 | Coagulation factor V {Cow (Bos taurus) [TaxId: 991 | 97.08 | |
| d1cuoa_ | 129 | Azurin {Methylomonas sp. j [TaxId: 32038]} | 97.06 | |
| d2ccwa1 | 129 | Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d | 97.0 | |
| d1jzga_ | 128 | Azurin {Pseudomonas aeruginosa [TaxId: 287]} | 96.99 | |
| d2jxma1 | 97 | Plastocyanin {Photosynthetic prokaryote (Prochloro | 96.97 | |
| d1paza_ | 120 | Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta | 96.97 | |
| d1mzya2 | 178 | Nitrite reductase, NIR {Rhodobacter sphaeroides [T | 96.86 | |
| d1nwpa_ | 128 | Azurin {Pseudomonas putida [TaxId: 303]} | 96.83 | |
| d2cj3a1 | 105 | Plastocyanin {Anabaena variabilis [TaxId: 1172]} | 96.8 | |
| d1plca_ | 99 | Plastocyanin {Poplar (Populus nigra), variant ital | 96.76 | |
| d1aoza3 | 214 | Ascorbate oxidase {Zucchini (Cucurbita pepo var. m | 96.7 | |
| d1iuza_ | 98 | Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: | 96.65 | |
| d1kdja_ | 102 | Plastocyanin {Fern (Adiantum capillus-veneris) [Ta | 96.58 | |
| d1adwa_ | 123 | Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 | 96.51 | |
| d2ov0a1 | 105 | Amicyanin {Paracoccus denitrificans [TaxId: 266]} | 96.47 | |
| d1kv7a1 | 140 | multi-copper oxidase CueO {Escherichia coli [TaxId | 96.42 | |
| d1bqka_ | 124 | Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 | 96.3 | |
| d1ibya_ | 112 | Red copper protein nitrosocyanin {Nitrosomonas eur | 96.21 | |
| d1kv7a2 | 165 | multi-copper oxidase CueO {Escherichia coli [TaxId | 96.02 | |
| d1bypa_ | 99 | Plastocyanin {White campion (Silene pratensis) [Ta | 96.02 | |
| d1oe2a1 | 159 | Nitrite reductase, NIR {Alcaligenes xylosoxidans [ | 96.01 | |
| d1v10a3 | 190 | Laccase {Rigidoporus lignosus [TaxId: 219653]} | 95.96 | |
| d1aoza1 | 129 | Ascorbate oxidase {Zucchini (Cucurbita pepo var. m | 95.91 | |
| d1qhqa_ | 139 | Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] | 95.51 | |
| d2bw4a1 | 157 | Nitrite reductase, NIR {Alcaligenes xylosoxidans [ | 95.5 | |
| d1gyca1 | 130 | Laccase {Trametes versicolor, laccase 2 [TaxId: 53 | 95.28 | |
| d1kbva1 | 151 | Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani | 95.2 | |
| d1fwxa1 | 132 | Nitrous oxide reductase, C-terminal domain {Paraco | 95.0 | |
| d1gska2 | 174 | Spore coat protein A, CotA {Bacillus subtilis [Tax | 94.96 | |
| d2q9oa3 | 216 | Laccase {Melanocarpus albomyces [TaxId: 204285]} | 94.73 | |
| d1mzya1 | 153 | Nitrite reductase, NIR {Rhodobacter sphaeroides [T | 94.68 | |
| d1id2a_ | 106 | Amicyanin {Paracoccus versutus (Thiobacillus versu | 94.62 | |
| d2q9oa1 | 162 | Laccase {Melanocarpus albomyces [TaxId: 204285]} | 94.61 | |
| d2ccwa1 | 129 | Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d | 94.13 | |
| d1cuoa_ | 129 | Azurin {Methylomonas sp. j [TaxId: 32038]} | 94.13 | |
| d1gyca3 | 199 | Laccase {Trametes versicolor, laccase 2 [TaxId: 53 | 94.04 | |
| d1v10a1 | 136 | Laccase {Rigidoporus lignosus [TaxId: 219653]} | 93.96 | |
| d1hfua1 | 131 | Laccase {Inky cap fungus (Coprinus cinereus) [TaxI | 93.87 | |
| d1qnia1 | 131 | Nitrous oxide reductase, C-terminal domain {Pseudo | 91.93 | |
| d1jzga_ | 128 | Azurin {Pseudomonas aeruginosa [TaxId: 287]} | 91.54 | |
| d1cyxa_ | 158 | Quinol oxidase (CyoA) {Escherichia coli [TaxId: 56 | 90.61 | |
| d1nwpa_ | 128 | Azurin {Pseudomonas putida [TaxId: 303]} | 90.0 | |
| d2cuaa_ | 122 | Cytochrome c oxidase {Thermus thermophilus, ba3 ty | 88.78 | |
| d1gska1 | 181 | Spore coat protein A, CotA {Bacillus subtilis [Tax | 82.11 | |
| d3dtub1 | 152 | Cytochrome c oxidase {Rhodobacter sphaeroides [Tax | 80.48 |
| >d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Cupredoxin-like superfamily: Cupredoxins family: Multidomain cupredoxins domain: Ascorbate oxidase species: Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]
Probab=100.00 E-value=1.1e-38 Score=282.91 Aligned_cols=194 Identities=32% Similarity=0.636 Sum_probs=149.6
Q ss_pred CcccceeEEEEeceeeeecCCCCCCCccCCCCCeEEEEecceeeecCCchhhHHHHHhCCCCcccCCCCCCCCcccCCC-
Q 016876 164 PTVIDENLFFTVGLGLINCSNPNSPRCQGPNGTRFAASINNISFVFPRRNSLMQAYIQGQPGIFTTDFPPVPPIIFDYT- 242 (381)
Q Consensus 164 p~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~iN~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~p~~~~~~- 242 (381)
|.+.++++.+...+.. .+| ..+|+|||++|..|.+ |+|.+.+....+.+..+++ |..|+.+
T Consensus 2 P~~~~~ti~l~~~~~~-------------~ng-~~~~~iNniSf~~P~~-P~l~~~~~~~~~~~~~~~~---~~~~~~~~ 63 (214)
T d1aoza3 2 PVKFNRRIFLLNTQNV-------------ING-YVKWAINDVSLALPPT-PYLGAMKYNLLHAFDQNPP---PEVFPEDY 63 (214)
T ss_dssp CSSCSEEEEEEEEEEE-------------ETT-EEEEEETTEEECCCSS-CHHHHHHTTCTTSSCCSCC---CSCCCTTC
T ss_pred CCCCCeEEEEecCccc-------------cCC-eEEEEECCEeccCCCc-chHHHHhhccccccccCCC---cccccccc
Confidence 5567888888554432 144 4589999999999998 6666666655555554432 2233222
Q ss_pred -CCCCCCcccCCCccceEEeecCCEEEEEEeecCCc---CCCCCceeecCccEEEEEcCCCCCCCCCCCCccCCCCCCcc
Q 016876 243 -GNVSRGLWQPRKRTKLYKLKFGSRVQIVFQDTSIV---SVEDHPMHLHGHEFYVVGSGLGNFNPSTDTAKFNLIDPPRR 318 (381)
Q Consensus 243 -~~~~~~~~~~~~~~~~~~~~~g~~v~~~i~n~~~~---~~~~Hp~HlHG~~f~v~~~~~g~~~~~~~~~~~n~~~p~~r 318 (381)
...+......+.|++++++++|++|||+|+|.+.+ ....||||||||+|+|++++.|.++... ...+++.+|++|
T Consensus 64 ~~~~~~~~~~~~~~t~v~~~~~g~~veivl~n~~~~~~~~~~~HP~HlHG~~F~vl~~~~g~~~~~~-~~~~n~~~p~~r 142 (214)
T d1aoza3 64 DIDTPPTNEKTRIGNGVYQFKIGEVVDVILQNANMMKENLSETHPWHLHGHDFWVLGYGDGKFSAEE-ESSLNLKNPPLR 142 (214)
T ss_dssp CTTSCCCCTTCEEECCCEEECTTCEEEEEEEECCCSSTTCCCCEEEEETTCCEEEEEEEESSCCGGG-GGGSCCSSCCEE
T ss_pred cccCCCCCcccccCceeEEecCCCEEEEEEeccccccCCCCCCcceEeecceeEEeccCCCcccccc-cccccccCCcee
Confidence 11222223335678899999999999999996532 2467999999999999999999887543 467889999999
Q ss_pred ceEEeCCCcEEEEEEEeCCceeEEEEecchhhHhccceEEEEEecCCCcCCCCCCCCCCCCCC
Q 016876 319 NTIGTPPGGWVAVRFVAENPGIWLLHCHIDSHLTWGLAMAFLVENGVGKLQTVQPPPLDLPRC 381 (381)
Q Consensus 319 Dtv~v~~~~~~~i~f~~~~pG~w~~HCHi~~H~~~Gm~~~~~v~~~~~~~~~~~~~p~~~~~c 381 (381)
||+.|++|+|++|||++||||.|+||||+++|++.||+++|.|.+ ++++++|.++++|
T Consensus 143 DTv~v~~g~~~~ir~~adnpG~w~~HCH~~~H~~~GM~~~~~v~~-----~~~~~~P~~~~~c 200 (214)
T d1aoza3 143 NTVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAEGV-----EKVGRIPTKALAC 200 (214)
T ss_dssp SEEEECTTEEEEEEEECCSCEEEEEEESSHHHHHTTCEEEEEECG-----GGCCCCCHHHHSS
T ss_pred cCcccCCCceEEEEEecCCCeeEEEEECcHHHHhCcCcEEEEEcc-----ccccCCCcccccc
Confidence 999999999999999999999999999999999999999998742 3456788899998
|
| >d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} | Back information, alignment and structure |
|---|
| >d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} | Back information, alignment and structure |
|---|
| >d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} | Back information, alignment and structure |
|---|
| >d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} | Back information, alignment and structure |
|---|
| >d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} | Back information, alignment and structure |
|---|
| >d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} | Back information, alignment and structure |
|---|
| >d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} | Back information, alignment and structure |
|---|
| >d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} | Back information, alignment and structure |
|---|
| >d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} | Back information, alignment and structure |
|---|
| >d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} | Back information, alignment and structure |
|---|
| >d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} | Back information, alignment and structure |
|---|
| >d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} | Back information, alignment and structure |
|---|
| >d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} | Back information, alignment and structure |
|---|
| >d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} | Back information, alignment and structure |
|---|
| >d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} | Back information, alignment and structure |
|---|
| >d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} | Back information, alignment and structure |
|---|
| >d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} | Back information, alignment and structure |
|---|
| >d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} | Back information, alignment and structure |
|---|
| >d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} | Back information, alignment and structure |
|---|
| >d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} | Back information, alignment and structure |
|---|
| >d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} | Back information, alignment and structure |
|---|
| >d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} | Back information, alignment and structure |
|---|
| >d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} | Back information, alignment and structure |
|---|
| >d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} | Back information, alignment and structure |
|---|
| >d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} | Back information, alignment and structure |
|---|
| >d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} | Back information, alignment and structure |
|---|
| >d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} | Back information, alignment and structure |
|---|
| >d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} | Back information, alignment and structure |
|---|
| >d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} | Back information, alignment and structure |
|---|
| >d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} | Back information, alignment and structure |
|---|
| >d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} | Back information, alignment and structure |
|---|
| >d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} | Back information, alignment and structure |
|---|
| >d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} | Back information, alignment and structure |
|---|
| >d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} | Back information, alignment and structure |
|---|
| >d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} | Back information, alignment and structure |
|---|
| >d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} | Back information, alignment and structure |
|---|
| >d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} | Back information, alignment and structure |
|---|
| >d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} | Back information, alignment and structure |
|---|
| >d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} | Back information, alignment and structure |
|---|
| >d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} | Back information, alignment and structure |
|---|
| >d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} | Back information, alignment and structure |
|---|
| >d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} | Back information, alignment and structure |
|---|
| >d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} | Back information, alignment and structure |
|---|
| >d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} | Back information, alignment and structure |
|---|
| >d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} | Back information, alignment and structure |
|---|
| >d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} | Back information, alignment and structure |
|---|
| >d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1cyxa_ b.6.1.2 (A:) Quinol oxidase (CyoA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3dtub1 b.6.1.2 (B:130-281) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|