Citrus Sinensis ID: 016892

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-

MGISWSNRRRNNHHHHQFLAPPPPPPPPPLPPYQEPTLYAATNPPPPPAPHPYHPPHAPYPVPPPQPPPQAPVNPYYYHSHGYNSCGYPNPMMGRFSYQFQYQPPYYANQAHGWPAAARQSQVGPPPPYVDHQSAKKVRNDVNVHKHTLKIEVDEENPDHVLVSFVFDALFDGSITVFYFAKEEPNCKFVPLFPEAYMPAKIPFKKGLGQKFRQPSGTGIDLGFYELDDLSKPSLGEDIFPLVISAETHQPSSSNDGHLDDPVSNTSAHMQITQAVLEKNNDDLFQVKVIRQILWVDGVRYELREIYGIGNSAAEGFEDSDPGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPIEELIEIKINSGDQ

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEECccEEEcccEEEEEccccccCEEEEEEEEccccEEEEEEEEEEEcccccccccccccccccEEEcccccccEEEcccccccccccccccccccccccccCEEEEEEEEEEcccccccccccccccccccEEEEEEEEEEEcccccEEEEEEEEEEEEccEEEEEEEEEcccccccccccccccccccEEEEccccccEEEccccccccHHHHHHHHHccccccccccHHHHHEEEEcccccc

*************************************************************************NPYYYHSHGYNSCGYPNPMMGRFSYQFQYQPPYYANQAHGWP****************HQSAKKVRNDVNVHKHTLKIEVDEENPDHVLVSFVFDALFDGSITVFYFAKEEPNCKFVPLFPEAYMPAKIPFKKGLGQKFRQPSGTGIDLGFYELDDLSKPSLGEDIFPLVISAET*****************TSAHMQITQAVLEKNNDDLFQVKVIRQILWVDGVRYELREIYGIGNS*********PGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPIEELIEIKI*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable E3 ubiquitin-protein ligase LUL4	Acts as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates (in vitro).	probable	Q8LA32

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EA5, chain A
Confidence level:very confident
Coverage over the Query: 318-380
View the alignment between query and template
View the model in PyMOL

Template: 3K1L, chain B
Confidence level:probable
Coverage over the Query: 300-371
View the alignment between query and template
View the model in PyMOL

Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 140-222
View the alignment between query and template
View the model in PyMOL