Citrus Sinensis ID: 016892

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-
MGISWSNRRRNNHHHHQFLAPPPPPPPPPLPPYQEPTLYAATNPPPPPAPHPYHPPHAPYPVPPPQPPPQAPVNPYYYHSHGYNSCGYPNPMMGRFSYQFQYQPPYYANQAHGWPAAARQSQVGPPPPYVDHQSAKKVRNDVNVHKHTLKIEVDEENPDHVLVSFVFDALFDGSITVFYFAKEEPNCKFVPLFPEAYMPAKIPFKKGLGQKFRQPSGTGIDLGFYELDDLSKPSLGEDIFPLVISAETHQPSSSNDGHLDDPVSNTSAHMQITQAVLEKNNDDLFQVKVIRQILWVDGVRYELREIYGIGNSAAEGFEDSDPGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPIEELIEIKINSGDQ
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccEEEcccEEEEEccccccEEEEEEEEEccccEEEEEEEEEEEcccccccccccccccccEEEcccccccEEEcccccccccccccccccccccccccEEEEEEEEEEEcccccccccccccccccccEEEEEEEEEEEcccccEEEEEEEEEEEEccEEEEEEEEEcccccccccccccccccccEEEEccccccEEEccccccccHHHHHHHHHcccccccccHHHHHHEEEEcccccc
ccccccccccccHHcccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccEEEEccEEEEEEcccccccEEEEEEEEccccEEEEEEEEEEEccccccEEcccccccccEEEccccccEEEEccccccccHcHccHHHHcccccccccEEEEEEEEEEcccccccccccccccccccccEEEEEEEEEcccccEEEEEEEEEEEEccEEEEEEEEEEEcccccccccccccccEEEEEEcccccEEEEccccHEccHHHHHHHHHHHccccccccHHHHHHEEEEccccc
mgiswsnrrrnnhhhhqflappppppppplppyqeptlyaatnpppppaphpyhpphapypvpppqpppqapvnpyyyhshgynscgypnpmmgrfsyqfqyqppyyanqahgwpaaarqsqvgppppyvdhqsakkvrndvnvhkhtlkievdeenpdhVLVSFVFDALFDGSITVFYfakeepnckfvplfpeaympakipfkkglgqkfrqpsgtgidlgfyelddlskpslgedifplvisaethqpsssndghlddpvsntsAHMQITQAVLEKNNDDLFQVKVIRQILWVDGVRYELREIYgignsaaegfedsdpgkecvicmtepkdtavlpcrhmcmcgecakelrlqsnkcpicrqPIEELIEIKINSGDQ
mgiswsnrrrNNHHHHQFLAPPPPPPPPPLPPYQEPTLYAATNPPPPPAPHPYHPPHAPYPVPPPQPPPQAPVNPYYYHSHGYNSCGYPNPMMGRFSYQFQYQPPYYANQAHGWPAAARQSQVGPPPPYVDHQSAKKVRNDVNVHKHTLkievdeenpdHVLVSFVFDALFDGSITVFYFAKEEPNCKFVPLFPEAYMPAKIPFKKGLGQKFRQPSGTGIDLGFYELDDLSKPSLGEDIFPLVISAETHQPSSSNDGHLDDPVSNTSAHMQITQAVLeknnddlfqVKVIRQILWVDGVRYELREIYGIgnsaaegfedsdPGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPIEELieikinsgdq
MGISWSnrrrnnhhhhQFLAppppppppplppYQEPTLYAATnpppppaphpyhpphapypvpppqpppqapvnpyyyHSHGYNSCGYPNPMMGRFSyqfqyqppyyanqaHGWPAAARQSQVGPPPPYVDHQSAKKVRNDVNVHKHTLKIEVDEENPDHVLVSFVFDALFDGSITVFYFAKEEPNCKFVPLFPEAYMPAKIPFKKGLGQKFRQPSGTGIDLGFYELDDLSKPSLGEDIFPLVISAETHQPSSSNDGHLDDPVSNTSAHMQITQAVLEKNNDDLFQVKVIRQILWVDGVRYELREIYGIGNSAAEGFEDSDPGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPIEELIEIKINSGDQ
*************************************************************************NPYYYHSHGYNSCGYPNPMMGRFSYQFQYQPPYYANQAHGWP**************************VNVHKHTLKIEVDEENPDHVLVSFVFDALFDGSITVFYFAKEEPNCKFVPLFPEAYMPAKIPFKKGLGQKFRQPSGTGIDLGFYELDDLSKPSLGEDIFPLVI***************************ITQAVLEKNNDDLFQVKVIRQILWVDGVRYELREIYGIGNSAAEGFE***PGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPIEELIEIKI*****
*********************************************************************************************************YYANQAHGWP****************HQSAKKVRNDVNVHKHTLKIEVDEENPDHVLVSFVFDALFDGSITVFYFAKEEPNCKFVPLFPEAYMP*KIPFKKGLGQKFRQPSGTGIDLGFYELDDLSKPSLGEDIFPLVISAET*****************TSAHMQITQAVLEKNNDDLFQVKVIRQILWVDGVRYELREIYGIGN**********PGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPIEELI**K******
MGISWSNRRRNNHHHHQFLAPPPPPPPPPLPPYQEPTLYAATNPPPPPAPHPYHPPHAPYPVPPPQPPPQAPVNPYYYHSHGYNSCGYPNPMMGRFSYQFQYQPPYYANQAHGWPAAARQSQVGPPPPYVDHQSAKKVRNDVNVHKHTLKIEVDEENPDHVLVSFVFDALFDGSITVFYFAKEEPNCKFVPLFPEAYMPAKIPFKKGLGQKFRQPSGTGIDLGFYELDDLSKPSLGEDIFPLVISAET*************PVSNTSAHMQITQAVLEKNNDDLFQVKVIRQILWVDGVRYELREIYGIGNSAAEGFEDSDPGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPIEELIEIKINSGDQ
***************HQFLAPPPPPPPPPLPPYQEPTLYAATNPPPPPAPHPYHPPHAPYPVPPPQPPPQAPVNPYYYHSHGYNSCGYPNPMMGRFSYQFQYQPPYYANQAHGWPAAARQSQVGPPPPYVDHQSAKKVRNDVNVHKHTLKIEVDEENPDHVLVSFVFDALFDGSITVFYFAKEEPNCKFVPLFPEAYMPAKIPFKKGLGQKFRQPSGTGIDLGFYELDDLSKPSLGEDIFPLVISAETHQPS**************SAHMQITQAVLEKNNDDLFQVKVIRQILWVDGVRYELREIYGIGNS*********PGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPIEELIEIKIN****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGISWSNRRRNNHHHHQFLAPPPPPPPPPLPPYQEPTLYAATNPPPPPAPHPYHPPHAPYPVPPPQPPPQAPVNPYYYHSHGYNSCGYPNPMMGRFSYQFQYQPPYYANQAHGWPAAARQSQVGPPPPYVDHQSAKKVRNDVNVHKHTLKIEVDEENPDHVLVSFVFDALFDGSITVFYFAKEEPNCKFVPLFPEAYMPAKIPFKKGLGQKFRQPSGTGIDLGFYELDDLSKPSLGEDIFPLVISAETHQPSSSNDGHLDDPVSNTSAHMQITQAVLEKNNDDLFQVKVIRQILWVDGVRYELREIYGIGNSAAEGFEDSDPGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPIEELIEIKINSGDQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query381 2.2.26 [Sep-21-2011]
Q8LA32359 Probable E3 ubiquitin-pro yes no 0.740 0.785 0.595 6e-94
Q84ME1378 Probable E3 ubiquitin-pro no no 0.732 0.738 0.562 6e-91
Q9S752388 Probable E3 ubiquitin-pro no no 0.624 0.613 0.479 1e-67
Q9LFH6299 Probable E3 ubiquitin-pro no no 0.713 0.909 0.448 6e-66
Q9LYW5337 Probable E3 ubiquitin-pro no no 0.727 0.821 0.430 1e-61
O60291 552 E3 ubiquitin-protein liga yes no 0.616 0.425 0.337 2e-31
Q96PX1 679 RING finger protein 157 O no no 0.611 0.343 0.330 3e-31
Q9D074 532 E3 ubiquitin-protein liga yes no 0.606 0.434 0.343 4e-31
Q6INH1 674 RING finger protein 157 O N/A no 0.595 0.336 0.334 5e-31
Q5XIQ4 533 E3 ubiquitin-protein liga no no 0.606 0.433 0.339 1e-30
>sp|Q8LA32|LUL4_ARATH Probable E3 ubiquitin-protein ligase LUL4 OS=Arabidopsis thaliana GN=LUL4 PE=2 SV=1 Back     alignment and function desciption
 Score =  344 bits (883), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 184/309 (59%), Positives = 222/309 (71%), Gaps = 27/309 (8%)

Query: 84  NSCGYPNPMMGRFSYQFQYQPPYYANQA--HGWPAAAR-------QSQVGPPPPYVDHQS 134
           NSC Y +       Y +  QPP Y   A  + W    R       Q Q  PP PY++ Q+
Sbjct: 65  NSCSYGH-------YHYHPQPPQYFTTAQPNWWGPMMRPAYYCPPQPQTQPPKPYLEQQN 117

Query: 135 AKKVRNDVNVHKHTLKIEVDEENPDHVLVSFVFDALFDGSITVFYFAKEEPNCKFVPLFP 194
           AKKVRNDVNVH+ T+++EVD+  P H LVSFVFDALFDGS T+ +FAKEEPNC  +P FP
Sbjct: 118 AKKVRNDVNVHRDTVRLEVDDLVPGHHLVSFVFDALFDGSFTITFFAKEEPNCTIIPQFP 177

Query: 195 EAYMPAKIPFKKGLGQKFRQPSGTGIDLGFYELDDLSKPSLGEDIFPLVISAET-HQPSS 253
           E Y P +  F+KG GQKF QPSGTG DL F+ LDDLSKP L ED++PLVISAET   P+S
Sbjct: 178 EVYSPTRFHFQKGPGQKFLQPSGTGTDLSFFVLDDLSKP-LEEDVYPLVISAETIISPNS 236

Query: 254 SNDGHLDDPVSNTSAHMQITQAVLEKNNDDLFQVKVIRQILWVDGVRYELREIYG-IGNS 312
            ++         +S H Q+TQAVLEK+ND  F+VKV++QILW++GVRYELRE+YG     
Sbjct: 237 ISE--------QSSVHKQVTQAVLEKDNDGSFKVKVVKQILWIEGVRYELRELYGSTTQG 288

Query: 313 AAEGFEDSDPGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPIEELI 372
           AA G ++S  G ECVICMTE KDTAVLPCRH+CMC +CAKELRLQSNKCPICRQPIEEL+
Sbjct: 289 AASGLDESGSGTECVICMTEAKDTAVLPCRHLCMCSDCAKELRLQSNKCPICRQPIEELL 348

Query: 373 EIKINSGDQ 381
           EIK+NS D+
Sbjct: 349 EIKMNSSDE 357
Acts as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates (in vitro).
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q84ME1|LUL3_ARATH Probable E3 ubiquitin-protein ligase LUL3 OS=Arabidopsis thaliana GN=LUL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9S752|LOFG2_ARATH Probable E3 ubiquitin-protein ligase LOG2 OS=Arabidopsis thaliana GN=LOG2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LFH6|LUL2_ARATH Probable E3 ubiquitin-protein ligase LUL2 OS=Arabidopsis thaliana GN=LUL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYW5|LUL1_ARATH Probable E3 ubiquitin-protein ligase LUL1 OS=Arabidopsis thaliana GN=LUL1 PE=1 SV=1 Back     alignment and function description
>sp|O60291|MGRN1_HUMAN E3 ubiquitin-protein ligase MGRN1 OS=Homo sapiens GN=MGRN1 PE=1 SV=2 Back     alignment and function description
>sp|Q96PX1|RN157_HUMAN RING finger protein 157 OS=Homo sapiens GN=RNF157 PE=1 SV=3 Back     alignment and function description
>sp|Q9D074|MGRN1_MOUSE E3 ubiquitin-protein ligase MGRN1 OS=Mus musculus GN=Mgrn1 PE=1 SV=2 Back     alignment and function description
>sp|Q6INH1|RN157_XENLA RING finger protein 157 OS=Xenopus laevis GN=rnf157 PE=2 SV=1 Back     alignment and function description
>sp|Q5XIQ4|MGRN1_RAT E3 ubiquitin-protein ligase MGRN1 OS=Rattus norvegicus GN=Mgrn1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query381
255552223378 mahogunin, putative [Ricinus communis] g 0.776 0.783 0.719 1e-127
225432532 563 PREDICTED: uncharacterized protein LOC10 0.963 0.651 0.643 1e-126
297736983351 unnamed protein product [Vitis vinifera] 0.808 0.877 0.723 1e-124
449433345 574 PREDICTED: uncharacterized protein LOC10 0.984 0.653 0.606 1e-122
224107223375 predicted protein [Populus trichocarpa] 0.761 0.773 0.701 1e-119
224100325312 predicted protein [Populus trichocarpa] 0.653 0.798 0.784 1e-111
356555624373 PREDICTED: RING finger protein 157-like 0.779 0.796 0.653 1e-111
356548999371 PREDICTED: RING finger protein 157-like 0.958 0.983 0.597 1e-111
365222894363 Hop-interacting protein THI037 [Solanum 0.753 0.790 0.600 1e-100
359487780 660 PREDICTED: uncharacterized protein LOC10 0.664 0.383 0.665 2e-94
>gi|255552223|ref|XP_002517156.1| mahogunin, putative [Ricinus communis] gi|223543791|gb|EEF45319.1| mahogunin, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 221/307 (71%), Positives = 255/307 (83%), Gaps = 11/307 (3%)

Query: 78  YHSHGYNSCGYPNPMMGRFSYQFQYQPPYYANQAHGWPAA---ARQSQVGPPPPYVDHQS 134
           Y+SH Y+SC Y N        +F YQP YY+NQA+GWP         Q   P PY++HQ+
Sbjct: 80  YYSHPYHSCNYAN--------RFNYQPFYYSNQANGWPPVRPNVGSGQQIEPAPYIEHQN 131

Query: 135 AKKVRNDVNVHKHTLKIEVDEENPDHVLVSFVFDALFDGSITVFYFAKEEPNCKFVPLFP 194
           AKKVRNDVNVHK TLK+E+D++NPD  LVSFVFDALFDGSIT+FYFAKEE NC+F+P+FP
Sbjct: 132 AKKVRNDVNVHKDTLKVEIDDQNPDTYLVSFVFDALFDGSITIFYFAKEEANCRFIPVFP 191

Query: 195 EAYMPAKIPFKKGLGQKFRQPSGTGIDLGFYELDDLSKPSLGEDIFPLVISAETHQPSSS 254
           EA+ P +IPF+KGLGQKF QPSGTGIDLGF+ELDDLSKPS GED+FPLVI AET     S
Sbjct: 192 EAHTPVRIPFQKGLGQKFCQPSGTGIDLGFFELDDLSKPSPGEDVFPLVIVAETCSAILS 251

Query: 255 NDGHLDDPVSNTSAHMQITQAVLEKNNDDLFQVKVIRQILWVDGVRYELREIYGIGNSAA 314
            + H++D  SNT+ HMQIT AVLEK N+D FQV+VI+QILW+DGVRYELRE+YGIG+SAA
Sbjct: 252 ANEHVEDSGSNTTNHMQITLAVLEKKNNDPFQVRVIKQILWIDGVRYELRELYGIGSSAA 311

Query: 315 EGFEDSDPGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPIEELIEI 374
           E F D DPGKECVICMTEPKDTAVLPCRHMCMC +CAKELRLQSNKCPICRQPI+ELIEI
Sbjct: 312 EDFNDCDPGKECVICMTEPKDTAVLPCRHMCMCSDCAKELRLQSNKCPICRQPIDELIEI 371

Query: 375 KINSGDQ 381
           KIN+GDQ
Sbjct: 372 KINNGDQ 378

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225432532|ref|XP_002277630.1| PREDICTED: uncharacterized protein LOC100266660 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736983|emb|CBI26184.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449433345|ref|XP_004134458.1| PREDICTED: uncharacterized protein LOC101203938 [Cucumis sativus] gi|449521981|ref|XP_004168007.1| PREDICTED: uncharacterized LOC101203938 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224107223|ref|XP_002314412.1| predicted protein [Populus trichocarpa] gi|222863452|gb|EEF00583.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224100325|ref|XP_002311832.1| predicted protein [Populus trichocarpa] gi|222851652|gb|EEE89199.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356555624|ref|XP_003546130.1| PREDICTED: RING finger protein 157-like [Glycine max] Back     alignment and taxonomy information
>gi|356548999|ref|XP_003542886.1| PREDICTED: RING finger protein 157-like [Glycine max] Back     alignment and taxonomy information
>gi|365222894|gb|AEW69799.1| Hop-interacting protein THI037 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|359487780|ref|XP_003633650.1| PREDICTED: uncharacterized protein LOC100852866 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query381
TAIR|locus:2082440359 LUL4 "LOG2-LIKE UBIQUITIN LIGA 0.664 0.704 0.651 9.3e-91
TAIR|locus:2179594378 LUL3 "LOG2-LIKE UBIQUITIN LIGA 0.648 0.653 0.623 2.7e-88
TAIR|locus:2075069388 LOG2 "LOSS OF GDU 2" [Arabidop 0.687 0.675 0.505 3e-69
TAIR|locus:2084026299 LUL2 "LOG2-LIKE UBIQUITIN LIGA 0.656 0.836 0.469 7.9e-62
TAIR|locus:2143493337 LUL1 "LOG2-LIKE UBIQUITIN LIGA 0.622 0.703 0.486 3.2e-58
UNIPROTKB|K7EIM7332 MGRN1 "E3 ubiquitin-protein li 0.619 0.710 0.359 3.7e-32
UNIPROTKB|E9PB19 531 MGRN1 "E3 ubiquitin-protein li 0.619 0.444 0.359 5.9e-32
UNIPROTKB|E1C804 536 MGRN1 "Uncharacterized protein 0.622 0.442 0.356 2.4e-31
UNIPROTKB|F1PG71 515 MGRN1 "Uncharacterized protein 0.614 0.454 0.357 5e-31
UNIPROTKB|O60291 552 MGRN1 "E3 ubiquitin-protein li 0.616 0.425 0.362 5.1e-31
TAIR|locus:2082440 LUL4 "LOG2-LIKE UBIQUITIN LIGASE4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 905 (323.6 bits), Expect = 9.3e-91, P = 9.3e-91
 Identities = 172/264 (65%), Positives = 207/264 (78%)

Query:   120 QSQVGPPPPYVDHQSAKKVRNDVNVHKHTLKIEVDEENPDHVLVSFVFDALFDGSITVFY 179
             Q Q  PP PY++ Q+AKKVRNDVNVH+ T+++EVD+  P H LVSFVFDALFDGS T+ +
Sbjct:   103 QPQTQPPKPYLEQQNAKKVRNDVNVHRDTVRLEVDDLVPGHHLVSFVFDALFDGSFTITF 162

Query:   180 FAKEEPNCKFVPLFPEAYMPAKIPFKKGLGQKFRQPSGTGIDLGFYELDDLSKPSLGEDI 239
             FAKEEPNC  +P FPE Y P +  F+KG GQKF QPSGTG DL F+ LDDLSKP L ED+
Sbjct:   163 FAKEEPNCTIIPQFPEVYSPTRFHFQKGPGQKFLQPSGTGTDLSFFVLDDLSKP-LEEDV 221

Query:   240 FPLVISAETH-QPSSSNDGHLDDPVSNTSAHMQITQAVLEKNNDDLFQVKVIRQILWVDG 298
             +PLVISAET   P+S ++         +S H Q+TQAVLEK+ND  F+VKV++QILW++G
Sbjct:   222 YPLVISAETIISPNSISE--------QSSVHKQVTQAVLEKDNDGSFKVKVVKQILWIEG 273

Query:   299 VRYELREIYG-IGNSAAEGFEDSDPGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQ 357
             VRYELRE+YG     AA G ++S  G ECVICMTE KDTAVLPCRH+CMC +CAKELRLQ
Sbjct:   274 VRYELRELYGSTTQGAASGLDESGSGTECVICMTEAKDTAVLPCRHLCMCSDCAKELRLQ 333

Query:   358 SNKCPICRQPIEELIEIKINSGDQ 381
             SNKCPICRQPIEEL+EIK+NS D+
Sbjct:   334 SNKCPICRQPIEELLEIKMNSSDE 357
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
TAIR|locus:2179594 LUL3 "LOG2-LIKE UBIQUITIN LIGASE3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075069 LOG2 "LOSS OF GDU 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084026 LUL2 "LOG2-LIKE UBIQUITIN LIGASE2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143493 LUL1 "LOG2-LIKE UBIQUITIN LIGASE1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|K7EIM7 MGRN1 "E3 ubiquitin-protein ligase MGRN1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PB19 MGRN1 "E3 ubiquitin-protein ligase MGRN1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C804 MGRN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PG71 MGRN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O60291 MGRN1 "E3 ubiquitin-protein ligase MGRN1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LA32LUL4_ARATH6, ., 3, ., 2, ., -0.59540.74010.7855yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query381
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 2e-19
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-11
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 1e-09
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-09
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-07
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 7e-07
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 2e-06
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 3e-06
pfam04652315 pfam04652, DUF605, Vta1 like 4e-06
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 9e-06
smart0018440 smart00184, RING, Ring finger 2e-05
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 3e-05
PRK00404141 PRK00404, tatB, sec-independent translocase; Provi 6e-05
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 7e-05
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 8e-05
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-04
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 2e-04
pfam04652315 pfam04652, DUF605, Vta1 like 2e-04
pfam04652315 pfam04652, DUF605, Vta1 like 2e-04
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-04
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 2e-04
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 4e-04
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 4e-04
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 5e-04
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 6e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 6e-04
PRK06975656 PRK06975, PRK06975, bifunctional uroporphyrinogen- 7e-04
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 8e-04
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 8e-04
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 8e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 9e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 9e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
PLN02983274 PLN02983, PLN02983, biotin carboxyl carrier protei 0.001
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.001
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.001
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 0.001
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.001
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 0.001
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 0.002
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.002
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.002
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.002
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 0.002
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.002
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 0.002
TIGR02927579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 0.002
TIGR02927579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 0.002
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 0.002
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.002
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 0.002
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.002
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 0.002
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.002
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.003
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.003
pfam04652315 pfam04652, DUF605, Vta1 like 0.003
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.003
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.003
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.003
pfam03276582 pfam03276, Gag_spuma, Spumavirus gag protein 0.003
PRK14963504 PRK14963, PRK14963, DNA polymerase III subunits ga 0.003
PHA03282540 PHA03282, PHA03282, envelope glycoprotein E; Provi 0.003
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 0.004
pfam05044908 pfam05044, Prox1, Homeobox prospero-like protein ( 0.004
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information 
 Score = 80.5 bits (199), Expect = 2e-19
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 1/47 (2%)

Query: 324 KECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPIEE 370
             CVIC+  P++   LPC H+C+C ECAK LR    KCPICRQPIE 
Sbjct: 3   DLCVICLERPRNVVFLPCGHLCLCEECAKRLR-SKKKCPICRQPIES 48

Length = 49
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|165539 PHA03282, PHA03282, envelope glycoprotein E; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|218397 pfam05044, Prox1, Homeobox prospero-like protein (PROX1) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 381
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.31
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 99.29
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 98.94
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.89
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 98.85
PHA02929238 N1R/p28-like protein; Provisional 98.82
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.8
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.77
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 98.7
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.68
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 98.67
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.48
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.48
PHA02926242 zinc finger-like protein; Provisional 98.47
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.45
PF1463444 zf-RING_5: zinc-RING finger domain 98.36
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.33
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.33
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.31
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.31
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.26
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 98.23
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.23
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.21
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.2
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.13
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.12
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.0
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 98.0
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.97
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.92
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.87
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.83
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.73
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.72
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.69
COG5236 493 Uncharacterized conserved protein, contains RING Z 97.56
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.53
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.48
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.43
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.37
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.31
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.15
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.14
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.92
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.78
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 96.54
COG5152259 Uncharacterized conserved protein, contains RING a 96.29
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.23
COG52191525 Uncharacterized conserved protein, contains RING Z 96.01
KOG0297 391 consensus TNF receptor-associated factor [Signal t 95.87
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.77
KOG0825 1134 consensus PHD Zn-finger protein [General function 95.74
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.63
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.38
KOG2660 331 consensus Locus-specific chromosome binding protei 95.32
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 95.01
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 94.91
PF04641260 Rtf2: Rtf2 RING-finger 94.84
KOG4367 699 consensus Predicted Zn-finger protein [Function un 94.84
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 94.84
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 94.43
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.25
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 94.11
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 93.98
KOG4739 233 consensus Uncharacterized protein involved in syna 93.79
KOG1002 791 consensus Nucleotide excision repair protein RAD16 93.48
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 93.36
COG5175 480 MOT2 Transcriptional repressor [Transcription] 93.32
KOG2113394 consensus Predicted RNA binding protein, contains 93.16
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 93.06
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 92.68
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 92.64
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 92.59
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 92.51
KOG4445 368 consensus Uncharacterized conserved protein, conta 92.07
PHA02825162 LAP/PHD finger-like protein; Provisional 91.84
KOG3002 299 consensus Zn finger protein [General function pred 91.5
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 90.66
COG5222427 Uncharacterized conserved protein, contains RING Z 90.41
PHA03096284 p28-like protein; Provisional 90.33
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 89.9
KOG149384 consensus Anaphase-promoting complex (APC), subuni 89.78
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 88.84
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 88.7
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 88.34
KOG3799169 consensus Rab3 effector RIM1 and related proteins, 87.94
PF10272358 Tmpp129: Putative transmembrane protein precursor; 87.01
PHA02862156 5L protein; Provisional 86.82
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 86.75
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 85.93
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 85.81
KOG4672487 consensus Uncharacterized conserved low complexity 85.24
KOG2113 394 consensus Predicted RNA binding protein, contains 85.15
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 81.65
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=4.2e-61  Score=468.53  Aligned_cols=246  Identities=52%  Similarity=0.928  Sum_probs=223.3

Q ss_pred             CCCCCCccccccceeeeeeeeccCCceeEEEcCCCCceeceEEeeeccccceEEEEEeeecCCCCCcccCCCCCCCCcee
Q 016892          123 VGPPPPYVDHQSAKKVRNDVNVHKHTLKIEVDEENPDHVLVSFVFDALFDGSITVFYFAKEEPNCKFVPLFPEAYMPAKI  202 (381)
Q Consensus       123 ~~~~~~~v~~q~t~tirn~VNlrK~SLrl~~~~~~p~~y~v~FtFDa~~~~sItI~f~a~E~~~~~~~~~~~~~~~~~t~  202 (381)
                      ..++.+|+ ||+|+||||+||++|++++++.|..+++.|+++|+|||+..|+|||+|||||+..|.++.+.+..+.++|+
T Consensus       100 ~~~~~~~~-~~~av~i~~d~~l~k~~~~l~~d~~~P~~~~~sf~fda~~~g~itV~~fakE~~~c~~~~~~~~~~~~~t~  178 (349)
T KOG4265|consen  100 CAPPDQYL-HQKAVTIRNDVNLDKETLRLDPDPLTPGLLLLSFTFDALAQGAITVLFFAKEEVLCGLVLLVPDELPSITV  178 (349)
T ss_pred             ecCCCccc-cccceeccchhhcccceEEeccCCCCcceeEEEEEeccccCccEEEEEeccccccccccccccccCCCeeE
Confidence            35566799 99999999999999999999999999999999999999999999999999999999999888877899999


Q ss_pred             ecCCccCCeeeCCCCCCcCCCCcCcccCCCCCCCCCceeeEEEeeecCCCCCCCCCCCCCCCCCccchhHHHHHHHhcCC
Q 016892          203 PFKKGLGQKFRQPSGTGIDLGFYELDDLSKPSLGEDIFPLVISAETHQPSSSNDGHLDDPVSNTSAHMQITQAVLEKNND  282 (381)
Q Consensus       203 ~F~~Gl~Q~F~qps~~~idl~~~~~~eL~~~~~~~~~~PLvi~~e~~~~~~~~~~~~~~~~~~~~~~~qit~a~~ek~~~  282 (381)
                      +|++|++|+|.|++ ++||++.|+++||.+.. ++++|||+|++++...+.   .      .....+.++|+++.++.++
T Consensus       179 ~f~~gl~Q~F~q~s-~~~D~~~~~~~~L~~~~-~~~vyplsi~~~~~~~~~---~------~~~~~~~~~tq~v~~~~~~  247 (349)
T KOG4265|consen  179 HFEKGLGQLFLQPS-TGIDFSVMSIDDLSLSL-DRRVYPLSISAEVQPSDV---V------ESMGVFHVITQAVYEKDEK  247 (349)
T ss_pred             EcccchhhhhcCCc-cccchhhcchhhhcccc-cCCeeeEEEEEEEecccc---c------cccceeeEEEeeeeccCcC
Confidence            99999999999999 99999999999999965 899999999999984321   1      2234578899999988889


Q ss_pred             chhHHHHHhhhhhcCCchhhhHHHhhCCCCCCCCC--CCCCCCCcceecccCCcCeEEeCCCCccccHHHHHHHHhCCCC
Q 016892          283 DLFQVKVIRQILWVDGVRYELREIYGIGNSAAEGF--EDSDPGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNK  360 (381)
Q Consensus       283 ~~~~v~v~kq~l~v~g~~~el~ei~g~~~s~~~~~--~~~~~~~~CvICl~~~~d~vlLPCgH~cfC~~Ca~~l~~~s~~  360 (381)
                      |.+.++++||++|++|.+|+|+||||++++..+..  ++.+++++|||||++.+|+++|||||+|+|++|++.|+.+.++
T Consensus       248 G~~~~~~~kQ~~~v~g~~y~LqEiyGien~~v~~~~~~~~~~gkeCVIClse~rdt~vLPCRHLCLCs~Ca~~Lr~q~n~  327 (349)
T KOG4265|consen  248 GSIKIKVLKQILWVDGTRYLLQEIYGIENSTVEGTDADESESGKECVICLSESRDTVVLPCRHLCLCSGCAKSLRYQTNN  327 (349)
T ss_pred             CceeeeeeeeEEEEeCceeeeehhhccccCCCCCCccccccCCCeeEEEecCCcceEEecchhhehhHhHHHHHHHhhcC
Confidence            99999999999999999999999999997764432  2446789999999999999999999999999999999999999


Q ss_pred             CccccccccceEEEEcCCCC
Q 016892          361 CPICRQPIEELIEIKINSGD  380 (381)
Q Consensus       361 CPiCR~~I~~~i~I~i~~~~  380 (381)
                      |||||+.|+++++|+++.++
T Consensus       328 CPICRqpi~~ll~i~~~~~~  347 (349)
T KOG4265|consen  328 CPICRQPIEELLEIYVNKED  347 (349)
T ss_pred             CCccccchHhhheecccccc
Confidence            99999999999999998765

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3799 consensus Rab3 effector RIM1 and related proteins, contain Rab3a binding domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG4672 consensus Uncharacterized conserved low complexity protein [Function unknown] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query381
2ea5_A68 Solution Structure Of The Ring Domain Of The Human 4e-06
2vje_A64 Crystal Structure Of The Mdm2-Mdmx Ring Domain Hete 1e-05
2hdp_A63 Solution Structure Of Hdm2 Ring Finger Domain Lengt 1e-05
3eb5_A74 Structure Of The Ciap2 Ring Domain Length = 74 6e-05
3t6p_A345 Iap Antagonist-Induced Conformational Change In Cia 7e-05
2vje_B63 Crystal Structure Of The Mdm2-Mdmx Ring Domain Hete 3e-04
>pdb|2EA5|A Chain A, Solution Structure Of The Ring Domain Of The Human Cell Growth Regulator With Ring Finger Domain 1 Protein Length = 68 Back     alignment and structure 
Iteration: 1

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 37/62 (59%), Gaps = 5/62 (8%)
Query: 310 GNSAAEGFEDSDP-GKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPI 368
           G+S + G E S+   K+CV+C     +  +LPCRH C+C  C K  +    +CP+CRQ +
Sbjct: 1   GSSGSSGVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQ----QCPMCRQFV 56
Query: 369 EE 370
           +E
Sbjct: 57  QE 58
>pdb|2VJE|A Chain A, Crystal Structure Of The Mdm2-Mdmx Ring Domain Heterodimer Length = 64 Back     alignment and structure
>pdb|2HDP|A Chain A, Solution Structure Of Hdm2 Ring Finger Domain Length = 63 Back     alignment and structure
>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 Back     alignment and structure
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure
>pdb|2VJE|B Chain B, Crystal Structure Of The Mdm2-Mdmx Ring Domain Heterodimer Length = 63 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query381
2ea5_A68 Cell growth regulator with ring finger domain prot 3e-25
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 3e-23
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 8e-23
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 2e-20
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 5e-20
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 3e-14
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-11
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 5e-04
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-10
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 5e-10
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 9e-10
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 1e-08
2ecm_A55 Ring finger and CHY zinc finger domain- containing 5e-08
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 1e-07
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-07
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 1e-07
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-07
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 7e-07
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 9e-07
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-06
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 4e-06
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 1e-05
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 1e-05
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 2e-05
2ect_A78 Ring finger protein 126; metal binding protein, st 2e-05
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 3e-05
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 4e-05
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 6e-05
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 8e-05
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 1e-04
1z6u_A150 NP95-like ring finger protein isoform B; structura 1e-04
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-04
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-04
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-04
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 3e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 3e-04
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 4e-04
3oun_A157 Putative uncharacterized protein TB39.8; peptidogl 5e-04
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 5e-04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 6e-04
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 7e-04
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 8e-04
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 8e-04
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
 Score = 96.4 bits (240), Expect = 3e-25
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 5/71 (7%)

Query: 310 GNSAAEGFEDS-DPGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPI 368
           G+S + G E S +  K+CV+C     +  +LPCRH C+C  C K  +    +CP+CRQ +
Sbjct: 1   GSSGSSGVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQ----QCPMCRQFV 56

Query: 369 EELIEIKINSG 379
           +E   +   S 
Sbjct: 57  QESFALSGPSS 67
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query381
2ea5_A68 Cell growth regulator with ring finger domain prot 99.48
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.47
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.45
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.2
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.2
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.19
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.18
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.18
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.15
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.15
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.15
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.1
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.1
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.1
2ect_A78 Ring finger protein 126; metal binding protein, st 99.09
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.08
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.05
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.05
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.04
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.04
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.03
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.02
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.02
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.01
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.01
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.01
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.0
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.0
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.95
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.95
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.94
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.93
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.9
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.86
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.84
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.83
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.83
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.83
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.82
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.82
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.81
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.8
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.79
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.79
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.78
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.76
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.76
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.75
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.75
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.75
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.74
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.74
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.69
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.67
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.61
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.57
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.57
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.53
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.51
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.48
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.44
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.36
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.25
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.23
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.94
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.84
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.8
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.79
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.75
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.75
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.48
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 94.87
3nw0_A238 Non-structural maintenance of chromosomes element 92.24
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 91.73
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 88.76
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.48  E-value=1.4e-14  Score=111.12  Aligned_cols=59  Identities=34%  Similarity=0.871  Sum_probs=51.9

Q ss_pred             CCCCCCCcceecccCCcCeEEeCCCCccccHHHHHHHHhCCCCCccccccccceEEEEcCCCC
Q 016892          318 EDSDPGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPIEELIEIKINSGD  380 (381)
Q Consensus       318 ~~~~~~~~CvICl~~~~d~vlLPCgH~cfC~~Ca~~l~~~s~~CPiCR~~I~~~i~I~i~~~~  380 (381)
                      ...++..+|+||++..++++++||||++||..|+..+    ..||+||+.|..+++|+..+++
T Consensus        10 ~~~~~~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~~----~~CP~CR~~i~~~~~i~~~~sg   68 (68)
T 2ea5_A           10 PSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYF----QQCPMCRQFVQESFALSGPSSG   68 (68)
T ss_dssp             CSCCCSSCCSSSSSSCCCCEETTTTBCCSCTTHHHHC----SSCTTTCCCCCCEECCCSSCCC
T ss_pred             ccCCCCCCCCCcCcCCCCEEEECCCChhhhHHHHhcC----CCCCCCCcchhceEEeecCCCC
Confidence            3445678999999999999999999999999999854    5899999999999999887653
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 381
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-13
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-12
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 6e-10
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-09
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-09
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-07
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 5e-07
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 1e-05
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 7e-05
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 9e-05
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 3e-04
d1jvra_137 a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell 0.004
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 63.5 bits (154), Expect = 1e-13
 Identities = 15/60 (25%), Positives = 22/60 (36%)

Query: 318 EDSDPGKECVICMTEPKDTAVLPCRHMCMCGECAKELRLQSNKCPICRQPIEELIEIKIN 377
           E     + C IC    KD  + PC H+            +   CP CR  I+    I ++
Sbjct: 18  EMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVD 77
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query381
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.13
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.03
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.98
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.92
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.91
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.9
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.86
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.76
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.75
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.72
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.67
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.66
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.62
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.52
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.49
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.53
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 87.17
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.21  E-value=1.9e-12  Score=100.32  Aligned_cols=53  Identities=32%  Similarity=0.735  Sum_probs=46.5

Q ss_pred             CCcceecccCCcCeEEeCCCCccccHHHHHHHHh-CCCCCccccccccceEEEEc
Q 016892          323 GKECVICMTEPKDTAVLPCRHMCMCGECAKELRL-QSNKCPICRQPIEELIEIKI  376 (381)
Q Consensus       323 ~~~CvICl~~~~d~vlLPCgH~cfC~~Ca~~l~~-~s~~CPiCR~~I~~~i~I~i  376 (381)
                      ...|.||++...+.++++|||. ||..|+..|.. ++.+||+||..|...-.|.+
T Consensus        23 ~~~C~IC~~~~~~~~~~~CgH~-fC~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i~i   76 (79)
T d1fbva4          23 FQLCKICAENDKDVKIEPCGHL-MCTSCLTSWQESEGQGCPFCRCEIKGTEPIVV   76 (79)
T ss_dssp             TTBCTTTSSSBCCEECSSSCCE-ECHHHHHHHHHTTCCSCTTTCCCCCCCCCSSC
T ss_pred             CCCCccCCCcCCCeEEeCCCCe-eeHHHHHHHHHHCcCcCCCCCcCccCCceeec
Confidence            3479999999999999999999 99999999986 55789999999998766554
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure