Citrus Sinensis ID: 016905

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380

MFGALHKCCPPSLMTKWLILVIFLNFGHSSREPDVEGEALIEVLKALNDTHGQFTDWNDHFVSPCFSWSHVTCRNGNVISLTLGSNGFSGKISPSITKLKFLASLELQDNDLSGTLPDFLGSMTHLQSLNLANNKFSGSIPATWSQLSNLKHLDLSSNNLTGRIPMQLFSVATFNFTGTHLICGSSLEQPCMSRPSPPVSTSRTKLRIVVASASCGAFVLLSLGALFACRYQKLRKLKHDVFFDVAGEDDCKVSLTQLRRFSCRELQLATDNFSESNIIGQGGFGKVYKGVLSDNTKVAVKRLQDYYSPGGEAAFQREVHLISVAIHKNLLQLIGYCTTSSERILVYPFMQNLSVAYRLRVSHKIYTKIISLSSLHCFSL

cccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccccccccccEEEccccccEEEcccccccCCccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHcccccccEEECcccccEEEEEcccccEEEEEEEcccccccHHHHHHHHHHHHHcccccccccEEEECccccccEEEccccccccHHHHcccccccccccccHHHHHcccc

MFGALHKCCPPSLMTKWLILVIFLNFGHSSREPDVEGEALIEVLKALNDTHGQFTDWNDHFVSPCFSWSHVTCRNGNVISLTLGSNGFSGKISPSITKLKFLASLELQDNDLSGTLPDFLGSMTHLQSLNLANNKFSGSIPATWSQLSNLKHLDLSSNNLTGRIPMQLFSVATFNFTGTHLICGSS******************KLRIVVASASCGAFVLLSLGALFACRYQKLRKLKHDVFFDVAGEDDCKVSLTQLRRFSCRELQLATDNFSESNIIGQGGFGKVYKGVLSDNTKVAVKRLQDYYSPGGEAAFQREVHLISVAIHKNLLQLIGYCTTSSERILVYPFMQNLSVAYRLRVSHKIYTKIISLSSLHCFSL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 96-186
View the alignment between query and template
View the model in PyMOL

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 77-164
View the alignment between query and template
View the model in PyMOL

Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 33-180
View the alignment between query and template
View the model in PyMOL

Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 256-378
View the alignment between query and template
View the model in PyMOL

Template: 2KS1, chain B
Confidence level:probable
Coverage over the Query: 209-235
View the alignment between query and template
View the model in PyMOL