Citrus Sinensis ID: 016931


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380
MRITVMTADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNAEKLSALGVKDEDLVMMVSNAASSPATNNLSFNPDGSAVNPAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDLLRERSRQRSELRRRQEEEMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEVSVPFLQEKDIPSHFLDEERYSKQASSSGTAVTSAAKDKSSNLPAGGGQSSGGTRGNTTQVILLCSIVLSTY
cEEEEEEccccEEEEEEcccccHHHHHHHHHHHHccccccEEEEEccEEccccccccccccccccEEEEEEcccccccccccccccccccccHHHHHHHHHccHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHccccccccEEEEEEEEEEccEEEEEEEccccccccccHHHHHHHccccccccccccccccccccccccEEEEEEEEEccEEEEEEEEEEcccccccHHcHHHHHHccEEEEccccEEEEccccEEEccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccEEEEEEEEcccc
cEEEEEEcccEEEEEEccccccHHHHHHHHHHHccccHHcEEEEEccccccccccHHHcccccccEEEEEEcccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHcEEEEEEEEEEEEcccEEEEEEcccccHEEccHHHHHHcccHHHHHHHHcccEEcccccEEEEEEEEEEEEEcccccccEEEEEccccccEEEHHHHHHHccEEEEccccEEEEccccEEEccccHHHccHHHHHHHHccccccccccccccHcccccccccccccccccccccccccEEEEcHHHHccc
MRITVmtadeqiisldvdphetVENVKALLEVETQVPLQQQQLLyngremnnaeklsalgvkdedlVMMVSNaasspatnnlsfnpdgsavnpaAFQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDLLRERSRQRSELRRRQEEEMALlyadpfdvEAQKKIEAAIRQKGIDENWAAALEHNPEAFARVVMLYVDMevngiplkafvdsgaqstIISKSCAERCGLLRLLddryrgvahgvgqseilgrihvapikignvfypcsfvvldspnmeflFGLDMLRKHQCIIDLkenvlrvgggevsvpflqekdipshfldeeryskqasssgtavtsaakdkssnlpagggqssggtrgnTTQVILLCSIVLSTY
mritvmtadeqiisldvdpheTVENVKALLEVETQVPLQQQQLLYNGREMNNAEKLSALGVKDEDLVMMVSNAASSPATNNLSFNPDGSAVNPAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDLLRERSRQRSELRRRQEEEMallyadpfdveAQKKIEAAIRQKGIDENWAAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLLDDRYRGVAHgvgqseilgrIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEVSVPFLQEKDIPSHFLDEERYSKQASSSGTAVtsaakdkssnlpagggqssggtrgnttqVILLCSIVLSTY
MRITVMTADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNAEKLSALGVKDEDLVMMVSNAASSPATNNLSFNPDGSAVNPAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDllrersrqrselrrrqeeeMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGllrllddrYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEVSVPFLQEKDIPSHFLDEERYSKQasssgtavtsaaKDKSSNLPAgggqssggtrgnttqVILLCSIVLSTY
**********QIISLDVDPHETVENVKALLEVETQVPLQQQQLLYN**********************************************************NLMTQLFQ***ELAQVLLGNDL*************************ALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEVSVPFLQE****************************************************************
MRITVMTADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNAEKLSALGVKDEDLVMMVSN*****************************************************************************************************************HNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLLD**************ILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEVSVPFLQ**********************************************************SIVLSTY
MRITVMTADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNAEKLSALGVKDEDLVMMVSNAASSPATNNLSFNPDGSAVNPAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDLLRERSRQRSELRRRQEEEMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEVSVPFLQEKDIPSHFLDEE**********************************TRGNTTQVILLCSIVLSTY
MRITVMTADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNAEKLSALGVKDEDLVMMVSNAA**************SAVNPAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDLNKLQDLLRERSRQRSELRRRQEEEMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEVSVPFLQEKDIPSHFLDEE****************************************QVILLCSIVLSTY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRITVMTADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNAEKLSALGVKDEDLVMMVSNAASSPATNNLSFNPDGSAVNPAAFQQHIRNDANLMTQLFQSDPELAQVLLGNDxxxxxxxxxxxxxxxxxxxxxxxxEMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEVSVPFLQEKDIPSHFLDEERYSKQASSSGTAVTSAAKDKSSNLPAGGGQSSGGTRGNTTQVILLCSIVLSTY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query380 2.2.26 [Sep-21-2011]
Q0U3Y6442 DNA damage-inducible prot N/A no 0.878 0.755 0.388 1e-67
Q7ZYA7393 Protein DDI1 homolog 2 OS N/A no 0.834 0.806 0.396 5e-65
Q497D6394 Protein DDI1 homolog 2 OS yes no 0.834 0.804 0.392 5e-65
Q2USD7402 DNA damage-inducible prot yes no 0.865 0.818 0.387 1e-64
A1CDT9404 DNA damage-inducible prot N/A no 0.789 0.742 0.405 4e-64
A1DCU5405 DNA damage-inducible prot N/A no 0.892 0.837 0.379 4e-64
Q5TDH0399 Protein DDI1 homolog 2 OS yes no 0.807 0.769 0.382 5e-64
Q4WGS4405 DNA damage-inducible prot yes no 0.860 0.807 0.381 1e-63
A2ADY9399 Protein DDI1 homolog 2 OS yes no 0.810 0.771 0.392 6e-63
Q2T9Z1396 Protein DDI1 homolog 1 OS yes no 0.810 0.777 0.387 7e-63
>sp|Q0U3Y6|DDI1_PHANO DNA damage-inducible protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DDI1 PE=3 SV=2 Back     alignment and function desciption
 Score =  256 bits (655), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 139/358 (38%), Positives = 217/358 (60%), Gaps = 24/358 (6%)

Query: 8   ADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNN-AEKLSALGVKDEDL 66
           +D ++++L++ P  TV+++K  +E ET +P   Q +  NG+ ++   + L  +G++D ++
Sbjct: 15  SDGELLTLELPPGSTVKDLKGFIEAETNLPAASQGIYLNGQPVSQETQTLENVGIRDGEM 74

Query: 67  VMMV---------SNAASSPATNNLSFNPDGSAVNPAAFQQHIRNDANLMTQLFQSDPEL 117
           + ++           AAS PA       P G + +P A +Q +  +  +  +L Q DPEL
Sbjct: 75  LAVIVRQNRQQPQQPAASRPA-------PVGQS-DPEAVRQQVLRNPQVQAELRQRDPEL 126

Query: 118 AQVLLGNDLNKLQDLLRERSRQRSELRRRQEEEMALLYADPFDVEAQKKIEAAIRQKGID 177
             ++  ND ++ ++    R        R ++ ++ALL  DPF+VEAQ+KIE  IRQ+ + 
Sbjct: 127 LAIM--NDADRWREAFASRQNSAQNAERERQNQIALLNEDPFNVEAQRKIEDIIRQERVV 184

Query: 178 ENWAAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLLDD 237
           EN   A   NPE F RV MLY++ EVNG+P+KAFVDSGAQ+TI+S  CAERCG++RL+D 
Sbjct: 185 ENLEKAYNENPEVFVRVHMLYINTEVNGVPVKAFVDSGAQATIMSPDCAERCGIMRLMDT 244

Query: 238 RYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDL 297
           RY G+A GVG + ILGR+H A IKIG    PC+F V++  +++ LFGLDML++++  IDL
Sbjct: 245 RYAGMARGVGTARILGRVHHAEIKIGGAVMPCAFTVMEGKDVDLLFGLDMLKRYKAKIDL 304

Query: 298 KENVLRVGGGEVSVPFLQEKDIPSHFLDEERYSKQASSSGTAVTSAAKDKSSNLPAGG 355
           ++N L      + VPFL E +IP + LDE   + + + +G   T       +  PAGG
Sbjct: 305 EKNALCF--ESIEVPFLHESEIPRN-LDEAEMN-EPTVAGPNGTEIGARSGAVRPAGG 358




Acts as a linker between the 19S proteasome and polyubiquitinated proteins via UBA domain interactions with ubiquitin for their subsequent degradation. Required for S-phase checkpoint control and may be involved in the regulation of exocytosis.
Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (taxid: 321614)
>sp|Q7ZYA7|DDI2_XENLA Protein DDI1 homolog 2 OS=Xenopus laevis GN=ddi2 PE=2 SV=1 Back     alignment and function description
>sp|Q497D6|DDI2_XENTR Protein DDI1 homolog 2 OS=Xenopus tropicalis GN=ddi2 PE=2 SV=1 Back     alignment and function description
>sp|Q2USD7|DDI1_ASPOR DNA damage-inducible protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ddi1 PE=3 SV=2 Back     alignment and function description
>sp|A1CDT9|DDI1_ASPCL DNA damage-inducible protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ddi1 PE=3 SV=1 Back     alignment and function description
>sp|A1DCU5|DDI1_NEOFI DNA damage-inducible protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ddi1 PE=3 SV=1 Back     alignment and function description
>sp|Q5TDH0|DDI2_HUMAN Protein DDI1 homolog 2 OS=Homo sapiens GN=DDI2 PE=1 SV=1 Back     alignment and function description
>sp|Q4WGS4|DDI1_ASPFU DNA damage-inducible protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ddi1 PE=3 SV=1 Back     alignment and function description
>sp|A2ADY9|DDI2_MOUSE Protein DDI1 homolog 2 OS=Mus musculus GN=Ddi2 PE=1 SV=1 Back     alignment and function description
>sp|Q2T9Z1|DDI1_BOVIN Protein DDI1 homolog 1 OS=Bos taurus GN=DDI1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query380
224122096410 predicted protein [Populus trichocarpa] 0.965 0.895 0.853 1e-178
224061633418 predicted protein [Populus trichocarpa] 0.981 0.892 0.834 1e-178
449444008407 PREDICTED: DNA damage-inducible protein 0.963 0.899 0.817 1e-176
449508333407 PREDICTED: DNA damage-inducible protein 0.963 0.899 0.815 1e-176
255579550413 DNA-damage inducible protein ddi1, putat 0.963 0.886 0.839 1e-175
358249254405 uncharacterized protein LOC100782198 [Gl 0.897 0.841 0.835 1e-170
225462066410 PREDICTED: DNA damage-inducible protein 0.921 0.853 0.854 1e-170
334185304413 DNA damage-inducible protein 1 [Arabidop 0.928 0.854 0.806 1e-167
356527193410 PREDICTED: DNA damage-inducible protein 0.876 0.812 0.846 1e-166
18399933414 DNA damage-inducible protein 1 [Arabidop 0.928 0.852 0.804 1e-164
>gi|224122096|ref|XP_002330540.1| predicted protein [Populus trichocarpa] gi|118486011|gb|ABK94849.1| unknown [Populus trichocarpa] gi|222872098|gb|EEF09229.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  631 bits (1628), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 315/369 (85%), Positives = 338/369 (91%), Gaps = 2/369 (0%)

Query: 1   MRITVMTADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNAEKLSALG 60
           MRITVMTADEQIISL+VDPHE+VENVKALLEVETQVPLQQQQLLYNGREM N EKLSALG
Sbjct: 1   MRITVMTADEQIISLEVDPHESVENVKALLEVETQVPLQQQQLLYNGREMRNNEKLSALG 60

Query: 61  VKDEDLVMMVSNAAS-SPATNNLSFNPDGSAVNPAAFQQHIRNDANLMTQLFQSDPELAQ 119
           VKDEDLVMMVSNAA+ S  +NNL  NPDGSA+NP AFQQ +RND+N M QLFQ+DPELAQ
Sbjct: 61  VKDEDLVMMVSNAAALSAPSNNLGLNPDGSAMNPGAFQQQLRNDSNTMAQLFQADPELAQ 120

Query: 120 VLLGNDLNKLQDLLRERSRQRSELRRRQEEEMALLYADPFDVEAQKKIEAAIRQKGIDEN 179
           V+LGNDLNKLQDLLR+R RQRSEL R+QEEE ALL ADPFDVEAQKKIEAAIRQKGIDEN
Sbjct: 121 VILGNDLNKLQDLLRQRHRQRSELHRQQEEEFALLEADPFDVEAQKKIEAAIRQKGIDEN 180

Query: 180 WAAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLLDDRY 239
           WAAALE+NPEAFARV+MLYVDMEVNG+PLKAFVDSGAQSTIISKSCAERCGLLRLLD RY
Sbjct: 181 WAAALEYNPEAFARVIMLYVDMEVNGVPLKAFVDSGAQSTIISKSCAERCGLLRLLDQRY 240

Query: 240 RGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKE 299
           +G+AHGVGQSEILGRIHVAPIKIGN+FYPCSF+VLDSPNMEFLFGLDMLRKHQCIIDLKE
Sbjct: 241 KGIAHGVGQSEILGRIHVAPIKIGNIFYPCSFMVLDSPNMEFLFGLDMLRKHQCIIDLKE 300

Query: 300 NVLRVGGGEVSVPFLQEKDIPSHFLDEERYSKQASSSGTAVTSAAKDKSSNLPAGGGQSS 359
           NVLRVGGGEVSVPFLQEKDIP  FLDEERYSK+ASSSG  VTS   +K ++ PA  GQSS
Sbjct: 301 NVLRVGGGEVSVPFLQEKDIPPRFLDEERYSKEASSSGNPVTSGKAEKKNDPPA-MGQSS 359

Query: 360 GGTRGNTTQ 368
           G  R + TQ
Sbjct: 360 GVARSSVTQ 368




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224061633|ref|XP_002300577.1| predicted protein [Populus trichocarpa] gi|222847835|gb|EEE85382.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449444008|ref|XP_004139767.1| PREDICTED: DNA damage-inducible protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449508333|ref|XP_004163284.1| PREDICTED: DNA damage-inducible protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255579550|ref|XP_002530617.1| DNA-damage inducible protein ddi1, putative [Ricinus communis] gi|223529827|gb|EEF31760.1| DNA-damage inducible protein ddi1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|358249254|ref|NP_001240274.1| uncharacterized protein LOC100782198 [Glycine max] gi|255638715|gb|ACU19662.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225462066|ref|XP_002276099.1| PREDICTED: DNA damage-inducible protein 1 [Vitis vinifera] gi|296090003|emb|CBI39822.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|334185304|ref|NP_001189876.1| DNA damage-inducible protein 1 [Arabidopsis thaliana] gi|332641803|gb|AEE75324.1| DNA damage-inducible protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356527193|ref|XP_003532197.1| PREDICTED: DNA damage-inducible protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|18399933|ref|NP_566451.1| DNA damage-inducible protein 1 [Arabidopsis thaliana] gi|334185306|ref|NP_001189877.1| DNA damage-inducible protein 1 [Arabidopsis thaliana] gi|109134143|gb|ABG25069.1| At3g13235 [Arabidopsis thaliana] gi|110741912|dbj|BAE98897.1| hypothetical protein [Arabidopsis thaliana] gi|332641802|gb|AEE75323.1| DNA damage-inducible protein 1 [Arabidopsis thaliana] gi|332641804|gb|AEE75325.1| DNA damage-inducible protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query380
TAIR|locus:505006342414 DDI1 "DNA-damage inducible 1" 0.928 0.852 0.734 3.3e-134
FB|FBgn0030753458 rngo "rings lost" [Drosophila 0.642 0.532 0.412 8.8e-57
UNIPROTKB|Q5TDH0399 DDI2 "Protein DDI1 homolog 2" 0.631 0.601 0.426 1.6e-55
UNIPROTKB|F1SUU7399 DDI2 "Uncharacterized protein" 0.644 0.614 0.418 8.8e-55
MGI|MGI:1917244399 Ddi2 "DNA-damage inducible pro 0.631 0.601 0.418 2.3e-54
UNIPROTKB|E2QUJ5399 DDI2 "Uncharacterized protein" 0.631 0.601 0.422 2.9e-54
UNIPROTKB|E1B9T9399 DDI2 "Uncharacterized protein" 0.636 0.606 0.414 2.9e-54
ZFIN|ZDB-GENE-031030-15411 ddi2 "DNA-damage inducible pro 0.634 0.586 0.419 3.3e-53
UNIPROTKB|F1MG01396 DDI1 "Protein DDI1 homolog 1" 0.594 0.570 0.432 4.2e-53
UNIPROTKB|F1MAK5399 Ddi2 "Protein Ddi2" [Rattus no 0.594 0.566 0.423 5.4e-53
TAIR|locus:505006342 DDI1 "DNA-damage inducible 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1315 (468.0 bits), Expect = 3.3e-134, P = 3.3e-134
 Identities = 263/358 (73%), Positives = 287/358 (80%)

Query:     1 MRITVMTADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNAEKLSALG 60
             MRITVMTA EQII+LDVD  ETVENVKALLEVE+ VP+QQQQLLYNG EM N++KLSALG
Sbjct:     1 MRITVMTAGEQIITLDVDSQETVENVKALLEVESNVPIQQQQLLYNGNEMGNSDKLSALG 60

Query:    61 VKDEDLVMM-VSNAASSPAT----NNLSFNPDGSAVNPAAFQQHIRNDANLMTQLFQSDP 115
             VKD+DL+MM VSNA+S  AT    N+L  NPDGSA+NPAAFQQHIR D+NLM QLFQ+DP
Sbjct:    61 VKDDDLLMMMVSNASSGSATSAAGNDLGMNPDGSALNPAAFQQHIRGDSNLMGQLFQNDP 120

Query:   116 ELAQVLLGNDLNKLQDXXXXXXXXXXXXXXXXXXXMALLYADPFDVEAQKKIEAAIRQKG 175
             ELAQV+ G+DLNKLQD                   +ALLYADPFDVEAQ+KIEAAIRQKG
Sbjct:   121 ELAQVISGSDLNKLQDVLRARHRQRSVLQRQKEEELALLYADPFDVEAQRKIEAAIRQKG 180

Query:   176 IDENWAAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGXXXXX 235
             IDENW AALEHNPE FARV+MLYVDMEVNG+PLKAFVDSGAQSTIISKSCAERCG     
Sbjct:   181 IDENWEAALEHNPEGFARVIMLYVDMEVNGVPLKAFVDSGAQSTIISKSCAERCGLLRLM 240

Query:   236 XXXYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCII 295
                Y+G+AHGVGQ+EILGRIHVAPIKIGN FYPCSFVVLDSPNMEFLFGLDMLRKHQC I
Sbjct:   241 DQRYKGIAHGVGQTEILGRIHVAPIKIGNNFYPCSFVVLDSPNMEFLFGLDMLRKHQCTI 300

Query:   296 DLKENVLRVGGGEVSVPFLQEKDIPSHFLDEERYSKQXXXXXXXXXXXXKDKSSNLPA 353
             DLKENV+ VGGGEVSVPFLQEKDIPS FLDEER                 +K +N  A
Sbjct:   301 DLKENVMTVGGGEVSVPFLQEKDIPSRFLDEERVPNDASSSGATVPSGFTEKKNNTVA 358




GO:0004190 "aspartic-type endopeptidase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005634 "nucleus" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006486 "protein glycosylation" evidence=RCA
FB|FBgn0030753 rngo "rings lost" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TDH0 DDI2 "Protein DDI1 homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SUU7 DDI2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1917244 Ddi2 "DNA-damage inducible protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUJ5 DDI2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1B9T9 DDI2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031030-15 ddi2 "DNA-damage inducible protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MG01 DDI1 "Protein DDI1 homolog 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAK5 Ddi2 "Protein Ddi2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6CFI3DDI1_YARLINo assigned EC number0.34710.86310.8261yesno
Q4WGS4DDI1_ASPFUNo assigned EC number0.38140.86050.8074yesno
Q2USD7DDI1_ASPORNo assigned EC number0.38710.86570.8184yesno
Q497D6DDI2_XENTRNo assigned EC number0.39210.83420.8045yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query380
cd05479124 cd05479, RP_DDI, RP_DDI; retropepsin-like domain o 3e-77
pfam09668124 pfam09668, Asp_protease, Aspartyl protease 4e-69
cd0179671 cd01796, DDI1_N, DNA damage inducible protein 1 ub 6e-22
cd0176969 cd01769, UBL, Ubiquitin-like domain of UBL 2e-14
cd0030392 cd00303, retropepsin_like, Retropepsins; pepsin-li 8e-14
pfam0024069 pfam00240, ubiquitin, Ubiquitin family 1e-13
smart0021372 smart00213, UBQ, Ubiquitin homologues 2e-13
pfam1365089 pfam13650, Asp_protease_2, Aspartyl protease 2e-10
cd0180577 cd01805, RAD23_N, Ubiquitin-like domain of RAD23 4e-09
cd0181271 cd01812, BAG1_N, Ubiquitin-like domain of BAG1 4e-09
cd0548396 cd05483, retropepsin_like_bacteria, Bacterial aspa 7e-09
cd05480103 cd05480, NRIP_C, NRIP_C; putative nuclear receptor 2e-08
cd0019669 cd00196, UBQ, Ubiquitin-like proteins 9e-08
pfam08284135 pfam08284, RVP_2, Retroviral aspartyl protease 9e-08
cd0180376 cd01803, Ubiquitin, Ubiquitin 9e-08
cd0180972 cd01809, Scythe_N, Ubiquitin-like domain of Scythe 2e-07
pfam1197672 pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO- 6e-07
cd0180676 cd01806, Nedd8, Nebb8-like ubiquitin protein 1e-06
cd1221989 cd12219, UBL_TBK1_like, Ubiquitin-Like Domain Of H 5e-05
TIGR00601378 TIGR00601, rad23, UV excision repair protein Rad23 6e-05
pfam1397572 pfam13975, gag-asp_proteas, gag-polyprotein putati 1e-04
cd0548491 cd05484, retropepsin_like_LTR_2, Retropepsins_like 2e-04
PTZ0004476 PTZ00044, PTZ00044, ubiquitin; Provisional 2e-04
pfam0007799 pfam00077, RVP, Retroviral aspartyl protease 0.001
cd0180774 cd01807, GDX_N, ubiquitin-like domain of GDX 0.002
cd01802103 cd01802, AN1_N, ubiquitin-like domain of AN1 0.003
>gnl|CDD|133146 cd05479, RP_DDI, RP_DDI; retropepsin-like domain of DNA damage inducible protein Back     alignment and domain information
 Score =  233 bits (597), Expect = 3e-77
 Identities = 79/124 (63%), Positives = 109/124 (87%)

Query: 181 AAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLLDDRYR 240
             A+EH+PE+F +V MLY+++E+NG+P+KAFVDSGAQ TI+SK+CAE+CGL+RL+D R++
Sbjct: 1   QNAMEHHPESFGKVPMLYINVEINGVPVKAFVDSGAQMTIMSKACAEKCGLMRLIDKRFQ 60

Query: 241 GVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKEN 300
           G+A GVG  +ILGRIH+A +KIGN+F PCSF VL+  +++FL GLDML++HQC+IDLKEN
Sbjct: 61  GIAKGVGTQKILGRIHLAQVKIGNLFLPCSFTVLEDDDVDFLIGLDMLKRHQCVIDLKEN 120

Query: 301 VLRV 304
           VLR+
Sbjct: 121 VLRI 124


The family represents the retropepsin-like domain of DNA damage inducible protein. DNA damage inducible protein has a retropepsin-like domain and an amino-terminal ubiquitin-like domain and/or a UBA (ubiquitin-associated) domain. This CD represents the retropepsin-like domain of DDI. Length = 124

>gnl|CDD|118200 pfam09668, Asp_protease, Aspartyl protease Back     alignment and domain information
>gnl|CDD|176391 cd01796, DDI1_N, DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL Back     alignment and domain information
>gnl|CDD|133136 cd00303, retropepsin_like, Retropepsins; pepsin-like aspartate proteases Back     alignment and domain information
>gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family Back     alignment and domain information
>gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues Back     alignment and domain information
>gnl|CDD|222288 pfam13650, Asp_protease_2, Aspartyl protease Back     alignment and domain information
>gnl|CDD|176400 cd01805, RAD23_N, Ubiquitin-like domain of RAD23 Back     alignment and domain information
>gnl|CDD|176407 cd01812, BAG1_N, Ubiquitin-like domain of BAG1 Back     alignment and domain information
>gnl|CDD|133150 cd05483, retropepsin_like_bacteria, Bacterial aspartate proteases, retropepsin-like protease family Back     alignment and domain information
>gnl|CDD|133147 cd05480, NRIP_C, NRIP_C; putative nuclear receptor interacting protein Back     alignment and domain information
>gnl|CDD|176352 cd00196, UBQ, Ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|116868 pfam08284, RVP_2, Retroviral aspartyl protease Back     alignment and domain information
>gnl|CDD|176398 cd01803, Ubiquitin, Ubiquitin Back     alignment and domain information
>gnl|CDD|176404 cd01809, Scythe_N, Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>gnl|CDD|192903 pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO-like Back     alignment and domain information
>gnl|CDD|176401 cd01806, Nedd8, Nebb8-like ubiquitin protein Back     alignment and domain information
>gnl|CDD|240618 cd12219, UBL_TBK1_like, Ubiquitin-Like Domain Of Human Tbk1 and similar proteins Back     alignment and domain information
>gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 Back     alignment and domain information
>gnl|CDD|206145 pfam13975, gag-asp_proteas, gag-polyprotein putative aspartyl protease Back     alignment and domain information
>gnl|CDD|133151 cd05484, retropepsin_like_LTR_2, Retropepsins_like_LTR, pepsin-like aspartate proteases Back     alignment and domain information
>gnl|CDD|185411 PTZ00044, PTZ00044, ubiquitin; Provisional Back     alignment and domain information
>gnl|CDD|215697 pfam00077, RVP, Retroviral aspartyl protease Back     alignment and domain information
>gnl|CDD|176402 cd01807, GDX_N, ubiquitin-like domain of GDX Back     alignment and domain information
>gnl|CDD|176397 cd01802, AN1_N, ubiquitin-like domain of AN1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 380
KOG0012380 consensus DNA damage inducible protein [Replicatio 100.0
PF09668124 Asp_protease: Aspartyl protease; InterPro: IPR0191 100.0
cd05480103 NRIP_C NRIP_C; putative nuclear receptor interacti 100.0
cd05479124 RP_DDI RP_DDI; retropepsin-like domain of DNA dama 99.97
KOG0010493 consensus Ubiquitin-like protein [Posttranslationa 99.94
PF08284135 RVP_2: Retroviral aspartyl protease; InterPro: IPR 99.84
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.72
TIGR02281121 clan_AA_DTGA clan AA aspartic protease, TIGR02281 99.71
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.68
cd0548491 retropepsin_like_LTR_2 Retropepsins_like_LTR, peps 99.68
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.68
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.65
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.65
PTZ0004476 ubiquitin; Provisional 99.65
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.63
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.62
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.62
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.62
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.62
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.61
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.61
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.6
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.59
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 99.59
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.56
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 99.56
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 99.56
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 99.55
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 99.55
cd0548396 retropepsin_like_bacteria Bacterial aspartate prot 99.55
PF1365090 Asp_protease_2: Aspartyl protease 99.54
PF00077100 RVP: Retroviral aspartyl protease The Prosite entr 99.53
KOG000570 consensus Ubiquitin-like protein [Cell cycle contr 99.49
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 99.47
TIGR03698107 clan_AA_DTGF clan AA aspartic protease, AF_0612 fa 99.47
KOG0011340 consensus Nucleotide excision repair factor NEF2, 99.45
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 99.44
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 99.43
cd0609586 RP_RTVL_H_like Retropepsin of the RTVL_H family of 99.43
KOG0003128 consensus Ubiquitin/60s ribosomal protein L40 fusi 99.41
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 99.36
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 99.34
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 99.34
KOG0004156 consensus Ubiquitin/40S ribosomal protein S27a fus 99.29
COG3577215 Predicted aspartyl protease [General function pred 99.24
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 99.23
cd0030392 retropepsin_like Retropepsins; pepsin-like asparta 99.16
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 99.13
cd0548193 retropepsin_like_LTR_1 Retropepsins_like_LTR; peps 99.07
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 99.07
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 99.04
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 99.0
PF12384177 Peptidase_A2B: Ty3 transposon peptidase; InterPro: 98.99
PF1397572 gag-asp_proteas: gag-polyprotein putative aspartyl 98.96
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 98.91
COG5550125 Predicted aspartyl protease [Posttranslational mod 98.88
PLN02560308 enoyl-CoA reductase 98.77
KOG4248 1143 consensus Ubiquitin-like protein, regulator of apo 98.76
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 98.59
cd0609489 RP_Saci_like RP_Saci_like, retropepsin family. Ret 98.55
KOG000175 consensus Ubiquitin and ubiquitin-like proteins [P 98.55
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 98.42
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 98.39
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 98.36
PF02160201 Peptidase_A3: Cauliflower mosaic virus peptidase ( 98.31
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 98.31
PF05585164 DUF1758: Putative peptidase (DUF1758); InterPro: I 98.23
cd0548287 HIV_retropepsin_like Retropepsins, pepsin-like asp 98.22
KOG1872473 consensus Ubiquitin-specific protease [Posttransla 97.98
KOG349373 consensus Ubiquitin-like protein [Posttranslationa 97.89
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 97.7
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 97.62
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 97.49
KOG176999 consensus Ubiquitin-like proteins [Posttranslation 97.28
KOG4495110 consensus RNA polymerase II transcription elongati 97.14
COG541781 Uncharacterized small protein [Function unknown] 96.95
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 96.91
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 96.75
smart0016680 UBX Domain present in ubiquitin-regulatory protein 96.74
KOG3206234 consensus Alpha-tubulin folding cofactor B [Posttr 96.64
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 96.41
KOG1639297 consensus Steroid reductase required for elongatio 96.36
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 96.35
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 96.29
PF12382137 Peptidase_A2E: Retrotransposon peptidase; InterPro 96.29
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 96.11
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 95.88
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 95.49
COG4067162 Uncharacterized protein conserved in archaea [Post 95.45
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 95.4
PF0928059 XPC-binding: XPC-binding domain; InterPro: IPR0153 95.31
PF00026 317 Asp: Eukaryotic aspartyl protease The Prosite entr 95.14
COG5227103 SMT3 Ubiquitin-like protein (sentrin) [Posttransla 94.96
cd05470109 pepsin_retropepsin_like Cellular and retroviral pe 94.79
cd05476265 pepsin_A_like_plant Chroloplast Nucleoids DNA-bind 94.62
PF13019162 Telomere_Sde2: Telomere stability and silencing 94.55
PTZ00013 450 plasmepsin 4 (PM4); Provisional 94.34
PTZ00147 453 plasmepsin-1; Provisional 94.31
KOG0013231 consensus Uncharacterized conserved protein [Funct 94.26
cd06097278 Aspergillopepsin_like Aspergillopepsin_like, aspar 93.94
cd05487 326 renin_like Renin stimulates production of angioten 93.14
cd05478317 pepsin_A Pepsin A, aspartic protease produced in g 92.85
cd06096326 Plasmepsin_5 Plasmepsins are a class of aspartic p 92.74
cd05477318 gastricsin Gastricsins, asparate proteases produce 92.64
cd05474 295 SAP_like SAPs, pepsin-like proteinases secreted fr 92.53
PF1445357 ThiS-like: ThiS-like ubiquitin 92.21
PRK0643767 hypothetical protein; Provisional 92.14
KOG0010493 consensus Ubiquitin-like protein [Posttranslationa 91.68
cd05476265 pepsin_A_like_plant Chroloplast Nucleoids DNA-bind 91.67
PF05618138 Zn_protease: Putative ATP-dependant zinc protease; 91.53
cd05478 317 pepsin_A Pepsin A, aspartic protease produced in g 91.49
cd06098317 phytepsin Phytepsin, a plant homolog of mammalian 91.34
cd05474295 SAP_like SAPs, pepsin-like proteinases secreted fr 91.16
cd06098 317 phytepsin Phytepsin, a plant homolog of mammalian 90.96
cd05485329 Cathepsin_D_like Cathepsin_D_like, pepsin family o 90.96
cd05477 318 gastricsin Gastricsins, asparate proteases produce 90.74
PF1504476 CLU_N: Mitochondrial function, CLU-N-term 90.71
PF00026317 Asp: Eukaryotic aspartyl protease The Prosite entr 90.04
PRK0836470 sulfur carrier protein ThiS; Provisional 90.0
cd05490 325 Cathepsin_D2 Cathepsin_D2, pepsin family of protei 89.83
PTZ00165 482 aspartyl protease; Provisional 89.79
TIGR02958452 sec_mycoba_snm4 secretion protein snm4. Members of 89.42
cd05473 364 beta_secretase_like Beta-secretase, aspartic-acid 89.35
cd05485 329 Cathepsin_D_like Cathepsin_D_like, pepsin family o 89.34
cd05488 320 Proteinase_A_fungi Fungal Proteinase A , aspartic 89.28
cd05486 316 Cathespin_E Cathepsin E, non-lysosomal aspartic pr 88.99
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 88.96
cd05472 299 cnd41_like Chloroplast Nucleoids DNA-binding Prote 88.95
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 88.44
PF1483688 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A 87.99
PF03539163 Spuma_A9PTase: Spumavirus aspartic protease (A9); 87.83
PF1079076 DUF2604: Protein of Unknown function (DUF2604); In 87.52
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 87.42
cd06097278 Aspergillopepsin_like Aspergillopepsin_like, aspar 87.24
cd05471283 pepsin_like Pepsin-like aspartic proteases, biloba 87.23
PLN0279982 Molybdopterin synthase sulfur carrier subunit 87.1
PRK0648865 sulfur carrier protein ThiS; Validated 86.95
PRK0586365 sulfur carrier protein ThiS; Provisional 86.64
cd05488320 Proteinase_A_fungi Fungal Proteinase A , aspartic 86.62
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 86.61
KOG4583391 consensus Membrane-associated ER protein involved 86.23
cd06096326 Plasmepsin_5 Plasmepsins are a class of aspartic p 85.93
PF1162088 GABP-alpha: GA-binding protein alpha chain; InterP 85.9
PRK0565966 sulfur carrier protein ThiS; Validated 85.77
cd05472299 cnd41_like Chloroplast Nucleoids DNA-binding Prote 85.46
cd05471283 pepsin_like Pepsin-like aspartic proteases, biloba 85.19
smart0072741 STI1 Heat shock chaperonin-binding motif. 84.4
cd05487326 renin_like Renin stimulates production of angioten 84.2
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 84.16
cd05475273 nucellin_like Nucellins, plant aspartic proteases 83.74
cd05486316 Cathespin_E Cathepsin E, non-lysosomal aspartic pr 82.26
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 82.01
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 81.72
cd05490325 Cathepsin_D2 Cathepsin_D2, pepsin family of protei 81.66
PRK0805366 sulfur carrier protein ThiS; Provisional 81.49
PLN03146431 aspartyl protease family protein; Provisional 81.45
cd0640886 PB1_NoxR The PB1 domain is present in the Epichloe 81.24
PF0928059 XPC-binding: XPC-binding domain; InterPro: IPR0153 80.22
>KOG0012 consensus DNA damage inducible protein [Replication, recombination and repair] Back     alignment and domain information
Probab=100.00  E-value=5.1e-63  Score=471.46  Aligned_cols=321  Identities=42%  Similarity=0.689  Sum_probs=282.3

Q ss_pred             CEEEEEeC--CCCEEEEEeCCCCCHHHHHHHHHHHhCCCCcCeEEecCCeecCCc--ccchhcCCCCCcEEEEeecCCCC
Q 016931            1 MRITVMTA--DEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNA--EKLSALGVKDEDLVMMVSNAASS   76 (380)
Q Consensus         1 M~ItVk~~--~g~~~~i~V~~~~TV~~LK~~I~~~~gip~~~q~Li~~Gk~L~D~--~tL~~~gI~dg~~I~l~~~~~~s   76 (380)
                      |.++|.+.  ..+.+.++|..+..+.+|+.+++..+|++.+..-|+|+++++.+.  ..|.++|+++||++.+..+.+..
T Consensus         1 M~~tvs~~l~~~~~~~i~v~~dg~L~nl~aL~~~d~g~~~~~~~li~n~~~l~s~~s~~l~Q~g~~~~dsl~lr~ks~d~   80 (380)
T KOG0012|consen    1 MSLTVSVALNFEKKFPIPVTTDGELNNLAALCWKDTGIVYDPSDLIYNPRPLVSNESQGLTQIGLKDGDSLALRCKSSDP   80 (380)
T ss_pred             CeEEEEEEecceeeeccccccccchhhHHHHHHHHhCcccchhhcccCCCccccchhhhhhhcccccceeEeccCCCCCC
Confidence            77888765  567788999999999999999999999999999999999999864  68999999999999997543221


Q ss_pred             -------------CC--CC-----CCCC------------------CCCCCCCChHHHHHHHhcCHHHHHHHhhcCHHHH
Q 016931           77 -------------PA--TN-----NLSF------------------NPDGSAVNPAAFQQHIRNDANLMTQLFQSDPELA  118 (380)
Q Consensus        77 -------------~~--~~-----~~~~------------------~~~g~~~~p~~~~q~~l~nP~~l~qL~~~nP~La  118 (380)
                                   .+  ..     +.+.                  .+.+...+|..++|.++++|..+..+++.+|.|+
T Consensus        81 r~~v~~~~~~~~dFat~A~~~fs~q~a~~~~gaq~~rg~~~~di~~a~~~~ldsp~~~Rq~~la~pf~L~~~r~~lp~La  160 (380)
T KOG0012|consen   81 RPIVPIQVRLISDFATIAVPMFSSQRARQLQGAQRTRGRLQTDIPEASSLSLDSPATFRQALLAMPFFLHLDRAYLPPLA  160 (380)
T ss_pred             CccccccceehhcccccccccccchhccccccccccccccccccccccccCcCCHHHHHHHHhcCchhhhhchhhcCccc
Confidence                         00  00     0000                  0011136788899999999999999999999999


Q ss_pred             HHhcCCCHHHHHHHHHHhHHHHHHHHHhhHHHHHHhhCCCccHHHHHHHHHHHHhhcHHHHHHHHHhcCCccccccceeE
Q 016931          119 QVLLGNDLNKLQDLLRERSRQRSELRRRQEEEMALLYADPFDVEAQKKIEAAIRQKGIDENWAAALEHNPEAFARVVMLY  198 (380)
Q Consensus       119 ~ai~~~d~~~~~~~l~~~~~q~~~~~~~~~~el~~l~~dP~~~E~Q~~I~E~Irq~~i~en~~~A~E~~Pe~f~~~~~ly  198 (380)
                      .++..+|.+.|.+.+...+..++ .  +.....+.+.+||||+|+|++|+|.|||++|+|||.+|+||+||.|+.+.|||
T Consensus       161 ~~l~~g~~~k~~~~~~~~q~d~~-r--r~~~~~rl~eanPfd~E~q~rIee~irq~~i~eq~~~ai~~~pe~f~~v~ML~  237 (380)
T KOG0012|consen  161 ALLVLGDLEKFDRTLKEMQKDYQ-R--RSVHQRRLLEANPFDLEAQRRIEEKIRQNAIDEQMSHAIEYHPEDFTQVTMLY  237 (380)
T ss_pred             hhhcccchhhhhhhhhhhccccc-h--hhhhhHHHHhcCCcchhhhhhhhHHHHHHHHHHHHHHhhhcCccccccceEEE
Confidence            99999999999888874422222 1  12234567889999999999999999999999999999999999999999999


Q ss_pred             EeeeecCeeEEEEEcCCccccccCHHHHHHcCCccccCCcceeEeecCcceeEEeEEEEEeEEEcCEEEeEEEEEecCCC
Q 016931          199 VDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPN  278 (380)
Q Consensus       199 v~v~Ing~~v~alVDTGA~~siIs~~~a~rlgL~~~~~~~~~~~~~gvg~~~~~g~i~~~~i~ig~~~~~~~~~Vl~~~~  278 (380)
                      |+|+|||++||||||||||.|+||.+||+||||.+++|+||.|++.|||+.++.|+||.++++||+.+++|+|.|++...
T Consensus       238 iN~~ing~~VKAfVDsGaq~timS~~Caer~gL~rlid~r~~g~a~gvg~~ki~g~Ih~~~lki~~~~l~c~ftV~d~~~  317 (380)
T KOG0012|consen  238 INCEINGVPVKAFVDSGAQTTIMSAACAERCGLNRLIDKRFQGEARGVGTEKILGRIHQAQLKIEDLYLPCSFTVLDRRD  317 (380)
T ss_pred             EEEEECCEEEEEEEcccchhhhhhHHHHHHhChHHHhhhhhhccccCCCcccccceeEEEEEEeccEeeccceEEecCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CceeeeHHHHhhcCeEEEcCCCEEEEcCCceeeeccCCCCCCcccc
Q 016931          279 MEFLFGLDMLRKHQCIIDLKENVLRVGGGEVSVPFLQEKDIPSHFL  324 (380)
Q Consensus       279 ~d~iLG~D~L~~~~~~ID~~~~~l~i~~~~~~~pfl~~~e~~~~~~  324 (380)
                      .|++||+|+|++|+||||+++|+|+||+++.++||++..++|.+..
T Consensus       318 ~d~llGLd~Lrr~~ccIdL~~~~L~ig~~~teiPfl~~~~lp~~~~  363 (380)
T KOG0012|consen  318 MDLLLGLDMLRRHQCCIDLKTNVLRIGNTETEIPFLPSNELPSHNK  363 (380)
T ss_pred             cchhhhHHHHHhccceeecccCeEEecCCCccccccccccCCcccc
Confidence            9999999999999999999999999999988999999999999764



>PF09668 Asp_protease: Aspartyl protease; InterPro: IPR019103 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd05480 NRIP_C NRIP_C; putative nuclear receptor interacting protein Back     alignment and domain information
>cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF08284 RVP_2: Retroviral aspartyl protease; InterPro: IPR013242 This region defines single domain aspartyl proteases from retroviruses, retrotransposons, and badnaviruses (plant dsDNA viruses) Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family Back     alignment and domain information
>PF13650 Asp_protease_2: Aspartyl protease Back     alignment and domain information
>PF00077 RVP: Retroviral aspartyl protease The Prosite entry also includes Pfam:PF00026; InterPro: IPR018061 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>TIGR03698 clan_AA_DTGF clan AA aspartic protease, AF_0612 family Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd06095 RP_RTVL_H_like Retropepsin of the RTVL_H family of human endogenous retrovirus-like elements Back     alignment and domain information
>KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3577 Predicted aspartyl protease [General function prediction only] Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd00303 retropepsin_like Retropepsins; pepsin-like aspartate proteases Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd05481 retropepsin_like_LTR_1 Retropepsins_like_LTR; pepsin-like aspartate protease from retrotransposons with long terminal repeats Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>PF12384 Peptidase_A2B: Ty3 transposon peptidase; InterPro: IPR024650 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13975 gag-asp_proteas: gag-polyprotein putative aspartyl protease Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>COG5550 Predicted aspartyl protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>cd06094 RP_Saci_like RP_Saci_like, retropepsin family Back     alignment and domain information
>KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>PF02160 Peptidase_A3: Cauliflower mosaic virus peptidase (A3); InterPro: IPR000588 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>PF05585 DUF1758: Putative peptidase (DUF1758); InterPro: IPR008737 This is a family of nematode proteins of unknown function [] Back     alignment and domain information
>cd05482 HIV_retropepsin_like Retropepsins, pepsin-like aspartate proteases Back     alignment and domain information
>KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3493 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4495 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B [Transcription] Back     alignment and domain information
>COG5417 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>KOG3206 consensus Alpha-tubulin folding cofactor B [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>KOG1639 consensus Steroid reductase required for elongation of the very long chain fatty acids [Lipid transport and metabolism] Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>PF12382 Peptidase_A2E: Retrotransposon peptidase; InterPro: IPR024648 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>COG4067 Uncharacterized protein conserved in archaea [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>PF09280 XPC-binding: XPC-binding domain; InterPro: IPR015360 Members of this entry adopt a structure consisting of four alpha helices, arranged in an array Back     alignment and domain information
>PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 Back     alignment and domain information
>COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05470 pepsin_retropepsin_like Cellular and retroviral pepsin-like aspartate proteases Back     alignment and domain information
>cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants Back     alignment and domain information
>PF13019 Telomere_Sde2: Telomere stability and silencing Back     alignment and domain information
>PTZ00013 plasmepsin 4 (PM4); Provisional Back     alignment and domain information
>PTZ00147 plasmepsin-1; Provisional Back     alignment and domain information
>KOG0013 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin Back     alignment and domain information
>cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure Back     alignment and domain information
>cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals Back     alignment and domain information
>cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite Back     alignment and domain information
>cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa Back     alignment and domain information
>cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins Back     alignment and domain information
>PF14453 ThiS-like: ThiS-like ubiquitin Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants Back     alignment and domain information
>PF05618 Zn_protease: Putative ATP-dependant zinc protease; InterPro: IPR008503 This family consists of several hypothetical proteins from different archaeal and bacterial species Back     alignment and domain information
>cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals Back     alignment and domain information
>cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins Back     alignment and domain information
>cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins Back     alignment and domain information
>cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins Back     alignment and domain information
>cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases Back     alignment and domain information
>cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa Back     alignment and domain information
>PF15044 CLU_N: Mitochondrial function, CLU-N-term Back     alignment and domain information
>PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases Back     alignment and domain information
>PTZ00165 aspartyl protease; Provisional Back     alignment and domain information
>TIGR02958 sec_mycoba_snm4 secretion protein snm4 Back     alignment and domain information
>cd05473 beta_secretase_like Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease Back     alignment and domain information
>cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases Back     alignment and domain information
>cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily Back     alignment and domain information
>cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A Back     alignment and domain information
>PF03539 Spuma_A9PTase: Spumavirus aspartic protease (A9); InterPro: IPR001641 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10790 DUF2604: Protein of Unknown function (DUF2604); InterPro: IPR019726 This entry represents bacterial proteins with undetermined function Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin Back     alignment and domain information
>cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH Back     alignment and domain information
>PLN02799 Molybdopterin synthase sulfur carrier subunit Back     alignment and domain information
>PRK06488 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>PRK05863 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>KOG4583 consensus Membrane-associated ER protein involved in stress response (contains ubiquitin-like domain) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite Back     alignment and domain information
>PF11620 GABP-alpha: GA-binding protein alpha chain; InterPro: IPR024668 GA-binding protein alpha is a transcription factor capable of interacting with purine rich repeats (GA repeats) Back     alignment and domain information
>PRK05659 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase Back     alignment and domain information
>cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH Back     alignment and domain information
>smart00727 STI1 Heat shock chaperonin-binding motif Back     alignment and domain information
>cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>cd05475 nucellin_like Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation Back     alignment and domain information
>cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases Back     alignment and domain information
>PRK08053 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PLN03146 aspartyl protease family protein; Provisional Back     alignment and domain information
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA Back     alignment and domain information
>PF09280 XPC-binding: XPC-binding domain; InterPro: IPR015360 Members of this entry adopt a structure consisting of four alpha helices, arranged in an array Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query380
2i1a_A148 A Retroviral Protease-Like Domain In The Eukaryotic 4e-36
3s8i_A148 The Retroviral-Like Protease (Rvp) Domain Of Human 3e-34
2xk5_B76 Crystal Structure Of K6-Linked Diubiquitin Length = 3e-07
1zgu_B76 Solution Structure Of The Human Mms2-Ubiquitin Comp 5e-07
2o6v_D76 Crystal Structure And Solution Nmr Studies Of Lys48 6e-07
2fcs_A76 X-Ray Crystal Structure Of A Chemically Synthesized 6e-07
2ojr_A111 Structure Of Ubiquitin Solved By Sad Using The Lant 8e-07
3jvz_X81 E2~ubiquitin-Hect Length = 81 1e-06
4ap4_C80 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 1e-06
2khw_B79 Solution Structure Of The Human Polymerase Iota Ubm 1e-06
2k25_A103 Automated Nmr Structure Of The Ubb By Fapsy Length 1e-06
2ld9_A77 Backbone Structure Of Ubiquitin Determined Using Ba 1e-06
3dvg_X80 Crystal Structure Of K63-Specific Fab Apu.3a8 Bound 1e-06
2k6d_B76 Cin85 Sh3-C Domain In Complex With Ubiquitin Length 1e-06
3nob_A78 Structure Of K11-Linked Di-Ubiquitin Length = 78 1e-06
3ai5_A307 Crystal Structure Of Yeast Enhanced Green Fluoresce 1e-06
1aar_A76 Structure Of A Diubiquitin Conjugate And A Model Fo 1e-06
3dvg_Y79 Crystal Structure Of K63-Specific Fab Apu.3a8 Bound 1e-06
3vdz_A111 Tailoring Encodable Lanthanide-Binding Tags As Mri 1e-06
2znv_C77 Crystal Structure Of Human Amsh-Lp Dub Domain In Co 1e-06
3rul_A79 New Strategy To Analyze Structures Of Glycopeptide- 1e-06
1xd3_B75 Crystal Structure Of Uchl3-Ubvme Complex Length = 7 2e-06
1cmx_B76 Structural Basis For The Specificity Of Ubiquitin C 2e-06
3k9o_B96 The Crystal Structure Of E2-25k And Ubb+1 Complex L 2e-06
2znv_B76 Crystal Structure Of Human Amsh-Lp Dub Domain In Co 2e-06
3ons_A72 Crystal Structure Of Human Ubiquitin In A New Cryst 2e-06
3ldz_F73 Crystal Structure Of Human Stam1 Vhs Domain In Comp 2e-06
1yx5_B98 Solution Structure Of S5a Uim-1UBIQUITIN COMPLEX Le 2e-06
1yj1_A76 X-Ray Crystal Structure Of A Chemically Synthesized 3e-06
1yiw_A76 X-Ray Crystal Structure Of A Chemically Synthesized 3e-06
2o6v_B76 Crystal Structure And Solution Nmr Studies Of Lys48 4e-06
3u30_A172 Crystal Structure Of A Linear-Specific Ubiquitin Fa 4e-06
2zvn_A154 Nemo Cozi Domain Incomplex With Diubiquitin In P212 4e-06
3q3f_A189 Engineering Domain-Swapped Binding Interfaces By Mu 4e-06
1ogw_A76 Synthetic Ubiquitin With Fluoro-Leu At 50 And 67 Le 5e-06
4a18_K129 T.Thermophila 60s Ribosomal Subunit In Complex With 5e-06
2w9n_A152 Crystal Structure Of Linear Di-Ubiquitin Length = 1 5e-06
3b08_A152 Crystal Structure Of The Mouse Hoil1-L-Nzf In Compl 5e-06
4i6l_B76 Crystal Structure Of Otub1 In Complex With Ubiquiti 5e-06
2y5b_B152 Structure Of Usp21 In Complex With Linear Diubiquit 6e-06
1s1q_B76 Tsg101(Uev) Domain In Complex With Ubiquitin Length 6e-06
3v6c_B91 Crystal Structure Of Usp2 In Complex With Mutated U 7e-06
3v6e_B91 Crystal Structure Of Usp2 And A Mutant Form Of Ubiq 7e-06
3mtn_B85 Usp21 In Complex With A Ubiquitin-based, Usp21-spec 8e-06
2zcb_A76 Crystal Structure Of Ubiquitin P37aP38A Length = 76 8e-06
3h7s_B76 Crystal Structures Of K63-Linked Di- And Tri-Ubiqui 1e-05
3n3k_B85 The Catalytic Domain Of Usp8 In Complex With A Usp8 2e-05
3dbh_I88 Structural Dissection Of A Gating Mechanism Prevent 2e-05
1ud7_A76 Solution Structure Of The Designed Hydrophobic Core 2e-05
3dbl_I88 Structural Dissection Of A Gating Mechanism Prevent 2e-05
2nvu_I81 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 3e-05
4f8c_B88 Structure Of The Cif:nedd8 Complex - Yersinia Pseud 3e-05
2gbk_A83 Crystal Structure Of The 9-10 Moad Insertion Mutant 3e-05
2gbj_A84 Crystal Structure Of The 9-10 8 Glycine Insertion M 3e-05
1ndd_B76 Structure Of Nedd8 Length = 76 4e-05
3gzn_I82 Structure Of Nedd8-Activating Enzyme In Complex Wit 4e-05
2bkr_B77 Nedd8 Nedp1 Complex Length = 77 4e-05
4hcp_B78 Crystal Structure Of Burkholderia Pseudomallei Effe 4e-05
1uel_A95 Solution Structure Of Ubiquitin-Like Domain Of Hhr2 5e-05
2gbr_A81 Crystal Structure Of The 35-36 Moad Insertion Mutan 5e-05
1c3t_A76 Rotamer Strain As A Determinant Of Protein Structur 5e-05
4ii3_B96 Crystal Structure Of S. Pombe Ubiquitin Activating 5e-05
4hcn_B98 Crystal Structure Of Burkholderia Pseudomallei Effe 6e-05
4ii2_B83 Crystal Structure Of Ubiquitin Activating Enzyme 1 6e-05
4gsw_A80 Crystal Structure Of Ubiquitin From Entamoeba Histo 7e-05
3u5e_m128 The Structure Of The Eukaryotic Ribosome At 3.0 A R 7e-05
1otr_B76 Solution Structure Of A Cue-Ubiquitin Complex Lengt 7e-05
3u5g_f152 The Structure Of The Eukaryotic Ribosome At 3.0 A R 7e-05
3u5c_f152 The Structure Of The Eukaryotic Ribosome At 3.0 A R 8e-05
3olm_D79 Structure And Function Of A Ubiquitin Binding Site 8e-05
3l0w_B169 Structure Of Split Monoubiquitinated Pcna With Ubiq 8e-05
1zw7_A82 Elimination Of The C-Cap In Ubiquitin Structure, Dy 9e-05
3zf7_s128 High-resolution Cryo-electron Microscopy Structure 1e-04
2gbm_A84 Crystal Structure Of The 35-36 8 Glycine Insertion 1e-04
4hk2_A78 U7ub25.2540 Length = 78 2e-04
1p1a_A85 Nmr Structure Of Ubiquitin-Like Domain Of Hhr23b Le 2e-04
2jwz_A76 Mutations In The Hydrophobic Core Of Ubiquitin Diff 2e-04
4hjk_A77 U7ub7 Disulfide Variant Length = 77 2e-04
2jvc_A82 Nmr Solution Structure Of Ubiquitin Like Protein Le 2e-04
1gjz_A53 Solution Structure Of A Dimeric N-Terminal Fragment 2e-04
3dqv_A81 Structural Insights Into Nedd8 Activation Of Cullin 3e-04
1sif_A88 Crystal Structure Of A Multiple Hydrophobic Core Mu 4e-04
>pdb|2I1A|A Chain A, A Retroviral Protease-Like Domain In The Eukaryotic Protein Ddi1 Length = 148 Back     alignment and structure

Iteration: 1

Score = 148 bits (374), Expect = 4e-36, Method: Compositional matrix adjust. Identities = 71/151 (47%), Positives = 101/151 (66%), Gaps = 3/151 (1%) Query: 171 IRQKGIDENWAAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCG 230 ++Q+ IDE A+E+ PE F +V MLY+++E+N P+KAFVD+GAQ+TI+S A++ G Sbjct: 1 MKQQAIDEQLRNAIEYTPEMFTQVPMLYINIEINNYPVKAFVDTGAQTTIMSTRLAKKTG 60 Query: 231 XXXXXXXXYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRK 290 + G A GVG +I+GRIH A +KI + PCSF VLD+ +++ L GLDML++ Sbjct: 61 LSRMIDKRFIGEARGVGTGKIIGRIHQAQVKIETQYIPCSFTVLDT-DIDVLIGLDMLKR 119 Query: 291 HQCIIDLKENVLRVGGGEVSVPFLQEKDIPS 321 H +DLKENVLR+ EV FL E +IP Sbjct: 120 HLACVDLKENVLRI--AEVETSFLSEAEIPK 148
>pdb|3S8I|A Chain A, The Retroviral-Like Protease (Rvp) Domain Of Human Ddi1 Length = 148 Back     alignment and structure
>pdb|2XK5|B Chain B, Crystal Structure Of K6-Linked Diubiquitin Length = 76 Back     alignment and structure
>pdb|1ZGU|B Chain B, Solution Structure Of The Human Mms2-Ubiquitin Complex Length = 76 Back     alignment and structure
>pdb|2O6V|D Chain D, Crystal Structure And Solution Nmr Studies Of Lys48-Linked Tetraubiquitin At Neutral Ph Length = 76 Back     alignment and structure
>pdb|2FCS|A Chain A, X-Ray Crystal Structure Of A Chemically Synthesized [l-Gln35]ubiquitin With A Cubic Space Group Length = 76 Back     alignment and structure
>pdb|2OJR|A Chain A, Structure Of Ubiquitin Solved By Sad Using The Lanthanide- Binding Tag Length = 111 Back     alignment and structure
>pdb|3JVZ|X Chain X, E2~ubiquitin-Hect Length = 81 Back     alignment and structure
>pdb|4AP4|C Chain C, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 80 Back     alignment and structure
>pdb|2KHW|B Chain B, Solution Structure Of The Human Polymerase Iota Ubm2- Ubiquitin Complex Length = 79 Back     alignment and structure
>pdb|2K25|A Chain A, Automated Nmr Structure Of The Ubb By Fapsy Length = 103 Back     alignment and structure
>pdb|2LD9|A Chain A, Backbone Structure Of Ubiquitin Determined Using Backbone Amide Noes And Backbone N-H And N-C Rdcs Length = 77 Back     alignment and structure
>pdb|3DVG|X Chain X, Crystal Structure Of K63-Specific Fab Apu.3a8 Bound To K63-Linked Di- Ubiquitin Length = 80 Back     alignment and structure
>pdb|2K6D|B Chain B, Cin85 Sh3-C Domain In Complex With Ubiquitin Length = 76 Back     alignment and structure
>pdb|3NOB|A Chain A, Structure Of K11-Linked Di-Ubiquitin Length = 78 Back     alignment and structure
>pdb|3AI5|A Chain A, Crystal Structure Of Yeast Enhanced Green Fluorescent Protein- Ubiquitin Fusion Protein Length = 307 Back     alignment and structure
>pdb|1AAR|A Chain A, Structure Of A Diubiquitin Conjugate And A Model For Interaction With Ubiquitin Conjugating Enzyme (E2) Length = 76 Back     alignment and structure
>pdb|3DVG|Y Chain Y, Crystal Structure Of K63-Specific Fab Apu.3a8 Bound To K63-Linked Di- Ubiquitin Length = 79 Back     alignment and structure
>pdb|3VDZ|A Chain A, Tailoring Encodable Lanthanide-Binding Tags As Mri Contrast Agents: Xq-Dse3-Ubiquitin At 2.4 Angstroms Length = 111 Back     alignment and structure
>pdb|2ZNV|C Chain C, Crystal Structure Of Human Amsh-Lp Dub Domain In Complex With Lys63-Linked Ubiquitin Dimer Length = 77 Back     alignment and structure
>pdb|3RUL|A Chain A, New Strategy To Analyze Structures Of Glycopeptide-Target Complexes Length = 79 Back     alignment and structure
>pdb|1XD3|B Chain B, Crystal Structure Of Uchl3-Ubvme Complex Length = 75 Back     alignment and structure
>pdb|1CMX|B Chain B, Structural Basis For The Specificity Of Ubiquitin C- Terminal Hydrolases Length = 76 Back     alignment and structure
>pdb|3K9O|B Chain B, The Crystal Structure Of E2-25k And Ubb+1 Complex Length = 96 Back     alignment and structure
>pdb|2ZNV|B Chain B, Crystal Structure Of Human Amsh-Lp Dub Domain In Complex With Lys63-Linked Ubiquitin Dimer Length = 76 Back     alignment and structure
>pdb|3ONS|A Chain A, Crystal Structure Of Human Ubiquitin In A New Crystal Form Length = 72 Back     alignment and structure
>pdb|3LDZ|F Chain F, Crystal Structure Of Human Stam1 Vhs Domain In Complex With Ubiquitin Length = 73 Back     alignment and structure
>pdb|1YX5|B Chain B, Solution Structure Of S5a Uim-1UBIQUITIN COMPLEX Length = 98 Back     alignment and structure
>pdb|1YJ1|A Chain A, X-Ray Crystal Structure Of A Chemically Synthesized [d-Gln35]ubiquitin Length = 76 Back     alignment and structure
>pdb|1YIW|A Chain A, X-Ray Crystal Structure Of A Chemically Synthesized Ubiquitin Length = 76 Back     alignment and structure
>pdb|2O6V|B Chain B, Crystal Structure And Solution Nmr Studies Of Lys48-Linked Tetraubiquitin At Neutral Ph Length = 76 Back     alignment and structure
>pdb|3U30|A Chain A, Crystal Structure Of A Linear-Specific Ubiquitin Fab Bound To Linear Ubiquitin Length = 172 Back     alignment and structure
>pdb|2ZVN|A Chain A, Nemo Cozi Domain Incomplex With Diubiquitin In P212121 Space Group Length = 154 Back     alignment and structure
>pdb|3Q3F|A Chain A, Engineering Domain-Swapped Binding Interfaces By Mutually Exclusive Folding: Insertion Of Ubiquitin Into Position 103 Of Barnase Length = 189 Back     alignment and structure
>pdb|1OGW|A Chain A, Synthetic Ubiquitin With Fluoro-Leu At 50 And 67 Length = 76 Back     alignment and structure
>pdb|4A18|K Chain K, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 26s Rrna And Proteins Of Molecule 1 Length = 129 Back     alignment and structure
>pdb|2W9N|A Chain A, Crystal Structure Of Linear Di-Ubiquitin Length = 152 Back     alignment and structure
>pdb|3B08|A Chain A, Crystal Structure Of The Mouse Hoil1-L-Nzf In Complex With Linear Di- Ubiquitin Length = 152 Back     alignment and structure
>pdb|4I6L|B Chain B, Crystal Structure Of Otub1 In Complex With Ubiquitin Variant Length = 76 Back     alignment and structure
>pdb|2Y5B|B Chain B, Structure Of Usp21 In Complex With Linear Diubiquitin-Aldehyde Length = 152 Back     alignment and structure
>pdb|1S1Q|B Chain B, Tsg101(Uev) Domain In Complex With Ubiquitin Length = 76 Back     alignment and structure
>pdb|3V6C|B Chain B, Crystal Structure Of Usp2 In Complex With Mutated Ubiquitin Length = 91 Back     alignment and structure
>pdb|3V6E|B Chain B, Crystal Structure Of Usp2 And A Mutant Form Of Ubiquitin Length = 91 Back     alignment and structure
>pdb|3MTN|B Chain B, Usp21 In Complex With A Ubiquitin-based, Usp21-specific Inhibitor Length = 85 Back     alignment and structure
>pdb|2ZCB|A Chain A, Crystal Structure Of Ubiquitin P37aP38A Length = 76 Back     alignment and structure
>pdb|3N3K|B Chain B, The Catalytic Domain Of Usp8 In Complex With A Usp8 Specific Inhibitor Length = 85 Back     alignment and structure
>pdb|3DBH|I Chain I, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190ala-Nedd8ala72arg) Length = 88 Back     alignment and structure
>pdb|1UD7|A Chain A, Solution Structure Of The Designed Hydrophobic Core Mutant Of Ubiquitin, 1d7 Length = 76 Back     alignment and structure
>pdb|3DBL|I Chain I, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190wt-Nedd8ala72gln) Length = 88 Back     alignment and structure
>pdb|2NVU|I Chain I, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 81 Back     alignment and structure
>pdb|4F8C|B Chain B, Structure Of The Cif:nedd8 Complex - Yersinia Pseudotuberculosis Cycle Inhibiting Factor In Complex With Human Nedd8 Length = 88 Back     alignment and structure
>pdb|2GBK|A Chain A, Crystal Structure Of The 9-10 Moad Insertion Mutant Of Ubiquitin Length = 83 Back     alignment and structure
>pdb|2GBJ|A Chain A, Crystal Structure Of The 9-10 8 Glycine Insertion Mutant Of Ubiquitin. Length = 84 Back     alignment and structure
>pdb|1NDD|B Chain B, Structure Of Nedd8 Length = 76 Back     alignment and structure
>pdb|3GZN|I Chain I, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 82 Back     alignment and structure
>pdb|2BKR|B Chain B, Nedd8 Nedp1 Complex Length = 77 Back     alignment and structure
>pdb|4HCP|B Chain B, Crystal Structure Of Burkholderia Pseudomallei Effector Protein Chbp In Complex With Nedd8 Length = 78 Back     alignment and structure
>pdb|1UEL|A Chain A, Solution Structure Of Ubiquitin-Like Domain Of Hhr23b Complexed With Ubiquitin-Interacting Motif Of Proteasome Subunit S5a Length = 95 Back     alignment and structure
>pdb|2GBR|A Chain A, Crystal Structure Of The 35-36 Moad Insertion Mutant Of Ubiquitin Length = 81 Back     alignment and structure
>pdb|1C3T|A Chain A, Rotamer Strain As A Determinant Of Protein Structural Specificity Length = 76 Back     alignment and structure
>pdb|4II3|B Chain B, Crystal Structure Of S. Pombe Ubiquitin Activating Enzyme 1 (uba1) In Complex With Ubiquitin And Atp/mg Length = 96 Back     alignment and structure
>pdb|4HCN|B Chain B, Crystal Structure Of Burkholderia Pseudomallei Effector Protein Chbp In Complex With Ubiquitin Length = 98 Back     alignment and structure
>pdb|4II2|B Chain B, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 83 Back     alignment and structure
>pdb|4GSW|A Chain A, Crystal Structure Of Ubiquitin From Entamoeba Histolytica To 2.15 Angstrom Length = 80 Back     alignment and structure
>pdb|3U5E|MM Chain m, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 60s Subunit, Ribosome A Length = 128 Back     alignment and structure
>pdb|1OTR|B Chain B, Solution Structure Of A Cue-Ubiquitin Complex Length = 76 Back     alignment and structure
>pdb|3U5G|FF Chain f, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 40s Subunit, Ribosome B Length = 152 Back     alignment and structure
>pdb|3U5C|FF Chain f, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 40s Subunit, Ribosome A Length = 152 Back     alignment and structure
>pdb|3OLM|D Chain D, Structure And Function Of A Ubiquitin Binding Site Within The Catalytic Domain Of A Hect Ubiquitin Ligase Length = 79 Back     alignment and structure
>pdb|3L0W|B Chain B, Structure Of Split Monoubiquitinated Pcna With Ubiquitin In Position Two Length = 169 Back     alignment and structure
>pdb|1ZW7|A Chain A, Elimination Of The C-Cap In Ubiquitin Structure, Dynamics And Thermodynamic Consequences Length = 82 Back     alignment and structure
>pdb|3ZF7|SS Chain s, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 128 Back     alignment and structure
>pdb|2GBM|A Chain A, Crystal Structure Of The 35-36 8 Glycine Insertion Mutant Of Ubiquitin Length = 84 Back     alignment and structure
>pdb|4HK2|A Chain A, U7ub25.2540 Length = 78 Back     alignment and structure
>pdb|1P1A|A Chain A, Nmr Structure Of Ubiquitin-Like Domain Of Hhr23b Length = 85 Back     alignment and structure
>pdb|2JWZ|A Chain A, Mutations In The Hydrophobic Core Of Ubiquitin Differentially Affect Its Recognition By Receptor Proteins Length = 76 Back     alignment and structure
>pdb|4HJK|A Chain A, U7ub7 Disulfide Variant Length = 77 Back     alignment and structure
>pdb|2JVC|A Chain A, Nmr Solution Structure Of Ubiquitin Like Protein Length = 82 Back     alignment and structure
>pdb|1GJZ|A Chain A, Solution Structure Of A Dimeric N-Terminal Fragment Of Human Ubiquitin Length = 53 Back     alignment and structure
>pdb|3DQV|A Chain A, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation Length = 81 Back     alignment and structure
>pdb|1SIF|A Chain A, Crystal Structure Of A Multiple Hydrophobic Core Mutant Of Ubiquitin Length = 88 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query380
2i1a_A148 DNA damage-inducible protein DDI1; acid protease f 5e-58
3s8i_A148 Protein DDI1 homolog 1; protease, structural genom 7e-53
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 3e-21
3m62_B106 UV excision repair protein RAD23; armadillo-like r 3e-18
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 3e-16
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 5e-15
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 9e-15
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 1e-14
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 2e-14
3u5c_F225 RP14, S2, YS8, 40S ribosomal protein S5; translati 3e-14
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 4e-14
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 7e-14
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 8e-14
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 9e-14
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 1e-13
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 1e-13
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 2e-13
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 4e-13
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 4e-13
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 5e-13
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 6e-13
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 7e-13
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 7e-13
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 7e-13
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 8e-13
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 3e-12
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 3e-12
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 3e-12
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 4e-12
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 4e-12
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 4e-12
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 5e-12
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 5e-12
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 6e-12
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 7e-12
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 8e-12
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 8e-12
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 9e-12
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 1e-11
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 1e-11
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 1e-11
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 4e-11
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 1e-10
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 2e-10
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 2e-10
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 3e-10
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 7e-10
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 1e-09
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 8e-10
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 3e-07
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 1e-09
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 3e-09
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 1e-07
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 7e-09
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 2e-08
1we6_A111 Splicing factor, putative; structural genomics, ub 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2fnj_B118 Transcription elongation factor B polypeptide 2; b 3e-07
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 4e-07
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 5e-06
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 7e-06
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 2e-05
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 4e-05
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 7e-05
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 7e-05
>2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} Length = 148 Back     alignment and structure
 Score =  184 bits (469), Expect = 5e-58
 Identities = 74/150 (49%), Positives = 105/150 (70%), Gaps = 3/150 (2%)

Query: 171 IRQKGIDENWAAALEHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCG 230
           ++Q+ IDE    A+E+ PE F +V MLY+++E+N  P+KAFVD+GAQ+TI+S   A++ G
Sbjct: 1   MKQQAIDEQLRNAIEYTPEMFTQVPMLYINIEINNYPVKAFVDTGAQTTIMSTRLAKKTG 60

Query: 231 LLRLLDDRYRGVAHGVGQSEILGRIHVAPIKIGNVFYPCSFVVLDSPNMEFLFGLDMLRK 290
           L R++D R+ G A GVG  +I+GRIH A +KI   + PCSF VLD+  ++ L GLDML++
Sbjct: 61  LSRMIDKRFIGEARGVGTGKIIGRIHQAQVKIETQYIPCSFTVLDTD-IDVLIGLDMLKR 119

Query: 291 HQCIIDLKENVLRVGGGEVSVPFLQEKDIP 320
           H   +DLKENVLR+    V   FL E +IP
Sbjct: 120 HLACVDLKENVLRIAE--VETSFLSEAEIP 147


>3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} Length = 148 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Length = 85 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Length = 84 Back     alignment and structure
>3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 87 Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 94 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} Length = 85 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 85 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: k.45.1.1 PDB: 3dbr_I 3dbl_I Length = 88 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Length = 88 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Length = 76 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Length = 76 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Length = 114 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Length = 128 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Length = 88 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Length = 98 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Length = 189 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 89 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Length = 96 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Length = 111 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Length = 79 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 78 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Length = 90 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Length = 169 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Length = 152 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Length = 152 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Length = 115 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Length = 172 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Length = 172 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 92 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Length = 189 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 111 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Length = 118 Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 93 Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Length = 105 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 105 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Length = 107 Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Length = 122 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query380
3s8i_A148 Protein DDI1 homolog 1; protease, structural genom 100.0
2i1a_A148 DNA damage-inducible protein DDI1; acid protease f 100.0
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 99.72
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.71
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.71
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.7
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.7
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.69
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 99.69
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.69
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.69
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.67
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.67
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.67
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.67
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.66
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.66
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.66
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.65
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.65
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.65
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.65
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.65
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.65
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.65
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.64
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.64
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.64
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.64
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.64
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.63
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 99.63
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 99.63
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.62
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.62
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.62
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 99.61
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.61
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.61
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.6
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 99.39
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 99.6
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 99.6
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.6
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.59
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.59
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.58
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 99.58
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.58
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 99.57
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.57
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.57
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.57
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 99.57
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 99.56
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 99.56
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 99.56
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 99.56
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.55
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.55
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.55
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 99.55
4ajy_B118 Transcription elongation factor B polypeptide 2; E 99.54
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.53
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.53
1we6_A111 Splicing factor, putative; structural genomics, ub 99.53
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.53
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 99.52
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 99.52
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 99.52
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.51
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 99.51
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.5
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.48
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 99.47
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 99.47
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 99.46
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 99.46
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.45
2kj6_A97 Tubulin folding cofactor B; methods development, N 99.45
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.45
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 99.45
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 99.45
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 99.43
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 99.37
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 99.34
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 99.33
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 99.26
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 99.26
3slz_A132 GAG-Pro-POL polyprotein; beta sheet and dimer, pro 99.23
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 99.22
1fmb_A104 EIAV protease; hydrolase (acid proteinase), RNA-di 99.2
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 99.2
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 99.15
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 99.13
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 99.11
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 99.07
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 99.06
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 99.0
3ec0_A99 Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1 98.97
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 98.97
2hs1_A99 HIV-1 protease; ultra-high resolution active site 98.94
3ka2_A203 [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro 98.78
2hah_A116 Protease, retropepsin; retroviral, aspartyl, hydro 98.64
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 98.64
2pjh_A80 Protein NPL4, nuclear protein localization protein 98.54
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 98.38
3ka2_A203 [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro 98.32
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 98.31
3sqf_A114 Protease; folded monomer, retropepsin, D-type retr 98.12
2rsp_A124 RSV protease; hydrolase(aspartyl proteinase); 2.00 98.1
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 98.09
3v7o_A227 Minor nucleoprotein VP30; ssgcid, seattle structur 98.03
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 98.02
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 97.84
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 97.74
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 97.72
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 97.63
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 97.5
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 97.44
3ix6_A360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 97.32
2pma_A146 Uncharacterized protein; APC86035.2, protein LPG00 97.12
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 97.1
3liy_A116 Protease; hydrolase, hydrolase-hydrolase inhibitor 97.04
4da1_A389 Protein phosphatase 1K, mitochondrial; metal-ION-a 96.96
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 96.82
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 96.33
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 96.1
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 95.54
2jys_A107 Protease/reverse transcriptase; retroviral proteas 95.35
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 95.3
3qvc_A 451 Histo-aspartic protease; HAP, plasmepsin, zymogen, 95.11
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 94.92
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 94.62
2x0b_A 383 Renin; hydrolase-hormone complex, hydrolase hormon 94.49
1pve_A72 HHR23B, UV excision repair protein RAD23 homolog B 94.38
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 93.8
1yg9_A 330 Aspartic protease BLA G 2; allegren, hydrolase, al 93.33
4e71_A111 Plexin-B2, MM1; transmembrane, signaling, RBD, str 93.29
1miq_A 375 Plasmepsin; aspartic proteinase zymogen, domain op 93.19
2bju_A 453 Plasmepsin II; aspartic proteinase, drug design, m 93.12
3k1w_A 341 Renin; protease, alternative splicing, aspartyl pr 92.93
2f4m_B61 UV excision repair protein RAD23 homolog B; glycop 92.92
3cms_A 323 Chymosin B; hydrolase, acid proteinase; 2.00A {Bos 92.85
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 92.82
1b5f_A239 Protein (cardosin A); hydrolase, aspartic proteina 92.78
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 92.5
1tzs_A 351 Cathepsin E; hydrolase, aspartic protease, activat 92.5
1bxo_A 323 Protein (penicillopepsin); hydrolase, phosphonate 92.47
3psg_A 370 Pepsinogen; hydrolase(acid proteinase zymogen); 1. 92.45
1izd_A 323 Aspartic proteinase; sugar binding, acid protease, 92.4
4aa9_A 320 Chymosin; hydrolase, aspartic peptidase, rennet; H 92.31
1ibq_A 325 Aspergillopepsin; aspartic proteinase, hydrolase; 92.18
1mpp_A 361 Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu 92.09
2r2o_A138 Plexin-B1; effector domain, structural genomics, s 91.82
1dpj_A 329 Proteinase A; proteinase A, hydrolase-hydrolase in 91.76
1wkr_A 340 Polyporopepsin; hydrolase, hydrolase-hydrolase inh 91.66
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 91.59
3c9x_A 329 Trichoderma reesei aspartic protease; aspartic pro 91.5
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 91.43
1htr_B 329 Gastricsin; aspartyl protease; 1.62A {Homo sapiens 90.79
3fv3_A 339 SAPP1P-secreted aspartic protease 1; secreted aspa 90.53
1oew_A 329 Endothiapepsin; hydrolase, aspartic proteinase mec 90.48
3qvc_A451 Histo-aspartic protease; HAP, plasmepsin, zymogen, 90.37
3pvk_A 342 Candidapepsin-2; hydrolase; 1.27A {Candida albican 90.36
1qdm_A 478 Prophytepsin; aspartic proteinases, saposin-like d 90.22
3cms_A323 Chymosin B; hydrolase, acid proteinase; 2.00A {Bos 90.06
1lya_B241 Cathepsin D; lysosomal aspartic protease; HET: NAG 89.74
1ibq_A325 Aspergillopepsin; aspartic proteinase, hydrolase; 89.73
1izd_A323 Aspartic proteinase; sugar binding, acid protease, 89.6
2apr_A 325 Rhizopuspepsin; hydrolase (aspartic proteinase); 1 89.18
1lya_A97 Cathepsin D; lysosomal aspartic protease; HET: NAG 89.16
2apr_A325 Rhizopuspepsin; hydrolase (aspartic proteinase); 1 88.98
1am5_A 324 Pepsin, acid proteinase; aspartyl protease, hydrol 88.98
1am5_A324 Pepsin, acid proteinase; aspartyl protease, hydrol 88.86
2qzx_A 342 Candidapepsin-5; aspartic proteinase, aspartyl pro 88.76
4aa9_A320 Chymosin; hydrolase, aspartic peptidase, rennet; H 88.71
1j71_A 334 Candidapepsin, aspartic proteinase; candida tropic 88.57
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 88.48
4e74_A117 Plexin-A4; RBD, structural genomics, structural ge 88.39
1dpj_A329 Proteinase A; proteinase A, hydrolase-hydrolase in 88.01
1yg9_A330 Aspartic protease BLA G 2; allegren, hydrolase, al 87.98
1bxo_A323 Protein (penicillopepsin); hydrolase, phosphonate 87.9
1miq_A375 Plasmepsin; aspartic proteinase zymogen, domain op 87.84
3h6n_A127 Plexin-D1; structural genomics consortium, SGC, me 87.84
2juo_A89 GA-binding protein alpha chain; OST, ubiquitin, tr 87.79
1oew_A329 Endothiapepsin; hydrolase, aspartic proteinase mec 87.59
3c9x_A329 Trichoderma reesei aspartic protease; aspartic pro 87.4
3k1w_A341 Renin; protease, alternative splicing, aspartyl pr 87.32
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 87.25
3lpj_A 455 Beta-secretase 1; alzheimer'S, aspartyl protease, 87.24
3fv3_A339 SAPP1P-secreted aspartic protease 1; secreted aspa 87.01
2llw_A71 Heat shock protein STI1; DP domain, alpha helix, c 86.83
1wkr_A340 Polyporopepsin; hydrolase, hydrolase-hydrolase inh 86.28
3aup_A403 SBG7S, BG, basic 7S globulin; pepsin-like fold, pl 86.22
1htr_B329 Gastricsin; aspartyl protease; 1.62A {Homo sapiens 85.92
3vf3_A 402 Beta-secretase 1; structure-based drug design, hyd 85.91
3aup_A 403 SBG7S, BG, basic 7S globulin; pepsin-like fold, pl 85.91
2bju_A453 Plasmepsin II; aspartic proteinase, drug design, m 85.86
2x0b_A383 Renin; hydrolase-hormone complex, hydrolase hormon 85.22
1tzs_A351 Cathepsin E; hydrolase, aspartic protease, activat 85.13
2f4m_B61 UV excision repair protein RAD23 homolog B; glycop 85.07
2kvr_A130 Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi 84.97
2qzx_A342 Candidapepsin-5; aspartic proteinase, aspartyl pro 84.85
2qp8_A 395 Beta-secretase 1; BACE1, protease, alternative spl 84.67
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 84.39
1mpp_A361 Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu 84.35
1pve_A72 HHR23B, UV excision repair protein RAD23 homolog B 84.27
2ewy_A 383 Beta-secretase 2; BACE2, aspartic protease, hydrol 84.23
1j71_A334 Candidapepsin, aspartic proteinase; candida tropic 83.87
1f0z_A66 THis protein; ubiquitin fold, transport protein; N 83.07
3pvk_A342 Candidapepsin-2; hydrolase; 1.27A {Candida albican 82.75
3psg_A370 Pepsinogen; hydrolase(acid proteinase zymogen); 1. 82.72
3kuz_A126 Plexin-C1; structural genomics, structural genomic 82.12
>3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=5.3e-37  Score=267.53  Aligned_cols=136  Identities=53%  Similarity=0.942  Sum_probs=119.9

Q ss_pred             hcCCccccccceeEEeeeecCeeEEEEEcCCccccccCHHHHHHcCCccccCCcceeEeecCcceeEEeEEEEEeEEEcC
Q 016931          185 EHNPEAFARVVMLYVDMEVNGIPLKAFVDSGAQSTIISKSCAERCGLLRLLDDRYRGVAHGVGQSEILGRIHVAPIKIGN  264 (380)
Q Consensus       185 E~~Pe~f~~~~~lyv~v~Ing~~v~alVDTGA~~siIs~~~a~rlgL~~~~~~~~~~~~~gvg~~~~~g~i~~~~i~ig~  264 (380)
                      -..||+|+++.|+||+|+|||++++|||||||++|+||.+||+||||.++.+.++.+.+.|+|+.++.|+++.++|+||+
T Consensus        13 ~~~~~~~~~~~~l~v~~~Ing~~v~~LVDTGAs~s~Is~~~A~rlGL~~~~~~~~~~~a~g~G~~~~~g~v~~~~I~Ig~   92 (148)
T 3s8i_A           13 GLVPRGSGQVTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIGRVHLAQIQIEG   92 (148)
T ss_dssp             ---------CCCCEEEEEETTEEEEEEECTTCSSCEEEHHHHHHTTCGGGEEGGGCEECCC---CEEEEEEEEEEEEETT
T ss_pred             CcCceeccccCEEEEEEEECCEEEEEEEeCCCCcEeeCHHHHHHcCCccccCcceeEEEEcCCccEEEEEEEEEEEEECC
Confidence            34799999999999999999999999999999999999999999999888888888899999999999999999999999


Q ss_pred             EEEeEEEEEecCCCCceeeeHHHHhhcCeEEEcCCCEEEEcCCceeeeccCCCCCC
Q 016931          265 VFYPCSFVVLDSPNMEFLFGLDMLRKHQCIIDLKENVLRVGGGEVSVPFLQEKDIP  320 (380)
Q Consensus       265 ~~~~~~~~Vl~~~~~d~iLG~D~L~~~~~~ID~~~~~l~i~~~~~~~pfl~~~e~~  320 (380)
                      ..++++|.|++...+|+|||||||++++|+|||++++|+|+++++++||++|+|||
T Consensus        93 ~~~~~~~~Vle~~~~d~LLGmD~L~~~~~~ID~~~~~L~l~~~~~~~pfl~~~~~~  148 (148)
T 3s8i_A           93 DFLQCSFSILEDQPMDMLLGLDMLRRHQCSIDLKKNVLVIGTTGTQTYFLPEGELP  148 (148)
T ss_dssp             EEEEEEEEEETTCSSSEEECHHHHHHTTCEEETTTTEEECTTTCCEEECCCGGGCC
T ss_pred             EEEEEEEEEeCCCCcCeeccHHHHHhCCEEEEcCCCEEEEccCCeEEeecCcccCc
Confidence            99999999999989999999999999999999999999999877899999999997



>2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>3slz_A GAG-Pro-POL polyprotein; beta sheet and dimer, protease, peptide inhibitor, TL-3 PEPS virus, hydrolase-hydrolase inhibitor complex; HET: 3TL; 1.40A {Dg-75 murine leukemia virus} PDB: 3nr6_A* 3sm1_A* 3sm2_A* 4exh_A* Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1fmb_A EIAV protease; hydrolase (acid proteinase), RNA-directed DNA polymerase, AS protease, endonuclease, polyprotein; HET: HYB; 1.80A {Equine infectious anemia virus} SCOP: b.50.1.1 PDB: 2fmb_A* Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>3ec0_A Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1.18A {Human immunodeficiency virus type 2} SCOP: b.50.1.1 PDB: 1hii_A* 1hsi_A 1hsh_A* 1idb_A* 1jld_A* 2mip_A 1ida_A* 3ebz_A* 3ecg_A* 3s45_A* 4upj_A* 1ivq_A* 1ivp_A 2hpf_A 3upj_A* 2hpe_A* 5upj_A* 6upj_A* 1sip_A 1tcw_A* ... Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>2hs1_A HIV-1 protease; ultra-high resolution active site surface binding site, HYDR; HET: 017; 0.84A {Human immunodeficiency virus 1} PDB: 3nu4_A* 3tl9_A* 3tkw_A* 3tkg_A* 3ndu_A* 3ndt_A* 3k4v_A* 3a2o_A* 1fgc_C* 2a1e_A* 2aod_A* 2aoi_A* 2aoj_A* 2hb3_A* 2ien_A* 1sdt_A* 2z4o_A* 2zye_A* 2nmw_A* 3b7v_A* ... Back     alignment and structure
>3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... Back     alignment and structure
>2hah_A Protease, retropepsin; retroviral, aspartyl, hydrolase-hydrolase complex; HET: 3TL; 1.70A {Feline immunodeficiency virus} PDB: 3ogp_A* 3ogq_A* 2fiv_A* 6fiv_A* 3fiv_A* 5fiv_A* 4fiv_A* 1fiv_A* 1b11_A* Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3sqf_A Protease; folded monomer, retropepsin, D-type retrovirus; 1.63A {Mason-pfizer monkey virus} SCOP: b.50.1.1 PDB: 1nso_A Back     alignment and structure
>2rsp_A RSV protease; hydrolase(aspartyl proteinase); 2.00A {Rous sarcoma virus} SCOP: b.50.1.1 PDB: 1mvp_A 1bai_A* Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>2pma_A Uncharacterized protein; APC86035.2, protein LPG0085, DUF785, legionella pneumophila pneumophila STR. philadelphia 1; 1.89A {Legionella pneumophila subsp} SCOP: b.50.1.3 Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>3liy_A Protease; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.86A {Human t-lymphotropic virus 1} PDB: 2b7f_A* 3liq_A* 3lit_A* 3liv_A* 3lix_A* 3lin_A* Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2jys_A Protease/reverse transcriptase; retroviral protease, hydrolase; NMR {Simian foamy virus type 1} Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Back     alignment and structure
>1pve_A HHR23B, UV excision repair protein RAD23 homolog B; XPC binding domain, solution structure, nucleotide excision repair, chaps, DNA binding protein; NMR {Homo sapiens} SCOP: a.189.1.1 Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Back     alignment and structure
>4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} Back     alignment and structure
>1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Back     alignment and structure
>2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Back     alignment and structure
>3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Back     alignment and structure
>2f4m_B UV excision repair protein RAD23 homolog B; glycoproteins, ubiquitin-dependent protein degradation, NUCL excision repair, peptide:N-glycanase; 1.85A {Mus musculus} SCOP: a.189.1.1 PDB: 2f4o_B* Back     alignment and structure
>3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Back     alignment and structure
>1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Back     alignment and structure
>3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Back     alignment and structure
>1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Back     alignment and structure
>4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A Back     alignment and structure
>1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Back     alignment and structure
>1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Back     alignment and structure
>2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A Back     alignment and structure
>1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Back     alignment and structure
>1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Back     alignment and structure
>3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* Back     alignment and structure
>1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Back     alignment and structure
>3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Back     alignment and structure
>3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Back     alignment and structure
>1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Back     alignment and structure
>3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Back     alignment and structure
>1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Back     alignment and structure
>1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Back     alignment and structure
>1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Back     alignment and structure
>2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Back     alignment and structure
>1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* Back     alignment and structure
>2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Back     alignment and structure
>1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Back     alignment and structure
>1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Back     alignment and structure
>2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Back     alignment and structure
>4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A Back     alignment and structure
>1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Back     alignment and structure
>4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* Back     alignment and structure
>1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Back     alignment and structure
>1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Back     alignment and structure
>1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Back     alignment and structure
>1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Back     alignment and structure
>3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} Back     alignment and structure
>2juo_A GA-binding protein alpha chain; OST, ubiquitin, transcription factor, ensemble, DNA-binding, nucleus, transcription regulation; NMR {Mus musculus} Back     alignment and structure
>1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Back     alignment and structure
>3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Back     alignment and structure
>3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 4fse_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Back     alignment and structure
>3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* Back     alignment and structure
>2llw_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Back     alignment and structure
>3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Back     alignment and structure
>1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Back     alignment and structure
>3vf3_A Beta-secretase 1; structure-based drug design, hydrolase-hydrolase inhibitor C; HET: 0GS; 1.48A {Homo sapiens} PDB: 2f3e_A* 2f3f_A* 1ym2_A* 3dv1_A* 3dv5_A* 3k5c_A* 3k5f_A* 3k5g_A* 3pi5_A* 3qbh_A* 3duy_A* 3veu_A* 3vg1_A* 4d83_A* 4d88_A* 4d89_A* 4d8c_A* 3msk_A* 3k5d_A* 1ym4_A* ... Back     alignment and structure
>3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Back     alignment and structure
>2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Back     alignment and structure
>2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Back     alignment and structure
>1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Back     alignment and structure
>2f4m_B UV excision repair protein RAD23 homolog B; glycoproteins, ubiquitin-dependent protein degradation, NUCL excision repair, peptide:N-glycanase; 1.85A {Mus musculus} SCOP: a.189.1.1 PDB: 2f4o_B* Back     alignment and structure
>2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} Back     alignment and structure
>2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Back     alignment and structure
>2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure
>1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Back     alignment and structure
>1pve_A HHR23B, UV excision repair protein RAD23 homolog B; XPC binding domain, solution structure, nucleotide excision repair, chaps, DNA binding protein; NMR {Homo sapiens} SCOP: a.189.1.1 Back     alignment and structure
>2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Back     alignment and structure
>1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Back     alignment and structure
>1f0z_A THis protein; ubiquitin fold, transport protein; NMR {Escherichia coli} SCOP: d.15.3.2 PDB: 1zud_2 Back     alignment and structure
>3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Back     alignment and structure
>3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Back     alignment and structure
>3kuz_A Plexin-C1; structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 380
d2bwfa173 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc 2e-14
d1v5oa_102 d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus mu 3e-14
d1oqya477 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h 3e-14
d1ogwa_76 d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [Tax 4e-14
d1wx9a173 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 2e-13
d1bt0a_73 d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t 2e-13
d1wxva181 d.15.1.1 (A:7-87) Bag-family molecular chaperone r 5e-13
d1z2ma276 d.15.1.1 (A:79-154) Interferon-induced 15 kDa prot 6e-13
d1v5ta_90 d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus mu 8e-13
d1wgga_96 d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolas 1e-12
d1uela_95 d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homol 2e-12
d1wh3a_87 d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like 2e-12
d1wiaa_95 d.15.1.1 (A:) Ubiquitin-like protein bab25500 (201 6e-12
d1wgda_93 d.15.1.1 (A:) Homocysteine-responsive endoplasmic 7e-12
d1v86a_95 d.15.1.1 (A:) hypothetical D7wsu128e protein {Mous 8e-12
d1zkha186 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t 1e-11
d1wx8a183 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul 4e-11
d1wy8a176 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING fing 5e-11
d1yqba184 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapien 7e-11
d1wjua_100 d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human 9e-11
d1j8ca_103 d.15.1.1 (A:) Ubiquitin-like N-terminal domain of 1e-10
d1v2ya_105 d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik 1e-10
d1z2ma176 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protei 2e-10
d2zeqa178 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin 5e-10
d2c9wb1103 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) 6e-10
d1wjna_97 d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse 1e-09
d2faza176 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING fing 1e-09
d2uyzb177 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human 2e-09
d1v6ea_95 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 2e-09
d1wgha_116 d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mous 3e-09
d1uh6a_100 d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mous 4e-09
d1ttna180 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquit 6e-09
d1euvb_79 d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea 8e-08
d1m94a_73 d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 9e-08
d1t0ya_90 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 8e-07
d1se9a_101 d.15.1.1 (A:) Hypothetical protein At3g01050 {Thal 5e-06
d1x1ma194 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse 4e-05
d1wm3a_72 d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 0.002
d2fmba_104 b.50.1.1 (A:) EIAV protease {Equine infectious ane 0.004
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: DSK2
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 65.2 bits (159), Expect = 2e-14
 Identities = 14/70 (20%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 1  MRITVMTADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNAEKLSALG 60
          + I + +  ++   ++V P  TV   K  +     +P+  Q+L+Y+G+ + + + + +  
Sbjct: 2  LNIHIKSGQDKW-EVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYH 60

Query: 61 VKDEDLVMMV 70
          ++D   V +V
Sbjct: 61 IQDGHSVHLV 70


>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105 Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90 Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 101 Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2fmba_ b.50.1.1 (A:) EIAV protease {Equine infectious anemia virus [TaxId: 11665]} Length = 104 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query380
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.77
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 99.77
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.76
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 99.75
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 99.74
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.73
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.73
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.73
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.73
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.73
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.72
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.71
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.71
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.71
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.7
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.65
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.65
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.65
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.64
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.61
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.59
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 99.59
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.58
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.57
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 99.57
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.57
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.56
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.56
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 99.54
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 99.49
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.49
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 99.32
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 99.23
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 99.2
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 99.18
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 99.17
d2fmba_104 EIAV protease {Equine infectious anemia virus [Tax 98.96
d4fiva_113 Feline immunodeficiency virus (FIV) protease {Feli 98.64
d2nmza199 Human immunodeficiency virus type 1 protease {Huma 98.54
d1hvca_203 Human immunodeficiency virus type 1 protease {Huma 98.51
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 98.47
d3ecga199 Human immunodeficiency virus type 2 (HIV-2) protea 98.41
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 98.4
d1nsoa_107 Mason-Pfizer monkey virus protease {Simian retrovi 98.3
d1hvca_203 Human immunodeficiency virus type 1 protease {Huma 97.76
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 97.36
d2rspa_124 Rous sarcoma virus protease {Rous sarcoma virus, s 97.21
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 96.89
d2pmaa1141 Uncharacterized protein LPG0085 {Legionella pneumo 96.61
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 96.28
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 96.14
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 95.63
d1izea_323 Acid protease {Fungus (Aspergillus oryzae) [TaxId: 94.56
d1bxoa_323 Acid protease {Fungus (Penicillium janthinellum), 94.1
d2f4mb158 XPC-binding domain of Rad23 homolog B (Hhr23b) {Hu 93.68
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 92.96
d1wkra_340 Acid protease {Irpex lacteus (Polyporus tulipifera 91.96
d2f4mb158 XPC-binding domain of Rad23 homolog B (Hhr23b) {Hu 90.52
d3cmsa_323 Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId 89.96
d2apra_325 Acid protease {Bread mold (Rhizopus chinensis) [Ta 89.7
d2bjua1329 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 89.67
d1am5a_324 Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 89.34
d1miqa_ 373 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 88.95
d1smra_ 335 Chymosin (synonym: renin) {Mouse (Mus musculus) [T 88.92
d1wkra_ 340 Acid protease {Irpex lacteus (Polyporus tulipifera 88.46
d1miqa_373 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 88.09
d1dpja_329 Acid protease {Baker's yeast (Saccharomyces cerevi 87.55
d3psga_ 370 Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} 87.54
d1y8xb192 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 87.39
d1izea_ 323 Acid protease {Fungus (Aspergillus oryzae) [TaxId: 87.21
d1bxoa_ 323 Acid protease {Fungus (Penicillium janthinellum), 87.21
d1j71a_334 Acid protease {Yeast (Candida tropicalis) [TaxId: 86.78
d1oewa_ 330 Endothiapepsin {Chestnut blight fungus (Endothia p 86.5
d1t6ex_381 Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu 86.32
d3psga_370 Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} 85.97
d1qdma2337 Plant acid proteinase, phytepsin {Barley (Hordeum 85.96
d1oewa_330 Endothiapepsin {Chestnut blight fungus (Endothia p 85.62
d2apra_ 325 Acid protease {Bread mold (Rhizopus chinensis) [Ta 85.49
d1smra_335 Chymosin (synonym: renin) {Mouse (Mus musculus) [T 84.89
d2qp8a1387 beta-secretase (memapsin) {Human (Homo sapiens) [T 84.42
d1mppa_357 Pepsin {Mucor pusillus [TaxId: 4840]} 84.41
g1lya.1338 Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} 84.27
d2qp8a1 387 beta-secretase (memapsin) {Human (Homo sapiens) [T 84.06
d1hrna_337 Chymosin (synonym: renin) {Human (Homo sapiens) [T 83.39
d1eaga_342 Acid protease {Yeast (Candida albicans) [TaxId: 54 81.04
d2bjua1 329 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 81.02
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: 2'-5'-oligoadenylate synthetase-like protein, OASL
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.77  E-value=6.1e-19  Score=137.93  Aligned_cols=75  Identities=21%  Similarity=0.400  Sum_probs=71.8

Q ss_pred             CEEEEEeCCCCEEEEEeCCCCCHHHHHHHHHHHhCCCCcCeEEecCCeecCCcccchhcCCCCCcEEEEeecCCC
Q 016931            1 MRITVMTADEQIISLDVDPHETVENVKALLEVETQVPLQQQQLLYNGREMNNAEKLSALGVKDEDLVMMVSNAAS   75 (380)
Q Consensus         1 M~ItVk~~~g~~~~i~V~~~~TV~~LK~~I~~~~gip~~~q~Li~~Gk~L~D~~tL~~~gI~dg~~I~l~~~~~~   75 (380)
                      |+|+|++++|+.+.++|++++||.+||++|+.++|+|+++|+|+|+||.|+|++||++|||++|++|||+.+...
T Consensus         8 mqI~Vk~~~g~~~~l~v~~~~tV~~lK~~I~~~~gip~~~qrLi~~Gk~L~d~~tL~~y~I~~~stl~l~~r~~~   82 (87)
T d1wh3a_           8 IQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIYGIQDSDTLILSKKKGS   82 (87)
T ss_dssp             EEEEEEETTTEEEEEEECSSSBHHHHHHHHHHHTCCCTTTEEEEETTEECCSSSBHHHHTCCTTEEEEEEECSCC
T ss_pred             EEEEEECCCCCEEEEEECCcCcHHHHHHHHHHHHCcChHHeEEEeeceEcCCCCcHHHcCCCCCCEEEEEecCCC
Confidence            899999999999999999999999999999999999999999999999999999999999999999999976443



>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fmba_ b.50.1.1 (A:) EIAV protease {Equine infectious anemia virus [TaxId: 11665]} Back     information, alignment and structure
>d4fiva_ b.50.1.1 (A:) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus [TaxId: 11673]} Back     information, alignment and structure
>d2nmza1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3ecga1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nsoa_ b.50.1.1 (A:) Mason-Pfizer monkey virus protease {Simian retrovirus 1, SRV-1 [TaxId: 11942]} Back     information, alignment and structure
>d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rspa_ b.50.1.1 (A:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C [TaxId: 11886]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmaa1 b.50.1.3 (A:26-166) Uncharacterized protein LPG0085 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Back     information, alignment and structure
>d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Back     information, alignment and structure
>d2f4mb1 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Back     information, alignment and structure
>d2f4mb1 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Back     information, alignment and structure
>d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Back     information, alignment and structure
>d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Back     information, alignment and structure
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Back     information, alignment and structure
>d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Back     information, alignment and structure
>d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Back     information, alignment and structure
>d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Back     information, alignment and structure
>d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Back     information, alignment and structure