Citrus Sinensis ID: 016954
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 380 | ||||||
| 255538534 | 480 | zinc ion binding protein, putative [Rici | 0.978 | 0.775 | 0.747 | 1e-165 | |
| 302142429 | 462 | unnamed protein product [Vitis vinifera] | 0.981 | 0.807 | 0.740 | 1e-162 | |
| 359492104 | 482 | PREDICTED: protein DA1 [Vitis vinifera] | 0.981 | 0.773 | 0.734 | 1e-161 | |
| 449470017 | 480 | PREDICTED: protein DA1-like [Cucumis sat | 0.978 | 0.775 | 0.712 | 1e-159 | |
| 224063585 | 450 | predicted protein [Populus trichocarpa] | 0.907 | 0.766 | 0.711 | 1e-156 | |
| 115466772 | 486 | Os06g0182500 [Oryza sativa Japonica Grou | 0.994 | 0.777 | 0.681 | 1e-154 | |
| 242092232 | 486 | hypothetical protein SORBIDRAFT_10g00557 | 0.994 | 0.777 | 0.683 | 1e-153 | |
| 356552147 | 468 | PREDICTED: protein DA1-like isoform 2 [G | 0.955 | 0.775 | 0.717 | 1e-152 | |
| 356552145 | 478 | PREDICTED: protein DA1-like isoform 1 [G | 0.960 | 0.763 | 0.707 | 1e-151 | |
| 219888221 | 508 | unknown [Zea mays] | 0.994 | 0.744 | 0.652 | 1e-151 |
| >gi|255538534|ref|XP_002510332.1| zinc ion binding protein, putative [Ricinus communis] gi|223551033|gb|EEF52519.1| zinc ion binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 587 bits (1514), Expect = e-165, Method: Compositional matrix adjust.
Identities = 281/376 (74%), Positives = 321/376 (85%), Gaps = 4/376 (1%)
Query: 3 WLSKIFKGSSHSITEGHSHRNYGEDPHCYAPSTSGDLPLEQENEDIDRAIALSLLEENQK 62
WLSKIFKGSSH+I+EGH NYG+DP+ YAPSTSG EQENEDI+RAI SLLEENQ
Sbjct: 4 WLSKIFKGSSHNISEGHYRGNYGQDPNYYAPSTSGVEWSEQENEDINRAIEWSLLEENQT 63
Query: 63 GENVIDKESQVEEDEQLARAIQESLNLESPPRQGTAHTYQHFPVIQFPEGY----RICAG 118
G+ VI+ E+Q+EEDEQLARAIQE LN+ESPPR G + + P RICAG
Sbjct: 64 GKRVINNENQLEEDEQLARAIQEILNVESPPRYGYGYGNGNGNGNDEPRLSLFLCRICAG 123
Query: 119 CNNEIGHGRFLNCLDVFWHPECFCCHACHQPITDIEFSTSENRPYHKSCYREHYHPKCDV 178
CN EIGHGRFLNCL+ FWHPECF CHAC+ PI+D EFS + N PYHKSCY+E YHPKCDV
Sbjct: 124 CNTEIGHGRFLNCLNAFWHPECFRCHACNLPISDYEFSMTGNYPYHKSCYKERYHPKCDV 183
Query: 179 CKHFIPSNHGGLIEYRAHPFWVQKYCPSHEHDGTPRCCSCERMEPQDTAYVALDDGRKLC 238
CK+FIP+N GLIEYRAHPFW+QKYCPSHEHDGTPRCCSCERME +DT Y+AL DGRKLC
Sbjct: 184 CKYFIPTNPAGLIEYRAHPFWIQKYCPSHEHDGTPRCCSCERMEARDTGYIALSDGRKLC 243
Query: 239 LECLDSAIMDTNECQPLYLDIQEFYESIHMKLEQQIPLLLVERQALNEARDGEKNGYYHM 298
LECLDSAIMDTNECQPLYLDIQEFYES++M++EQ +PLLLVERQALNEAR+GEKNG+YH+
Sbjct: 244 LECLDSAIMDTNECQPLYLDIQEFYESLNMRVEQHVPLLLVERQALNEAREGEKNGHYHI 303
Query: 299 PETRGLCLSEEQTVTTVLWRPRFGPGNQARNIITEPYKLTRRCDVTAILILYGLPRLLTG 358
PETRGLCLSEEQT++ VL RP+FG GN+A ++TEPYKL RRC+VTAILIL+GLPRLLTG
Sbjct: 304 PETRGLCLSEEQTISRVLKRPKFGAGNRAMGMVTEPYKLMRRCEVTAILILFGLPRLLTG 363
Query: 359 TILAHEMMHGWMRLQG 374
+ILAHEMMH WMRL+G
Sbjct: 364 SILAHEMMHAWMRLRG 379
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|302142429|emb|CBI19632.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359492104|ref|XP_002283584.2| PREDICTED: protein DA1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449470017|ref|XP_004152715.1| PREDICTED: protein DA1-like [Cucumis sativus] gi|449496042|ref|XP_004160020.1| PREDICTED: protein DA1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224063585|ref|XP_002301214.1| predicted protein [Populus trichocarpa] gi|222842940|gb|EEE80487.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|115466772|ref|NP_001056985.1| Os06g0182500 [Oryza sativa Japonica Group] gi|55771369|dbj|BAD72536.1| LIM domain containing protein-like [Oryza sativa Japonica Group] gi|113595025|dbj|BAF18899.1| Os06g0182500 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|242092232|ref|XP_002436606.1| hypothetical protein SORBIDRAFT_10g005570 [Sorghum bicolor] gi|241914829|gb|EER87973.1| hypothetical protein SORBIDRAFT_10g005570 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|356552147|ref|XP_003544431.1| PREDICTED: protein DA1-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356552145|ref|XP_003544430.1| PREDICTED: protein DA1-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|219888221|gb|ACL54485.1| unknown [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 380 | ||||||
| TAIR|locus:2115290 | 553 | AT4G36860 [Arabidopsis thalian | 0.863 | 0.593 | 0.678 | 1.8e-142 | |
| TAIR|locus:2202175 | 532 | DA1 "DA1" [Arabidopsis thalian | 0.713 | 0.509 | 0.765 | 1.6e-128 | |
| TAIR|locus:2063932 | 528 | DAR2 "DA1-related protein 2" [ | 0.95 | 0.683 | 0.526 | 1.5e-106 | |
| TAIR|locus:2154880 | 644 | DAR6 "DA1-related protein 6" [ | 0.8 | 0.472 | 0.514 | 9.1e-84 | |
| TAIR|locus:2170338 | 1613 | DAR4 "DA1-related protein 4" [ | 0.828 | 0.195 | 0.459 | 6.6e-72 | |
| TAIR|locus:2154890 | 702 | DAR5 "DA1-related protein 5" [ | 0.65 | 0.351 | 0.501 | 7.2e-68 | |
| ZFIN|ZDB-GENE-040121-6 | 649 | ldb3a "LIM-domain binding fact | 0.168 | 0.098 | 0.446 | 1.3e-08 | |
| UNIPROTKB|O43294 | 461 | TGFB1I1 "Transforming growth f | 0.260 | 0.214 | 0.333 | 2.1e-08 | |
| UNIPROTKB|Q3MHZ4 | 456 | TGFB1I1 "Transforming growth f | 0.260 | 0.217 | 0.333 | 2.7e-08 | |
| UNIPROTKB|E2RTE0 | 461 | TGFB1I1 "Uncharacterized prote | 0.260 | 0.214 | 0.333 | 2.7e-08 |
| TAIR|locus:2115290 AT4G36860 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1269 (451.8 bits), Expect = 1.8e-142, Sum P(2) = 1.8e-142
Identities = 226/333 (67%), Positives = 273/333 (81%)
Query: 42 EQENEDIDRAIALSLLEENQKGENVIDKESQVEEDEQLARAIQESLNLESPPRQGTAHTY 101
E + E+ ++ +A + LEE E + ++Q+EEDE LA+A+QES+N+ SPPR +
Sbjct: 121 EAQLEETEKLLAKARLEE----EEMRRSKAQLEEDELLAKALQESMNVGSPPRYDPGNIL 176
Query: 102 QHFPVIQFPEGYRICAGCNNEIGHGRFLNCLDVFWHPECFCCHACHQPITDIEFSTSENR 161
Q +P + P +RIC GC EIGHGRFL+C+ WHPECFCC+AC +PI D EFS S NR
Sbjct: 177 QPYPFL-IPSSHRICVGCQAEIGHGRFLSCMGGVWHPECFCCNACDKPIIDYEFSMSGNR 235
Query: 162 PYHKSCYREHYHPKCDVCKHFIPSNHGGLIEYRAHPFWVQKYCPSHEHDGTPRCCSCERM 221
PYHK CY+E +HPKCDVC +FIP+N GLIEYRAHPFW+QKYCPSHE DGTPRCCSCERM
Sbjct: 236 PYHKLCYKEQHHPKCDVCHNFIPTNPAGLIEYRAHPFWMQKYCPSHERDGTPRCCSCERM 295
Query: 222 EPQDTAYVALDDGRKLCLECLDSAIMDTNECQPLYLDIQEFYESIHMKLEQQIPLLLVER 281
EP+DT Y+ LDDGRKLCLECLDSAIMDT+ECQPLYL+I+EFYE +HMK+EQQIP+LLVER
Sbjct: 296 EPKDTKYLILDDGRKLCLECLDSAIMDTHECQPLYLEIREFYEGLHMKVEQQIPMLLVER 355
Query: 282 QALNEARDGEKNGYYHMPETRGLCLSEEQTVTTVLWRPRFGPGNQARNIITEPYKLTRRC 341
ALNEA +GEK+G++H+PETRGLCLSEEQTVTTVL RPR G G + ++ITEP +L RRC
Sbjct: 356 SALNEAMEGEKHGHHHLPETRGLCLSEEQTVTTVLRRPRIGAGYKLIDMITEPCRLIRRC 415
Query: 342 DVTAILILYGLPRLLTGTILAHEMMHGWMRLQG 374
+VTAILILYGLPRLLTG+ILAHEMMH W+RL G
Sbjct: 416 EVTAILILYGLPRLLTGSILAHEMMHAWLRLNG 448
|
|
| TAIR|locus:2202175 DA1 "DA1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2063932 DAR2 "DA1-related protein 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2154880 DAR6 "DA1-related protein 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170338 DAR4 "DA1-related protein 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2154890 DAR5 "DA1-related protein 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040121-6 ldb3a "LIM-domain binding factor 3a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43294 TGFB1I1 "Transforming growth factor beta-1-induced transcript 1 protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3MHZ4 TGFB1I1 "Transforming growth factor beta-1-induced transcript 1 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RTE0 TGFB1I1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 380 | |||
| pfam12315 | 212 | pfam12315, DUF3633, Protein of unknown function (D | 5e-70 | |
| cd09396 | 53 | cd09396, LIM_DA1, The Lim domain of DA1 | 3e-27 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 7e-12 | |
| cd09338 | 53 | cd09338, LIM3_Paxillin_like, The third LIM domain | 4e-09 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 7e-09 | |
| cd09361 | 52 | cd09361, LIM1_Enigma_like, The first LIM domain of | 8e-08 | |
| cd09332 | 52 | cd09332, LIM2_PINCH, The second LIM domain of prot | 8e-08 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 9e-08 | |
| cd09329 | 52 | cd09329, LIM3_abLIM, The third LIM domain of actin | 2e-07 | |
| cd09336 | 53 | cd09336, LIM1_Paxillin_like, The first LIM domain | 4e-07 | |
| cd09454 | 52 | cd09454, LIM1_ZASP_Cypher, The first LIM domain of | 4e-07 | |
| cd09410 | 53 | cd09410, LIM3_Leupaxin, The third LIM domain of Le | 4e-06 | |
| cd09367 | 52 | cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of L | 8e-06 | |
| cd09429 | 53 | cd09429, LIM3_FHL1, The third LIM domain of Four a | 2e-05 | |
| cd09362 | 52 | cd09362, LIM2_Enigma_like, The second LIM domain o | 2e-05 | |
| cd09409 | 53 | cd09409, LIM3_Paxillin, The third LIM domain of pa | 2e-05 | |
| cd09457 | 52 | cd09457, LIM2_ENH, The second LIM domain of the En | 3e-05 | |
| cd09401 | 53 | cd09401, LIM_TLP_like, The LIM domains of thymus L | 3e-05 | |
| cd09341 | 56 | cd09341, LIM2_Testin_like, The second LIM domain o | 6e-05 | |
| cd09337 | 52 | cd09337, LIM2_Paxillin_like, The second LIM domain | 9e-05 | |
| cd09363 | 54 | cd09363, LIM3_Enigma_like, The third LIM domain of | 1e-04 | |
| cd09391 | 57 | cd09391, LIM1_Lrg1p_like, The first LIM domain of | 1e-04 | |
| cd09412 | 52 | cd09412, LIM4_Leupaxin, The fourth LIM domain of L | 1e-04 | |
| cd09467 | 55 | cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b | 2e-04 | |
| cd09345 | 54 | cd09345, LIM2_FHL, The second LIM domain of Four a | 2e-04 | |
| cd09421 | 59 | cd09421, LIM3_LIMPETin, The third LIM domain of pr | 2e-04 | |
| cd09458 | 55 | cd09458, LIM3_Enigma, The third LIM domain of Enig | 2e-04 | |
| cd09456 | 52 | cd09456, LIM2_Enigma, The second LIM domain of Eni | 3e-04 | |
| cd09430 | 52 | cd09430, LIM5_LIMPETin, The fifth LIM domain of pr | 3e-04 | |
| cd09397 | 58 | cd09397, LIM1_UF1, LIM domain in proteins of unkno | 4e-04 | |
| cd09468 | 52 | cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 | 4e-04 | |
| cd09343 | 59 | cd09343, LIM1_FHL, The first LIM domain of Four an | 5e-04 | |
| cd09349 | 87 | cd09349, LIM1_Zyxin, The first LIM domain of Zyxin | 6e-04 | |
| cd09346 | 52 | cd09346, LIM3_FHL, The third LIM domain of Four an | 6e-04 | |
| cd09386 | 55 | cd09386, LIM1_LMO4, The first LIM domain of LMO4 ( | 6e-04 | |
| cd09447 | 53 | cd09447, LIM_LASP, The LIM domain of LIM and SH3 P | 8e-04 | |
| cd09359 | 53 | cd09359, LIM_LASP_like, The LIM domain of LIM and | 8e-04 | |
| cd09350 | 54 | cd09350, LIM1_TRIP6, The first LIM domain of Thyro | 0.001 | |
| cd09368 | 52 | cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of L | 0.001 | |
| cd09340 | 58 | cd09340, LIM1_Testin_like, The first LIM domain of | 0.001 | |
| cd09425 | 54 | cd09425, LIM4_LIMPETin, The fourth LIM domain of p | 0.002 | |
| cd09455 | 54 | cd09455, LIM1_Enigma_like_1, The first LIM domain | 0.002 | |
| cd09453 | 52 | cd09453, LIM1_ENH, The first LIM domain of the Eni | 0.002 | |
| cd09452 | 52 | cd09452, LIM1_Enigma, The first LIM domain of Enig | 0.002 | |
| cd09481 | 54 | cd09481, LIM1_CRP3, The first LIM domain of Cystei | 0.002 | |
| cd09388 | 55 | cd09388, LIM1_LMO1_LMO3, The first LIM domain of L | 0.003 | |
| cd09431 | 57 | cd09431, LIM3_Fhl2, The third LIM domain of Four a | 0.003 | |
| cd09427 | 58 | cd09427, LIM2_FHL3, The second LIM domain of Four | 0.004 | |
| cd09371 | 53 | cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | 0.004 |
| >gnl|CDD|204878 pfam12315, DUF3633, Protein of unknown function (DUF3633) | Back alignment and domain information |
|---|
Score = 218 bits (557), Expect = 5e-70
Identities = 81/110 (73%), Positives = 97/110 (88%)
Query: 265 SIHMKLEQQIPLLLVERQALNEARDGEKNGYYHMPETRGLCLSEEQTVTTVLWRPRFGPG 324
++MK+EQ+IP+LLVERQALN+AR+GEK G++H PETRGLCLSEEQ VT+VL RPR GPG
Sbjct: 1 GLNMKIEQEIPMLLVERQALNKAREGEKIGHHHTPETRGLCLSEEQIVTSVLKRPRIGPG 60
Query: 325 NQARNIITEPYKLTRRCDVTAILILYGLPRLLTGTILAHEMMHGWMRLQG 374
N+ + TEP KLTRRC+VTAIL+LYGLPRLLTG+ILAHEMMH W+RL G
Sbjct: 61 NRLIGMGTEPQKLTRRCEVTAILVLYGLPRLLTGSILAHEMMHAWLRLNG 110
|
This domain family is found in bacteria and eukaryotes, and is approximately 210 amino acids in length. The family is found in association with pfam00412. Length = 212 |
| >gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1 | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188718 cd09332, LIM2_PINCH, The second LIM domain of protein PINCH | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188838 cd09454, LIM1_ZASP_Cypher, The first LIM domain of ZASP/Cypher family | Back alignment and domain information |
|---|
| >gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188753 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of Lhx1 (also known as Lim1) and Lhx5 | Back alignment and domain information |
|---|
| >gnl|CDD|188813 cd09429, LIM3_FHL1, The third LIM domain of Four and a half LIM domains protein 1 (FHL1) | Back alignment and domain information |
|---|
| >gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188793 cd09409, LIM3_Paxillin, The third LIM domain of paxillin | Back alignment and domain information |
|---|
| >gnl|CDD|188841 cd09457, LIM2_ENH, The second LIM domain of the Enigma Homolog (ENH) family | Back alignment and domain information |
|---|
| >gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM and RhoGap domain containing protein | Back alignment and domain information |
|---|
| >gnl|CDD|188796 cd09412, LIM4_Leupaxin, The fourth LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188851 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b | Back alignment and domain information |
|---|
| >gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM domains protein (FHL) | Back alignment and domain information |
|---|
| >gnl|CDD|188805 cd09421, LIM3_LIMPETin, The third LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188842 cd09458, LIM3_Enigma, The third LIM domain of Enigma | Back alignment and domain information |
|---|
| >gnl|CDD|188840 cd09456, LIM2_Enigma, The second LIM domain of Enigma | Back alignment and domain information |
|---|
| >gnl|CDD|188814 cd09430, LIM5_LIMPETin, The fifth LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188783 cd09397, LIM1_UF1, LIM domain in proteins of unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|188852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 | Back alignment and domain information |
|---|
| >gnl|CDD|188729 cd09343, LIM1_FHL, The first LIM domain of Four and a half LIM domains protein (FHL) | Back alignment and domain information |
|---|
| >gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin | Back alignment and domain information |
|---|
| >gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM domains protein (FHL) | Back alignment and domain information |
|---|
| >gnl|CDD|188772 cd09386, LIM1_LMO4, The first LIM domain of LMO4 (LIM domain only protein 4) | Back alignment and domain information |
|---|
| >gnl|CDD|188831 cd09447, LIM_LASP, The LIM domain of LIM and SH3 Protein (LASP) | Back alignment and domain information |
|---|
| >gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein (LASP)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) | Back alignment and domain information |
|---|
| >gnl|CDD|188754 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of Lhx3 and Lhx4 family | Back alignment and domain information |
|---|
| >gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188809 cd09425, LIM4_LIMPETin, The fourth LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188839 cd09455, LIM1_Enigma_like_1, The first LIM domain of an Enigma subfamily with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|188837 cd09453, LIM1_ENH, The first LIM domain of the Enigma Homolog (ENH) family | Back alignment and domain information |
|---|
| >gnl|CDD|188836 cd09452, LIM1_Enigma, The first LIM domain of Enigma | Back alignment and domain information |
|---|
| >gnl|CDD|188865 cd09481, LIM1_CRP3, The first LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188774 cd09388, LIM1_LMO1_LMO3, The first LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) | Back alignment and domain information |
|---|
| >gnl|CDD|188815 cd09431, LIM3_Fhl2, The third LIM domain of Four and a half LIM domains protein 2 (FHL2) | Back alignment and domain information |
|---|
| >gnl|CDD|188811 cd09427, LIM2_FHL3, The second LIM domain of Four and a half LIM domains protein 3 (FHL3) | Back alignment and domain information |
|---|
| >gnl|CDD|188757 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 380 | |||
| PF12315 | 212 | DUF3633: Protein of unknown function (DUF3633); In | 100.0 | |
| KOG2272 | 332 | consensus Focal adhesion protein PINCH-1, contains | 99.94 | |
| KOG1701 | 468 | consensus Focal adhesion adaptor protein Paxillin | 99.88 | |
| KOG1701 | 468 | consensus Focal adhesion adaptor protein Paxillin | 99.8 | |
| KOG4577 | 383 | consensus Transcription factor LIM3, contains LIM | 99.79 | |
| KOG1703 | 479 | consensus Adaptor protein Enigma and related PDZ-L | 99.78 | |
| KOG2272 | 332 | consensus Focal adhesion protein PINCH-1, contains | 99.68 | |
| KOG1703 | 479 | consensus Adaptor protein Enigma and related PDZ-L | 99.68 | |
| KOG1044 | 670 | consensus Actin-binding LIM Zn-finger protein Lima | 99.62 | |
| KOG1044 | 670 | consensus Actin-binding LIM Zn-finger protein Lima | 99.58 | |
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.31 | |
| KOG1700 | 200 | consensus Regulatory protein MLP and related LIM p | 98.82 | |
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 98.58 | |
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 98.36 | |
| KOG4577 | 383 | consensus Transcription factor LIM3, contains LIM | 97.71 | |
| KOG1700 | 200 | consensus Regulatory protein MLP and related LIM p | 97.45 | |
| KOG1702 | 264 | consensus Nebulin repeat protein [Cytoskeleton] | 97.32 | |
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 97.2 | |
| KOG0490 | 235 | consensus Transcription factor, contains HOX domai | 96.98 | |
| PF14891 | 174 | Peptidase_M91: Effector protein | 86.5 | |
| PF13699 | 79 | DUF4157: Domain of unknown function (DUF4157) | 86.42 | |
| PF13485 | 128 | Peptidase_MA_2: Peptidase MA superfamily | 82.75 | |
| smart00726 | 26 | UIM Ubiquitin-interacting motif. Present in protea | 81.27 | |
| PF10263 | 157 | SprT-like: SprT-like family; InterPro: IPR006640 T | 80.81 |
| >PF12315 DUF3633: Protein of unknown function (DUF3633); InterPro: IPR022087 This domain family is found in bacteria and eukaryotes, and is approximately 210 amino acids in length | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-44 Score=326.95 Aligned_cols=116 Identities=72% Similarity=1.148 Sum_probs=114.3
Q ss_pred HhcccccCcccchhhhHHHHHHHhcCCCCCCCCCcccCCcccccccccceeeccccCCCCCccccccccccccccceeEE
Q 016954 265 SIHMKLEQQIPLLLVERQALNEARDGEKNGYYHMPETRGLCLSEEQTVTTVLWRPRFGPGNQARNIITEPYKLTRRCDVT 344 (380)
Q Consensus 265 ~~~~~i~~~~p~~lv~~~aLn~~~~~e~~g~~~~~e~rGl~~~E~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~ 344 (380)
+|||||++++||+||+++|||+|.++|++|++|.++|||||+||+++|++|+|+|++|+|+++++|.|+|++++++|+||
T Consensus 1 ~lnmki~q~~PllLVe~~aLN~a~~~Ek~~~~~~~~tRGLclseeq~v~sv~~~p~~~~~~~~~~~~~e~~~~~~~~eV~ 80 (212)
T PF12315_consen 1 GLNMKIEQEIPLLLVERQALNEAEEGEKIGHHHMPETRGLCLSEEQTVTSVLRRPRMGPGNQLIDMSTEPQRLTRGCEVT 80 (212)
T ss_pred CCCCcccCCCCeEEecHHHHHHHHhhccCCCCCCeeeeeeeeeeeEEEEEEEecCCcCCCCccceeeecceeeccceeEE
Confidence 58999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEEecCCChhhhhhHHHHHhHHHHhhhcCCCCCCC
Q 016954 345 AILILYGLPRLLTGTILAHEMMHGWMRLQGAFCLFP 380 (380)
Q Consensus 345 ~il~l~glp~~~~g~ilahe~~ha~l~l~g~~~l~~ 380 (380)
+|||||||||++||||||||||||||||+||++|+|
T Consensus 81 ~Ilvl~GLPrll~gsiLAHE~mHa~Lrl~g~~~L~~ 116 (212)
T PF12315_consen 81 AILVLYGLPRLLTGSILAHELMHAWLRLNGFPNLSP 116 (212)
T ss_pred EEEEECCCCHHHHhhHHHHHHHHHHhcccCCCCCCh
Confidence 999999999999999999999999999999999986
|
The family is found in association with PF00412 from PFAM. |
| >KOG2272 consensus Focal adhesion protein PINCH-1, contains LIM domains [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG1703 consensus Adaptor protein Enigma and related PDZ-LIM proteins [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2272 consensus Focal adhesion protein PINCH-1, contains LIM domains [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1703 consensus Adaptor protein Enigma and related PDZ-LIM proteins [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1044 consensus Actin-binding LIM Zn-finger protein Limatin involved in axon guidance [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1044 consensus Actin-binding LIM Zn-finger protein Limatin involved in axon guidance [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1700 consensus Regulatory protein MLP and related LIM proteins [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG1700 consensus Regulatory protein MLP and related LIM proteins [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1702 consensus Nebulin repeat protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF14891 Peptidase_M91: Effector protein | Back alignment and domain information |
|---|
| >PF13699 DUF4157: Domain of unknown function (DUF4157) | Back alignment and domain information |
|---|
| >PF13485 Peptidase_MA_2: Peptidase MA superfamily | Back alignment and domain information |
|---|
| >smart00726 UIM Ubiquitin-interacting motif | Back alignment and domain information |
|---|
| >PF10263 SprT-like: SprT-like family; InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 380 | ||||
| 2jtn_A | 182 | Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl | 7e-07 | ||
| 2rgt_A | 169 | Crystal Structure Of Lhx3 Lim Domains 1 And 2 With | 3e-06 | ||
| 3mmk_A | 169 | The Structural Basis For Partial Redundancy In A Cl | 4e-06 | ||
| 2dj7_A | 80 | Solution Structure Of 3rd Lim Domain Of Actin-Bindi | 4e-05 | ||
| 1x3h_A | 80 | Solution Structure Of The Lim Domain Of Human Leupa | 4e-04 |
| >pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 | Back alignment and structure |
|
| >pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 | Back alignment and structure |
| >pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 | Back alignment and structure |
| >pdb|2DJ7|A Chain A, Solution Structure Of 3rd Lim Domain Of Actin-Binding Lim Protein 3 Length = 80 | Back alignment and structure |
| >pdb|1X3H|A Chain A, Solution Structure Of The Lim Domain Of Human Leupaxin Length = 80 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 380 | |||
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 2e-21 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 3e-21 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 4e-21 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 5e-21 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 3e-19 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 7e-19 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 2e-08 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 9e-19 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 5e-18 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 1e-17 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 1e-17 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 2e-17 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 3e-17 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 5e-17 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 2e-16 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 6e-04 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 2e-16 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 3e-16 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 6e-16 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 3e-10 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 1e-15 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 1e-15 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 5e-15 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 5e-15 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 6e-15 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 9e-15 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 1e-14 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 2e-14 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 7e-14 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 2e-04 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 4e-14 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 5e-14 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 1e-10 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 5e-14 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 2e-13 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 3e-08 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 2e-13 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 5e-13 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 1e-12 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 1e-12 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 2e-12 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 4e-12 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 1e-10 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 2e-10 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 4e-10 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 2e-08 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 3e-08 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 6e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-06 | |
| 1q0v_A | 81 | Hydrophilic protein; has cysteine rich putative zi | 7e-06 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 2e-04 |
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
Score = 86.3 bits (214), Expect = 2e-21
Identities = 24/67 (35%), Positives = 31/67 (46%), Gaps = 1/67 (1%)
Query: 110 PEGYRICAGCNNEIGHGRFLNCLDVFWHPECFCCHACHQPITDIEFSTSENRPYHKSCYR 169
G CAGC EI HG+ L LD WH CF C C +T E+ + + PY +S Y
Sbjct: 12 IRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTG-EYISKDGVPYCESDYH 70
Query: 170 EHYHPKC 176
+
Sbjct: 71 AQFGSGP 77
|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1q0v_A Hydrophilic protein; has cysteine rich putative zinc finger esential for function;...; stable, non-interacting alpha-helices; NMR {Saccharomyces cerevisiae} SCOP: j.105.1.1 PDB: 1q0w_A Length = 81 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 380 | |||
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.92 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.91 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.91 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.91 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.89 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.89 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.85 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.78 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.72 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.62 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.61 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.59 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.59 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.57 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.57 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.56 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.55 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.53 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.53 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.53 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.52 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.52 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.51 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.51 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.51 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.51 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.51 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.51 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.5 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.5 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.49 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.49 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.47 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.47 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.46 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.46 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.45 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.45 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.44 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.44 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.43 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.43 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.4 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.38 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.37 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.37 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.36 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.33 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.33 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.31 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.21 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.16 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.14 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.11 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.09 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.05 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.04 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.03 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.01 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.01 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.01 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.01 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 98.99 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 98.98 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 98.97 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 98.91 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 98.89 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 98.88 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 98.88 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 98.87 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 98.86 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 98.85 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 98.85 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 98.84 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 98.84 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 98.83 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 98.8 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 98.79 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 98.77 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 98.76 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 98.75 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 98.74 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 98.69 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 98.64 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 97.47 | |
| 1q0v_A | 81 | Hydrophilic protein; has cysteine rich putative zi | 93.93 | |
| 2d3g_P | 26 | Ubiquitin interacting motif from hepatocyte growth | 89.98 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 83.61 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 82.85 |
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.92 E-value=2e-25 Score=189.45 Aligned_cols=121 Identities=20% Similarity=0.461 Sum_probs=107.5
Q ss_pred CCCccccCCcccccCceEeeCCceecCCCcccCCCCCCCCCceeeccCCcccccccccccccccccccCCcccCCCCcce
Q 016954 112 GYRICAGCNNEIGHGRFLNCLDVFWHPECFCCHACHQPITDIEFSTSENRPYHKSCYREHYHPKCDVCKHFIPSNHGGLI 191 (380)
Q Consensus 112 ~~~~C~~C~~~I~~g~~v~alg~~wH~~CF~C~~C~~~L~~~~f~~~dg~~YC~~cy~~~f~pkC~~C~~~I~~~~~~~i 191 (380)
..++|++|+++|..++++.++|+.||++||+|..|+++|.+..|+.++|++||+.||.++|+++|.+|+++|.+++ ..|
T Consensus 2 ~~~~C~~C~~~I~~~~~~~a~~~~~H~~CF~C~~C~~~L~~~~f~~~~g~~yC~~cy~~~~~~~C~~C~~~I~~~~-~~~ 80 (126)
T 2xqn_T 2 EKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEV-QRV 80 (126)
T ss_dssp CCCBBTTTSSBCCSSCEEEETTEEECGGGSBCTTTCCBCTTSEEEEETTEEEEHHHHHHHSCCBCTTTCSBCCTTS-CEE
T ss_pred cCCCCccCCCEeCCceEEeeCCCCccCCCCCcCCCCCCCCcCEEEeECCEEechHHhCcCcCccCcccCCcCCcCc-eEE
Confidence 3579999999997788999999999999999999999999989999999999999999999999999999999742 457
Q ss_pred EEecccccccccCCCCcc--CCCCcccccCCcCCCCCceEEccCCcccChhhhhhh
Q 016954 192 EYRAHPFWVQKYCPSHEH--DGTPRCCSCERMEPQDTAYVALDDGRKLCLECLDSA 245 (380)
Q Consensus 192 ~~~~~~fw~qkycp~h~H--~~CF~C~~C~r~l~~g~~f~~l~dg~~~C~~C~~~~ 245 (380)
++.++ +|| +.||+|..|+++|. +..|+ +.+|++||..++.++
T Consensus 81 ~a~~~----------~~H~~~~CF~C~~C~~~l~-~~~f~-~~~~~~yC~~~~~~~ 124 (126)
T 2xqn_T 81 TYNNF----------SWHASTECFLCSCCSKCLI-GQKFM-PVEGMVFCSVECKKR 124 (126)
T ss_dssp EETTE----------EEESSTTTSBCTTTCCBCT-TSEEE-EETTEEESSHHHHHS
T ss_pred ECCCC----------EeeCCCCCcCcCCCCCccC-CCeeE-eECCEEcchHHhhhh
Confidence 77764 469 99999999999995 77887 469999999777653
|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >1q0v_A Hydrophilic protein; has cysteine rich putative zinc finger esential for function;...; stable, non-interacting alpha-helices; NMR {Saccharomyces cerevisiae} SCOP: j.105.1.1 PDB: 1q0w_A | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 380 | ||||
| d2dara2 | 45 | g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, En | 6e-05 | |
| d1rutx1 | 30 | g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus m | 0.002 | |
| d2dj7a2 | 36 | g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abL | 0.004 |
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: PDZ and LIM domain protein 5, Enigma species: Human (Homo sapiens) [TaxId: 9606]
Score = 37.8 bits (88), Expect = 6e-05
Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 3/36 (8%)
Query: 108 QFPEGYR--ICAGCNNEIGHGRFLNCLDVFWHPECF 141
P G R +CA CN I G FL L WHPE F
Sbjct: 11 HIPAGKRTPMCAHCNQVI-RGPFLVALGKSWHPEEF 45
|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 380 | |||
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.57 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.55 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.38 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 98.3 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.18 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 98.13 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.08 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.08 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 98.05 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.89 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 97.86 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 97.85 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 97.83 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 97.8 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 97.78 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.75 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.75 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.72 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 97.65 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 97.62 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.6 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 97.53 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 97.47 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.46 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 97.45 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 97.44 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 97.42 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 97.39 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 97.38 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.33 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.32 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 97.28 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.27 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 97.25 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.25 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.19 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 97.18 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.13 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.08 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 97.04 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 96.99 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 96.81 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 96.81 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.81 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 96.77 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.73 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 96.72 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 96.62 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.59 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 96.58 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 96.57 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 96.52 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 96.49 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 96.48 | |
| d1x6aa2 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 96.44 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 96.33 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 96.33 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 96.31 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 96.23 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 96.09 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.06 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 95.98 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 95.95 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 95.91 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 95.87 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 95.85 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 95.76 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 95.7 | |
| d2cora1 | 31 | Pinch (particularly interesting new Cys-His) prote | 95.67 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 95.65 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 95.37 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 95.36 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 95.24 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 95.21 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 95.16 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 95.14 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 94.65 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 94.59 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 94.5 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 94.48 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 94.17 | |
| d1v6ga2 | 40 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 94.1 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 94.07 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 93.92 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 93.67 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 93.24 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 93.2 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 93.11 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 92.39 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 92.05 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 91.86 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 91.36 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 91.23 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 91.16 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 91.01 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 90.8 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 90.07 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 90.07 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 89.81 | |
| d1rutx2 | 34 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 88.57 | |
| d2d8xa1 | 32 | Pinch (particularly interesting new Cys-His) prote | 88.41 | |
| d2d8xa1 | 32 | Pinch (particularly interesting new Cys-His) prote | 87.81 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 87.69 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 85.35 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 84.25 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 84.1 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 83.67 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 83.67 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 82.02 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 81.95 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 81.32 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 81.26 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 80.67 |
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Leupaxin species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.57 E-value=1.7e-08 Score=64.87 Aligned_cols=32 Identities=38% Similarity=0.964 Sum_probs=29.1
Q ss_pred CCCCCCccccCCcccccCceEeeCCceecCCCc
Q 016954 109 FPEGYRICAGCNNEIGHGRFLNCLDVFWHPECF 141 (380)
Q Consensus 109 ~~~~~~~C~~C~~~I~~g~~v~alg~~wH~~CF 141 (380)
.....++|++|+++| .|++|+|+|+.|||+||
T Consensus 4 ~~~fapkC~~C~~~I-~g~~v~Al~~~wHpeCF 35 (35)
T d1x3ha1 4 LAMFSPKCGGCNRPV-LENYLSAMDTVWHPECF 35 (35)
T ss_dssp CCCCSCBCTTTCCBC-CSSCEEETTEEECTTTC
T ss_pred HHHhChhhhhcCCcc-cchheeecCCccCcccC
Confidence 345678999999999 79999999999999998
|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|