Citrus Sinensis ID: 016962


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MYFSKAKLKLFILFFVTSSSNLLIISINCQDDHILSLPRRQVALFIFGDSLFDAGINNYINTTTDYQANFWPYGESFFDYPTGRFSDGRLIPDFIAEYAELPFIPTFLPYHNHDQFTYGVNFASGGAGALVETHQGFVIDLETQLSYFKIVEKLLKQKLGDEEAETLLSEAVYLFGVGGNDYFNLFTSNSSDLHFSKKEFVGMVIGNLTNTIKEIYKRGGRKFAFANLCPLGCLPAMKVLFPGSTSPCVEDAQEFVQLHNKALSELLQELEGELKGFKYAYHDFFTSISQRFNNPSKYGFKEVTACCGSGPYGGLSSCGGKRAIKEYELCDNPNEYLFFDSSHSSEKAYKQIAELMWNGTPDVTGPYNLKMLFEHSTCI
cccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccEEEEEECccHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEccccccHHHHHHHHHHHHHcccccccccccHHHHHcccccc
****KAKLKLFILFFVTSSSNLLIISINCQDDHILSLPRRQVALFIFGDSLFDAGINNYINTTTDYQANFWPYGESFFDYPTGRFSDGRLIPDFIAEYAELPFIPTFLPYHNHDQFTYGVNFASGGAGALVETHQGFVIDLETQLSYFKIVEKLLKQKLGDEEAETLLSEAVYLFGVGGNDYFNLFTSNSSDLHFSKKEFVGMVIGNLTNTIKEIYKRGGRKFAFANLCPLGCLPAMKVLFPGSTSPCVEDAQEFVQLHNKALSELLQELEGELKGFKYAYHDFFTSISQRFNNPSKYGFKEVTACCGSGPYGGLSSCGGKRAIKEYELCDNPNEYLFFDSSHSSEKAYKQIAELMWNGTPDVTGPYNLKMLFEHS***
xxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYFSKAKLKLFILFFVTSSSNLLIISINCQDDHILSLPRRQVALFIFGDSLFDAGINNYINTTTDYQANFWPYGESFFDYPTGRFSDGRLIPDFIAEYAELPFIPTFLPYHNHDQFTYGVNFASGGAGALVETHQGFVIDLETQLSYFKIVEKLLKQKLGDEEAETLLSEAVYLFGVGGNDYFNLFTSNSSDLHFSKKEFVGMVIGNLTNTIKEIYKRGGRKFAFANLCPLGCLPAMKVLFPGSTSPCVEDAQEFVQLHxxxxxxxxxxxxxxxxxxxxxYHDFFTSISQRFNNPSKYGFKEVTACCGSGPYGGLSSCGGKRAIKEYELCDNPNEYLFFDSSHSSEKAYKQIAELMWNGTPDVTGPYNLKMLFEHSTCI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GDSL esterase/lipase 1 Confers resistance to the necrotrophic fungus Alternaria brassicicola. Possesses lipase and antimicrobial activities that directly disrupt fungal spore integrity. Triggers systemic resistance, mostly by the ethylene-dependent pathway.probableQ9FLN0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KVN, chain X
Confidence level:very confident
Coverage over the Query: 35-375
View the alignment between query and template
View the model in PyMOL