Citrus Sinensis ID: 016971

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MDWNLKPAWDFTEFEQEAIPNVDAVDESSSRTKGNFSVDLKLGQVNSSAEDSLNKCKEPVASKMESPSPSGSFKRARAANNGSQTASCLVDGCDSDLSNCRDYHRRHKVCELHSKTPQVLICGQKQRFCQQCSRFHCLEEFDEGKRSCRKRLDGHNRRRRKPQPDPLSRTGTFLSNYQGASLLPFSSSHMYPSATVVKPTWTGVVNTEADARRYNEHHRLNLPDERNLFLRSPSSSYKTGKQFTFLQGDNPTFNSQTSSEASVSQPLLGTANLSDRSGASHNVFHDRSTTQDSDCALSLLSSPTTQTSGISLSQMMPPSSMPLVRSLGTSLHNHSVEPMESVLVSSDQDDNVHCPGVFHLGYDGSAASDTPQTIPFHWE
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccHHHHcccccccccccccEEEEccEEEEEcccccccCCccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccc
MDWNLKPAWDFTEF************************************************************************SCLVDGCDSDLSNCRDYHRRHKVCELHSKTPQVLICGQKQRFCQQCSRFHCLEEFDEGKR******************************************************WTGV*N******RY*****************************************************************************************************************************************VHCPGVFHLGY************PFHWE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDWNLKPAWDFTEFEQEAIPNVDAVDESSSRTKGNFSVDLKLGQVNSSAEDSLNKCKEPVASKMESPSPSGSFKRARAANNGSQTASCLVDGCDSDLSNCRDYHRRHKVCELHSKTPQVLICGQKQRFCQQCSRFHCLEEFDEGKRSCRKRLDGHNRRRRKPQPDPLSRTGTFLSNYQGASLLPFSSSHMYPSATVVKPTWTGVVNTEADARRYNEHHRLNLPDERNLFLRSPSSSYKTGKQFTFLQGDNPTFNSQTSSEASVSQPLLGTANLSDRSGASHNVFHDRSTTQDSDCALSLLSSPTTQTSGISLSQMMPPSSMPLVRSLGTSLHNHSVEPMESVLVSSDQDDNVHCPGVFHLGYDGSAASDTPQTIPFHWE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Squamosa promoter-binding-like protein 13A Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.probableB9DI20
Squamosa promoter-binding-like protein 13B Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.probableP0DI11

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UL4, chain A
Confidence level:very confident
Coverage over the Query: 85-165
View the alignment between query and template
View the model in PyMOL