Citrus Sinensis ID: 016982

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38

MAAIAVHQFAQCITCHAWSPDHAMVAFCPNNNEVHIYKLIQEKWEKLHVLQKHDQIVSGIDWSVRSNRIVTVSHDRNSYVWNQEGSEWVPTLVILRLNRAALCVQWSPKENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHDSSVTSVAWHPNNVFLATTSTDGKCRVFSTFIKGVDIKEKKEGTSSDTKFGEQILQLDLSFSWAFGVKWSPSGNTLAYVGHNSMIYFVDDVGPSPLAQNVAFRDLPLRDVLFVSEKMVIGVGFDCNPMVFAADETGIWTFIKFLDERKTSSSGPKYGSQFSEAFGKLYGQSKYGVGNDAVESSRTRGGTHVNCINCIVPLREAGSSRITRFTTSGLDGKIVTWDLESQEDLLNYHL

ccccEEEcccccEEEEEEcccccEEEEccccccEEEEEccccEEEEEEEcccccccEEEEEEcccccEEEEccccccEEEEEccccCEEEEEEEccccccEEEEEEcccccEEEEECccccEEEEEEEEcccEEEEEcccccccccEEEEEEcccccEEEEECccccEEEEEcccccCCccccccccccccccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccccEEEEECccccEEEEEEccccEEEEEEccccEEEEEEcccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEECcccccCEEEEEECccccEEEEEcccccccccccc

*AAIAVHQFAQCITCHAWSPDHAMVAFCPNNNEVHIYKLIQEKWEKLHVLQKHDQIVSGIDWSVRSNRIVTVSHDRNSYVWNQEGSEWVPTLVILRLNRAALCVQWSPKENKFAVGSGAKTVCICYYEQENNWWVSKLIRKRHDSSVTSVAWHPNNVFLATTSTDGKCRVFSTFIKGVDIKEKKEGTSSDTKFGEQILQLDLSFSWAFGVKWSPSGNTLAYVGHNSMIYFVDDVGPSPLAQNVAFRDLPLRDVLFVSEKMVIGVGFDCNPMVFAADETGIWTFIKFLDER******************KLYGQSKYGVGNDAVESSRTRGGTHVNCINCIVPLREAGSSRITRFTTSGLDGKIVTWDLESQED*L****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Actin-related protein 2/3 complex subunit 1B	Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.	probable	O88656
Actin-related protein 2/3 complex subunit 1	Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.	probable	P78774
Actin-related protein 2/3 complex subunit 1B	Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.	probable	Q9WV32

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K8K, chain C
Confidence level:very confident
Coverage over the Query: 6-290,305-379
View the alignment between query and template
View the model in PyMOL