Citrus Sinensis ID: 017009

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38

MQDFYNLRKDVEAASDRVEEIRASAGLQQLEKELAELEMKAADSSFWDNRAEAQETLQALTDVKDKINLLTDFKTKMDDAVTIVKLTEEMDSTDAGLLEEAASIIKELNKALDQFELTQLLSGPYDKEGAVISITAGAGGTDAQDWADMLLRMYVRWGEKQRYKTRVVEKSLGEEAGIKSAVIEVEGRYAYGYLSGEKGTHRIVRQSPFNAKGLRQTSFSGAEVMPLLPEESMDVQIPEEDLEISFSRAGGKGGQNVNKVETAVRITHIPTGVTVRCTEERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVKDVRTGHETSDIVSVMDGELEPFIKSYLKYKYSMSLSASDAN

cccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccEEEEEEEEEcccccccccccccccEEEccccccccccccccccEEECccccccccccccccccCEEEEEccccccccccccccccEEcccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccc

*QDFYNLRKDVEAASDRVEEIRASAGLQQLEKELAELEMKAADSSFWDNRAE***TLQALTDVKDKINLLTDFKTKMDDAVTIVKLTEEMDSTDAGLLEEAASIIKELNKALDQFELTQLLSGPYDKEGAVISITAGAGGTDAQDWADMLLRMYVRWGEKQRYKTRVVEKSLGEEAGIKSAVIEVEGRYAYGYLSGEKGTHRIVRQSPFNAKGLRQTSFSGAEVMPLLPEESMDVQIPEEDLEISFSRAGGKGGQNVNKVETAVRITHIPTGVTVRCTEERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVKDVRTGHETSDIVSVMDGELEPFIKSYLKYKYS*********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQDFYNLRKDVEAASDRVExxxxxxxxxxxxxxxxxxxxxAADSSFWDNRAEAQETLQALTDVKDKINLLTDFKTKMDDAVTIVKLTEEMDSTDAGLxxxxxxxxxxxxxxxxxxxxxQLLSGPYDKEGAVISITAGAGGTDAQDWADMLLRMYVRWGEKQRYKTRVVEKSLGEEAGIKSAVIEVEGRYAYGYLSGEKGTHRIVRQSPFNAKGLRQTSFSGAEVMPLLPEESMDVQIPEEDLEISFSRAGGKGGQNVNKVETAVRITHIPTGVTVRCTEERSQLANKIKALSRLKAKLLVIAEEQRASEIKQIRGDAVKAEWGQQIRNYVFHPYKLVKDVRTGHETSDIVSVMDGELEPFIKSYLKYKYSMSLSASDAN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Peptide chain release factor 2	Peptide chain release factor 2 directs the termination of translation in response to the peptide chain termination codons UGA and UAA.	probable	B7K0A6
Peptide chain release factor 2	Peptide chain release factor 2 directs the termination of translation in response to the peptide chain termination codons UGA and UAA.	probable	Q7U3W6
Peptide chain release factor 2	Peptide chain release factor 2 directs the termination of translation in response to the peptide chain termination codons UGA and UAA.	probable	Q6GIN7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GQE, chain A
Confidence level:very confident
Coverage over the Query: 4-367
View the alignment between query and template
View the model in PyMOL