Citrus Sinensis ID: 017035


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MKREEMDGSCMDESTTTDSASTSPPITFPASIPPTKSPESLCRVGSGASSVILDSEAGVEAESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARAYDIAAQRFRGRDAVTNFKQISCAGTSSDDGDIEMAFLSSHSKSEIVDMLRKHTYNDELEQSKRNYGLDANGKRVIKHGEGDGAATAFGSDRVLKARDQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGSTSKGLLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDIVSFHRSTGGDRQLYIDWKARTGPIENPVEPVQMMRLFGVNIFKIPGNGLVGVDKIGCNINNNNNNGKRLREMELLSLECSKKQRMIGAL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccCEEEEcccccEEEEEccccHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHccccccHHHHHHcccccHHHHHHHHcccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEEEEccccccEEEccccccHHHccccccccEEEEEEcccccEEEEEEECccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccHHHHccc
***************************************************************************PQPNGRWGAQIYEKHQRVWLGTFNEEEEAARAYDIAAQRFRGRDAVTNFKQISCAGTSSDDGDIEMAFLSSHSKSEIVDMLRKHTYNDELEQSKRNYGLDANGKRVIKHGEGDGAATAFGSDRVLKARDQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSG*TSKGLLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDIVSFHRSTGGDRQLYIDWKARTG****PVEPVQMMRLFGVNIFKIPGNG******************************CSKKQRMIG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKREEMDGSCMDESTTTDSASTSPPITFPASIPPTKSPESLCRVGSGASSVILDSEAGVEAESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEEEAARAYDIAAQRFRGRDAVTNFKQISCAGTSSDDGDIEMAFLSSHSKSEIVDMLRKHTYNDELEQSKRNYGLDANGKRVIKHGEGDGAATAFGSDRVLKARDQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGSTSKGLLLNFEDVTGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDIVSFHRSTGGDRQLYIDWKARTGPIENPVEPVQMMRLFGVNIFKIPGNGLVGVDKIGCNINNNNNNGKRLREMELLSLECSKKQRMIGAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
AP2/ERF and B3 domain-containing transcription repressor RAV2 Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). Transcritptional repressor of flowering time on long day plants. Acts directly on FT expression by binding 5'-CAACA-3' and 5'-CACCTG-3 sequences (Probable). Functionally redundant with TEM1.probableP82280
AP2/ERF and B3 domain-containing protein Os01g0693400 probableQ8RZX9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WID, chain A
Confidence level:very confident
Coverage over the Query: 201-316
View the alignment between query and template
View the model in PyMOL
Template: 1GCC, chain A
Confidence level:very confident
Coverage over the Query: 70-127
View the alignment between query and template
View the model in PyMOL