Citrus Sinensis ID: 017051

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MELKFVLTAFVFISATVTTAEYIRPQPRRTLEFPWDPKPSSHPQQVHISLAGDSHMRVTWITDDESSPSVVEYGTSPGGYNCGAEGESTSYRYLFYRSGKIHHTVIGPLEHDTVYFYRCGRQGPEFEFKTPPAQFPITFAVAGDLGQTGWTKSTLDHIGQCKYDVHLLPGDLSYADYMQHRWDTFGELVQPLASARPWMVTQGNHEKESIPLIMDAFQSYNARWKMPFEESGSNSNLYYSFDVAGAHLIMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQGEGDGMMAIMEPLLYAASVDLVLAGHVHAYERSIRVNNGKPDPCGAVYITIGDGGNKEGLARKYVLTYRNIFELSNSNKK
ccHHHHHHHHHHHHccccccEEccccccccccccccccccccccEEEEEEcccccEEEEEEccccccccEEEEEcccccccEEEEEEEEEEEEEcccccEEEEEEEcccccccEEEEEEccccccEEEEcccccccEEEEEEccccccccHHHHHHHHHcccccEEEEccccccccccHHHHHHHHHHHHHHHccccEEEcccccccccccccccccccccccccccccccccccccEEEEEEccEEEEEEEccccccccHHHHHHHHHHHHHccccccccEEEEccccccccccccccccHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccc
ccHHHEHHHHHHHHccccccccEcccccccccccccccccccccEEEEEEccccEEEEEEEEcccccccEEEEEccccccEEEEEEEEEEEEEEEccccEEEEEEEcccccccEEEEEEcccccEEEEEcccccccEEEEEEEccccccccHHHHHHHHcccccEEEEEcccccccccccccccHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEEccccccccccHHHHHHHHHHHHcccccccEEEEEEccccccccHHcccccHHHHHHHHHHHHHccccEEEEccEEEEEcccEEEcccccccccEEEEEccccccccccHHcccccccEEEEcccccc
MELKFVLTAFVFISATvttaeyirpqprrtlefpwdpkpsshpqqvhislagdshmrvtwitddesspsvveygtspggyncgaegestSYRYLFYRsgkihhtvigplehdtvyfyrcgrqgpefefktppaqfpitfavagdlgqtgwtkstldhigqckydvhllpgdlsYADYMQHRWDTFGELVqplasarpwmvtqgnhekesiPLIMDAFQSYNarwkmpfeesgsnsnlyysfdVAGAHLIMLGsyadydeysdQYRWLKDDlskvdrkktpWLLVLLHvpwynsneahqgegdgmMAIMEPLLYAASVDLVLAGHVHAYERsirvnngkpdpcgavyitigdggnkeGLARKYVLTYRNIFELSNSNKK
MELKFVLTAFVFisatvttaeyirpqpRRTLEFPWDPKPSSHPQQVHISLAGDSHMRVTWITDDESSPSVVEYGTSPGGYNCGAEGESTSYRYLFYRSGKIHHTVIGPLEHDTVYFYRCGRQGPEFEFKTPPAQFPITFAVAGDLGQTGWTKSTLDHIGQCKYDVHLLPGDLSYADYMQHRWDTFGELVQPLASARPWMVTQGNHEKESIPLIMDAFQSYNARWKMPFEESGSNSNLYYSFDVAGAHLIMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQGEGDGMMAIMEPLLYAASVDLVLAGHVHAYERsirvnngkpdpCGAVYItigdggnkEGLARKYVLTYrnifelsnsnkk
MELKFVLTAFVFISATVTTAEYIRPQPRRTLEFPWDPKPSSHPQQVHISLAGDSHMRVTWITDDESSPSVVEYGTSPGGYNCGAEGESTSYRYLFYRSGKIHHTVIGPLEHDTVYFYRCGRQGPEFEFKTPPAQFPITFAVAGDLGQTGWTKSTLDHIGQCKYDVHLLPGDLSYADYMQHRWDTFGELVQPLASARPWMVTQGNHEKESIPLIMDAFQSYNARWKMPFEESGSNSNLYYSFDVAGAHLIMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQGEGDGMMAIMEPLLYAASVDLVLAGHVHAYERSIRVNNGKPDPCGAVYITIGDGGNKEGLARKYVLTYRNIFELSNSNKK
**LKFVLTAFVFISATVTTAEYIRP****************************SHMRVTWIT********VEYGTSPGGYNCGAEGESTSYRYLFYRSGKIHHTVIGPLEHDTVYFYRCGRQGPEFEFKTPPAQFPITFAVAGDLGQTGWTKSTLDHIGQCKYDVHLLPGDLSYADYMQHRWDTFGELVQPLASARPWMVTQGNHEKESIPLIMDAFQSYNARWKMPFEESGSNSNLYYSFDVAGAHLIMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQGEGDGMMAIMEPLLYAASVDLVLAGHVHAYERSIRVNNGKPDPCGAVYITIGDGGNKEGLARKYVLTYRNIFEL******
*ELKFVLTAFVFISATVTTAEYIRPQPRRTLEFPWDPKPSSHPQQVHISLAGDSHMRVTWITDDESSPSVVEYGTSPGGYNCGAEGESTSYRYLFYRSGKIHHTVIGPLEHDTVYFYRCGRQGPEFEFKTPPAQFPITFAVAGDLGQTGWTKSTLDHIGQCKYDVHLLPGDLSYADYMQHRWDTFGELVQPLASARPWMVTQGNHEKESIPLIMDAFQSYNARWKMPFEESGSNSNLYYSFDVAGAHLIMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQGEGDGMMAIMEPLLYAASVDLVLAGHVHAYERSIRVNNGKPDPCGAVYITIGDGGNKEGLARKYVLTYRN**********
MELKFVLTAFVFISATVTTAEYIRPQPRRTLEFPWD********QVHISLAGDSHMRVTWITDDESSPSVVEYGTSPGGYNCGAEGESTSYRYLFYRSGKIHHTVIGPLEHDTVYFYRCGRQGPEFEFKTPPAQFPITFAVAGDLGQTGWTKSTLDHIGQCKYDVHLLPGDLSYADYMQHRWDTFGELVQPLASARPWMVTQGNHEKESIPLIMDAFQSYNARWKMPFEESGSNSNLYYSFDVAGAHLIMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQGEGDGMMAIMEPLLYAASVDLVLAGHVHAYERSIRVNNGKPDPCGAVYITIGDGGNKEGLARKYVLTYRNIFELSNSNKK
MELKFVLTAFVFISATVTTAEYIRPQPRRTLEFPWDPKPSSHPQQVHISLAGDSHMRVTWITDDESSPSVVEYGTSPGGYNCGAEGESTSYRYLFYRSGKIHHTVIGPLEHDTVYFYRCGRQGPEFEFKTPPAQFPITFAVAGDLGQTGWTKSTLDHIGQCKYDVHLLPGDLSYADYMQHRWDTFGELVQPLASARPWMVTQGNHEKESIPLIMDAFQSYNARWKMPFEESGSNSNLYYSFDVAGAHLIMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQGEGDGMMAIMEPLLYAASVDLVLAGHVHAYERSIRVNNGKPDPCGAVYITIGDGGNKEGLARKYVLTYRNIFELS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELKFVLTAFVFISATVTTAEYIRPQPRRTLEFPWDPKPSSHPQQVHISLAGDSHMRVTWITDDESSPSVVEYGTSPGGYNCGAEGESTSYRYLFYRSGKIHHTVIGPLEHDTVYFYRCGRQGPEFEFKTPPAQFPITFAVAGDLGQTGWTKSTLDHIGQCKYDVHLLPGDLSYADYMQHRWDTFGELVQPLASARPWMVTQGNHEKESIPLIMDAFQSYNARWKMPFEESGSNSNLYYSFDVAGAHLIMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQGEGDGMMAIMEPLLYAASVDLVLAGHVHAYERSIRVNNGKPDPCGAVYITIGDGGNKEGLARKYVLTYRNIFELSNSNKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query378 2.2.26 [Sep-21-2011]
Q9LJU7437 Purple acid phosphatase 1 yes no 0.952 0.823 0.772 1e-170
Q8S340434 Purple acid phosphatase 2 no no 0.891 0.776 0.644 1e-128
Q9LXI4437 Purple acid phosphatase 2 no no 0.933 0.807 0.604 1e-121
Q9LXI7427 Probable purple acid phos no no 0.933 0.826 0.580 1e-115
Q949Y3475 Bifunctional purple acid no no 0.859 0.684 0.426 1e-71
Q6TPH1458 Purple acid phosphatase 2 no no 0.835 0.689 0.422 2e-70
Q93WP4481 Phosphoenolpyruvate phosp N/A no 0.859 0.675 0.447 2e-69
O23244466 Purple acid phosphatase 2 no no 0.957 0.776 0.405 2e-69
Q9C510466 Purple acid phosphatase 6 no no 0.947 0.768 0.399 5e-68
Q9SDZ9465 Purple acid phosphatase 2 N/A no 0.939 0.763 0.415 7e-67
>sp|Q9LJU7|PPA18_ARATH Purple acid phosphatase 18 OS=Arabidopsis thaliana GN=PAP18 PE=2 SV=1 Back     alignment and function desciption
 Score =  596 bits (1537), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 278/360 (77%), Positives = 307/360 (85%)

Query: 3   LKFVLTAFVFISATVTTAEYIRPQPRRTLEFPWDPKPSSHPQQVHISLAGDSHMRVTWIT 62
           L  V  +   I  +    +Y+RP+PR TL+FPW  K SS P+QVHISLAGD HMRVTW+T
Sbjct: 7   LLLVTLSVSIIFTSAAADDYVRPKPRETLQFPWKQKSSSVPEQVHISLAGDKHMRVTWVT 66

Query: 63  DDESSPSVVEYGTSPGGYNCGAEGESTSYRYLFYRSGKIHHTVIGPLEHDTVYFYRCGRQ 122
           +D+SSPS VEYGTSPG Y+   +GESTSY Y+ YRSGKIHHTVIGPLE DTVY+YRCG +
Sbjct: 67  NDKSSPSFVEYGTSPGKYSYLGQGESTSYSYIMYRSGKIHHTVIGPLEADTVYYYRCGGE 126

Query: 123 GPEFEFKTPPAQFPITFAVAGDLGQTGWTKSTLDHIGQCKYDVHLLPGDLSYADYMQHRW 182
           GPEF  KTPPAQFPITFAVAGDLGQTGWTKSTLDHI QCKY VHLLPGDLSYADYMQH+W
Sbjct: 127 GPEFHLKTPPAQFPITFAVAGDLGQTGWTKSTLDHIDQCKYAVHLLPGDLSYADYMQHKW 186

Query: 183 DTFGELVQPLASARPWMVTQGNHEKESIPLIMDAFQSYNARWKMPFEESGSNSNLYYSFD 242
           DTFGELVQPLAS RPWMVTQGNHEKESIP I+D F S+N+RWKMP+EESGSNSNLYYSF+
Sbjct: 187 DTFGELVQPLASVRPWMVTQGNHEKESIPFIVDEFVSFNSRWKMPYEESGSNSNLYYSFE 246

Query: 243 VAGAHLIMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQGEGD 302
           VAG H IMLGSY DYD YSDQY WLK DLSKVDR++TPWL+VL HVPWYNSN AHQ EGD
Sbjct: 247 VAGVHAIMLGSYTDYDRYSDQYSWLKADLSKVDRERTPWLIVLFHVPWYNSNNAHQHEGD 306

Query: 303 GMMAIMEPLLYAASVDLVLAGHVHAYERSIRVNNGKPDPCGAVYITIGDGGNKEGLARKY 362
            MMA MEPLLYA+ VD+V  GHVHAYER+ RVNNGK DPCG V+ITIGDGGN+EGLARKY
Sbjct: 307 EMMAEMEPLLYASGVDIVFTGHVHAYERTKRVNNGKSDPCGPVHITIGDGGNREGLARKY 366

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 2
>sp|Q8S340|PPA22_ARATH Purple acid phosphatase 22 OS=Arabidopsis thaliana GN=PAP22 PE=2 SV=1 Back     alignment and function description
>sp|Q9LXI4|PPA21_ARATH Purple acid phosphatase 21 OS=Arabidopsis thaliana GN=PAP21 PE=2 SV=1 Back     alignment and function description
>sp|Q9LXI7|PPA20_ARATH Probable purple acid phosphatase 20 OS=Arabidopsis thaliana GN=PAP20 PE=2 SV=1 Back     alignment and function description
>sp|Q949Y3|PPA26_ARATH Bifunctional purple acid phosphatase 26 OS=Arabidopsis thaliana GN=PAP26 PE=1 SV=1 Back     alignment and function description
>sp|Q6TPH1|PPA23_ARATH Purple acid phosphatase 23 OS=Arabidopsis thaliana GN=PAP23 PE=1 SV=2 Back     alignment and function description
>sp|Q93WP4|PEPP_ALLCE Phosphoenolpyruvate phosphatase OS=Allium cepa GN=ACPEPP PE=1 SV=1 Back     alignment and function description
>sp|O23244|PPA25_ARATH Purple acid phosphatase 25 OS=Arabidopsis thaliana GN=PAP25 PE=2 SV=2 Back     alignment and function description
>sp|Q9C510|PPA6_ARATH Purple acid phosphatase 6 OS=Arabidopsis thaliana GN=PAP6 PE=2 SV=1 Back     alignment and function description
>sp|Q9SDZ9|PPAF2_IPOBA Purple acid phosphatase 2 OS=Ipomoea batatas GN=PAP2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query378
358248462469 uncharacterized protein LOC100782338 [Gl 0.960 0.773 0.786 1e-172
187949279435 purple acid phosphatase [Glycine max] 0.960 0.834 0.786 1e-172
357459553433 Purple acid phosphatase [Medicago trunca 0.960 0.838 0.787 1e-172
224126441432 predicted protein [Populus trichocarpa] 0.955 0.835 0.779 1e-170
357601490437 PAP18 [Gossypium hirsutum] 0.910 0.787 0.808 1e-169
22331208437 purple acid phosphatase 18 [Arabidopsis 0.952 0.823 0.772 1e-168
25229112437 putative purple acid phosphatase [Arabid 0.952 0.823 0.769 1e-167
224117498432 predicted protein [Populus trichocarpa] 0.955 0.835 0.776 1e-167
357494441439 Purple acid phosphatase [Medicago trunca 0.925 0.797 0.772 1e-164
358248708460 purple acid phosphatase 18-like [Glycine 0.912 0.75 0.787 1e-162
>gi|358248462|ref|NP_001239630.1| uncharacterized protein LOC100782338 [Glycine max] gi|304421382|gb|ADM32490.1| phytase [Glycine max] Back     alignment and taxonomy information
 Score =  612 bits (1578), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 287/365 (78%), Positives = 321/365 (87%), Gaps = 2/365 (0%)

Query: 1   MELKFVL-TAFVFISATVTTA-EYIRPQPRRTLEFPWDPKPSSHPQQVHISLAGDSHMRV 58
           MELK +L T  + +S + T A +YIRPQPR+T   PW  KPSS+PQQVHISLAG+ HMRV
Sbjct: 35  MELKLLLITVLMMVSLSATAAADYIRPQPRKTFHLPWHSKPSSYPQQVHISLAGEQHMRV 94

Query: 59  TWITDDESSPSVVEYGTSPGGYNCGAEGESTSYRYLFYRSGKIHHTVIGPLEHDTVYFYR 118
           TWITDD S+PS+VEYGTSPG Y+  AEGE+TSY YL Y SGKIHHTVIGPLEH++VY+YR
Sbjct: 95  TWITDDNSAPSIVEYGTSPGRYDSVAEGETTSYSYLLYSSGKIHHTVIGPLEHNSVYYYR 154

Query: 119 CGRQGPEFEFKTPPAQFPITFAVAGDLGQTGWTKSTLDHIGQCKYDVHLLPGDLSYADYM 178
           CG QGP+F+ +TPPAQ PITFAVAGDLGQTGWTKSTLDHI QCKY+VHLLPGDLSYADY+
Sbjct: 155 CGGQGPQFQLRTPPAQLPITFAVAGDLGQTGWTKSTLDHIDQCKYNVHLLPGDLSYADYI 214

Query: 179 QHRWDTFGELVQPLASARPWMVTQGNHEKESIPLIMDAFQSYNARWKMPFEESGSNSNLY 238
           QHRWD+FG LVQPLASARPWMVTQGNHE ESIPL+ D F SYN+RWKMPFEESGSNSNLY
Sbjct: 215 QHRWDSFGRLVQPLASARPWMVTQGNHEVESIPLLKDGFLSYNSRWKMPFEESGSNSNLY 274

Query: 239 YSFDVAGAHLIMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQ 298
           YSF+VAG H+IMLGSYADYDEYS+QY WLK+DLSKVDR++TPWL+VL HVPWYNSN AHQ
Sbjct: 275 YSFEVAGVHIIMLGSYADYDEYSEQYGWLKEDLSKVDRERTPWLIVLFHVPWYNSNTAHQ 334

Query: 299 GEGDGMMAIMEPLLYAASVDLVLAGHVHAYERSIRVNNGKPDPCGAVYITIGDGGNKEGL 358
           GEG  MMA MEPLLYAAS DLVLAGHVHAYERS RV N + DPCG+V+ITIGDGGNKEGL
Sbjct: 335 GEGADMMASMEPLLYAASADLVLAGHVHAYERSKRVYNKRLDPCGSVHITIGDGGNKEGL 394

Query: 359 ARKYV 363
           A KY+
Sbjct: 395 APKYI 399

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|187949279|gb|ACD43082.1| purple acid phosphatase [Glycine max] Back     alignment and taxonomy information
>gi|357459553|ref|XP_003600057.1| Purple acid phosphatase [Medicago truncatula] gi|355489105|gb|AES70308.1| Purple acid phosphatase [Medicago truncatula] Back     alignment and taxonomy information
>gi|224126441|ref|XP_002319839.1| predicted protein [Populus trichocarpa] gi|222858215|gb|EEE95762.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357601490|gb|AET86955.1| PAP18 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|22331208|ref|NP_188686.2| purple acid phosphatase 18 [Arabidopsis thaliana] gi|75273656|sp|Q9LJU7.1|PPA18_ARATH RecName: Full=Purple acid phosphatase 18; Flags: Precursor gi|11994138|dbj|BAB01159.1| purple acid phosphatase-like protein [Arabidopsis thaliana] gi|17064824|gb|AAL32566.1| purple acid phosphatase-like protein [Arabidopsis thaliana] gi|20259848|gb|AAM13271.1| purple acid phosphatase-like protein [Arabidopsis thaliana] gi|332642867|gb|AEE76388.1| purple acid phosphatase 18 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|25229112|gb|AAN74649.1| putative purple acid phosphatase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224117498|ref|XP_002317591.1| predicted protein [Populus trichocarpa] gi|222860656|gb|EEE98203.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357494441|ref|XP_003617509.1| Purple acid phosphatase [Medicago truncatula] gi|355518844|gb|AET00468.1| Purple acid phosphatase [Medicago truncatula] Back     alignment and taxonomy information
>gi|358248708|ref|NP_001239671.1| purple acid phosphatase 18-like [Glycine max] gi|255636455|gb|ACU18566.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query378
TAIR|locus:2085770437 PAP18 "purple acid phosphatase 0.931 0.805 0.785 2.5e-159
TAIR|locus:2083238434 PAP22 "purple acid phosphatase 0.947 0.824 0.612 2.8e-121
TAIR|locus:2083218437 PAP21 "purple acid phosphatase 0.944 0.816 0.598 5e-115
TAIR|locus:2083288427 PAP20 [Arabidopsis thaliana (t 0.933 0.826 0.580 3.8e-110
TAIR|locus:2184657475 PAP26 "AT5G34850" [Arabidopsis 0.859 0.684 0.426 1.1e-69
TAIR|locus:2098500532 PAP15 "purple acid phosphatase 0.476 0.338 0.530 1.1e-64
UNIPROTKB|Q09131464 PAP "Purple acid phosphatase" 0.851 0.693 0.434 6e-64
TAIR|locus:2010753466 PAP6 "purple acid phosphatase 0.740 0.600 0.442 7.1e-61
TAIR|locus:2115345466 PAP25 "purple acid phosphatase 0.727 0.590 0.446 2.4e-60
TAIR|locus:2042689468 PAP10 "AT2G16430" [Arabidopsis 0.841 0.679 0.410 1.3e-59
TAIR|locus:2085770 PAP18 "purple acid phosphatase 18" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1552 (551.4 bits), Expect = 2.5e-159, P = 2.5e-159
 Identities = 278/354 (78%), Positives = 307/354 (86%)

Query:     9 AFVFISATVTTAEYIRPQPRRTLEFPWDPKPSSHPQQVHISLAGDSHMRVTWITDDESSP 68
             + +F SA     +Y+RP+PR TL+FPW  K SS P+QVHISLAGD HMRVTW+T+D+SSP
Sbjct:    15 SIIFTSAAAD--DYVRPKPRETLQFPWKQKSSSVPEQVHISLAGDKHMRVTWVTNDKSSP 72

Query:    69 SVVEYGTSPGGYNCGAEGESTSYRYLFYRSGKIHHTVIGPLEHDTVYFYRCGRQGPEFEF 128
             S VEYGTSPG Y+   +GESTSY Y+ YRSGKIHHTVIGPLE DTVY+YRCG +GPEF  
Sbjct:    73 SFVEYGTSPGKYSYLGQGESTSYSYIMYRSGKIHHTVIGPLEADTVYYYRCGGEGPEFHL 132

Query:   129 KTPPAQFPITFAVAGDLGQTGWTKSTLDHIGQCKYDVHLLPGDLSYADYMQHRWDTFGEL 188
             KTPPAQFPITFAVAGDLGQTGWTKSTLDHI QCKY VHLLPGDLSYADYMQH+WDTFGEL
Sbjct:   133 KTPPAQFPITFAVAGDLGQTGWTKSTLDHIDQCKYAVHLLPGDLSYADYMQHKWDTFGEL 192

Query:   189 VQPLASARPWMVTQGNHEKESIPLIMDAFQSYNARWKMPFEESGSNSNLYYSFDVAGAHL 248
             VQPLAS RPWMVTQGNHEKESIP I+D F S+N+RWKMP+EESGSNSNLYYSF+VAG H 
Sbjct:   193 VQPLASVRPWMVTQGNHEKESIPFIVDEFVSFNSRWKMPYEESGSNSNLYYSFEVAGVHA 252

Query:   249 IMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQGEGDGMMAIM 308
             IMLGSY DYD YSDQY WLK DLSKVDR++TPWL+VL HVPWYNSN AHQ EGD MMA M
Sbjct:   253 IMLGSYTDYDRYSDQYSWLKADLSKVDRERTPWLIVLFHVPWYNSNNAHQHEGDEMMAEM 312

Query:   309 EPLLYAASVDLVLAGHVHAYERSIRVNNGKPDPCGAVYITIGDGGNKEGLARKY 362
             EPLLYA+ VD+V  GHVHAYER+ RVNNGK DPCG V+ITIGDGGN+EGLARKY
Sbjct:   313 EPLLYASGVDIVFTGHVHAYERTKRVNNGKSDPCGPVHITIGDGGNREGLARKY 366
GO:0003993 "acid phosphatase activity" evidence=IEA;ISS
GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0016787 "hydrolase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0015824 "proline transport" evidence=RCA
TAIR|locus:2083238 PAP22 "purple acid phosphatase 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083218 PAP21 "purple acid phosphatase 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083288 PAP20 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184657 PAP26 "AT5G34850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098500 PAP15 "purple acid phosphatase 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q09131 PAP "Purple acid phosphatase" [Glycine max (taxid:3847)] Back     alignment and assigned GO terms
TAIR|locus:2010753 PAP6 "purple acid phosphatase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115345 PAP25 "purple acid phosphatase 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042689 PAP10 "AT2G16430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LJU7PPA18_ARATH3, ., 1, ., 3, ., 20.77220.95230.8237yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.976
3rd Layer3.6.1.13LOW CONFIDENCE prediction!
3rd Layer3.1.3.20.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_XIII0422
hypothetical protein (432 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query378
PLN02533427 PLN02533, PLN02533, probable purple acid phosphata 1e-165
cd00839294 cd00839, MPP_PAPs, purple acid phosphatases of the 3e-91
pfam00149185 pfam00149, Metallophos, Calcineurin-like phosphoes 6e-16
cd07378277 cd07378, MPP_ACP5, Homo sapiens acid phosphatase 5 7e-08
cd00838131 cd00838, MPP_superfamily, metallophosphatase super 8e-08
COG1409301 COG1409, Icc, Predicted phosphohydrolases [General 3e-06
cd07395262 cd07395, MPP_CSTP1, Homo sapiens CSTP1 and related 0.003
cd07402240 cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and 0.004
>gnl|CDD|215292 PLN02533, PLN02533, probable purple acid phosphatase Back     alignment and domain information 
 Score =  469 bits (1209), Expect = e-165
 Identities = 217/364 (59%), Positives = 262/364 (71%), Gaps = 8/364 (2%)

Query: 7   LTAFVFISATVTTAEYIRPQPRRTLEF-PWDPKPSSHPQQVHISLAGDSHMRVTWITDDE 65
           L A + I        Y RP  R+ L   P +    +HP QVHISL G   MR++WIT D 
Sbjct: 7   LVAILLIVLAGNVLSYDRPGTRKNLVIHPDNEDDPTHPDQVHISLVGPDKMRISWITQDS 66

Query: 66  SSPSVVEYGTSPGGYNCGAEGESTSYRYLF-YRSGKIHHTVIGPLEHDTVYFYRCG--RQ 122
             PSVV YGT  G Y   A G S+SY YL  YRSG+I+  VIGPL+ +TVY+Y+CG    
Sbjct: 67  IPPSVV-YGTVSGKYEGSANGTSSSYHYLLIYRSGQINDVVIGPLKPNTVYYYKCGGPSS 125

Query: 123 GPEFEFKTPPAQFPITFAVAGDLGQTGWTKSTLDHIGQCKYDVHLLPGDLSYADYMQHRW 182
             EF F+TPP++FPI FAV+GDLG + WTKSTL+H+ +  YDV +LPGDLSYA++ Q  W
Sbjct: 126 TQEFSFRTPPSKFPIKFAVSGDLGTSEWTKSTLEHVSKWDYDVFILPGDLSYANFYQPLW 185

Query: 183 DTFGELVQPLASARPWMVTQGNHEKESIPLIM-DAFQSYNARWKMPFEESGSNSNLYYSF 241
           DTFG LVQPLAS RPWMVT GNHE E IP++  + F +YNARW+MPFEESGS SNLYYSF
Sbjct: 186 DTFGRLVQPLASQRPWMVTHGNHELEKIPILHPEKFTAYNARWRMPFEESGSTSNLYYSF 245

Query: 242 DVAGAHLIMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQG-- 299
           +V G H+IMLGSY D++  S+QY+WL+++L K+DRK TPW++ ++H PWYNSNEAHQG  
Sbjct: 246 NVYGVHIIMLGSYTDFEPGSEQYQWLENNLKKIDRKTTPWVVAVVHAPWYNSNEAHQGEK 305

Query: 300 EGDGMMAIMEPLLYAASVDLVLAGHVHAYERSIRVNNGKPDPCGAVYITIGDGGNKEGLA 359
           E  GM   ME LLY A VDLV AGHVHAYER  RV  GK D CG VYITIGDGGN+EGLA
Sbjct: 306 ESVGMKESMETLLYKARVDLVFAGHVHAYERFDRVYQGKTDKCGPVYITIGDGGNREGLA 365

Query: 360 RKYV 363
            KY+
Sbjct: 366 TKYI 369

Length = 427
>gnl|CDD|163615 cd00839, MPP_PAPs, purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information
>gnl|CDD|163621 cd07378, MPP_ACP5, Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|224327 COG1409, Icc, Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>gnl|CDD|163638 cd07395, MPP_CSTP1, Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163645 cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 378
PLN02533427 probable purple acid phosphatase 100.0
KOG1378452 consensus Purple acid phosphatase [Carbohydrate tr 100.0
cd00839294 MPP_PAPs purple acid phosphatases of the metalloph 100.0
cd07395262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 99.97
PTZ00422394 glideosome-associated protein 50; Provisional 99.97
cd07378277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 99.97
cd07396267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 99.94
cd07402240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 99.93
PF09423453 PhoD: PhoD-like phosphatase; InterPro: IPR018946 T 99.92
KOG2679336 consensus Purple (tartrate-resistant) acid phospha 99.91
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 99.91
PRK11148275 cyclic 3',5'-adenosine monophosphate phosphodieste 99.91
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 99.9
COG3540522 PhoD Phosphodiesterase/alkaline phosphatase D [Ino 99.88
cd00842296 MPP_ASMase acid sphingomyelinase and related prote 99.87
cd08163257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 99.8
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 99.79
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 99.76
TIGR03767496 P_acnes_RR metallophosphoesterase, PPA1498 family. 99.75
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 99.75
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 99.74
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 99.74
PRK11340271 phosphodiesterase YaeI; Provisional 99.72
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 99.71
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 99.7
COG1409301 Icc Predicted phosphohydrolases [General function 99.67
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 99.66
TIGR03768492 RPA4764 metallophosphoesterase, RPA4764 family. Th 99.64
KOG1432379 consensus Predicted DNA repair exonuclease SIA1 [G 99.62
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 99.61
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 99.59
COG1408284 Predicted phosphohydrolases [General function pred 99.48
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 99.46
cd00838131 MPP_superfamily metallophosphatase superfamily, me 99.44
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 99.44
cd07397238 MPP_DevT Myxococcus xanthus DevT and related prote 99.44
COG2129226 Predicted phosphoesterases, related to the Icc pro 99.41
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 99.31
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 99.3
PF14582255 Metallophos_3: Metallophosphoesterase, calcineurin 99.3
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 99.29
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 99.28
PRK05340241 UDP-2,3-diacylglucosamine hydrolase; Provisional 99.25
KOG3770 577 consensus Acid sphingomyelinase and PHM5 phosphate 99.23
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 99.22
TIGR01854231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 99.16
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 99.15
cd07389228 MPP_PhoD Bacillus subtilis PhoD and related protei 99.12
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 99.1
PRK09453182 phosphodiesterase; Provisional 99.1
TIGR00583 405 mre11 DNA repair protein (mre11). All proteins in 99.05
cd00845252 MPP_UshA_N_like Escherichia coli UshA-like family, 99.01
cd07410277 MPP_CpdB_N Escherichia coli CpdB and related prote 98.96
cd07406257 MPP_CG11883_N Drosophila melanogaster CG11883 and 98.96
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 98.9
COG1768230 Predicted phosphohydrolase [General function predi 98.88
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 98.85
PHA02546340 47 endonuclease subunit; Provisional 98.83
cd00844262 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t 98.81
COG0622172 Predicted phosphoesterase [General function predic 98.77
COG0420 390 SbcD DNA repair exonuclease [DNA replication, reco 98.75
cd07412288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 98.75
cd07408257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 98.71
cd07411264 MPP_SoxB_N Thermus thermophilus SoxB and related p 98.65
TIGR00282266 metallophosphoesterase, MG_246/BB_0505 family. A m 98.6
cd07382255 MPP_DR1281 Deinococcus radiodurans DR1281 and rela 98.6
cd07409281 MPP_CD73_N CD73 ecto-5'-nucleotidase and related p 98.57
COG2908237 Uncharacterized protein conserved in bacteria [Fun 98.57
PRK04036504 DNA polymerase II small subunit; Validated 98.52
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 98.51
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 98.48
KOG3662 410 consensus Cell division control protein/predicted 98.48
TIGR00619253 sbcd exonuclease SbcD. This family is based on the 98.45
cd07407282 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and 98.45
cd07386243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 98.45
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 98.41
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 98.37
cd07405285 MPP_UshA_N Escherichia coli UshA and related prote 98.36
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 98.35
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 98.34
PRK10966 407 exonuclease subunit SbcD; Provisional 98.34
PRK09968218 serine/threonine-specific protein phosphatase 2; P 98.34
cd08162313 MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA 98.23
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras 98.21
PRK09558 551 ushA bifunctional UDP-sugar hydrolase/5'-nucleotid 98.06
TIGR01530 550 nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi 97.98
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 97.94
COG1311481 HYS2 Archaeal DNA polymerase II, small subunit/DNA 97.86
PRK11907 814 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 97.8
PHA02239235 putative protein phosphatase 97.79
TIGR00024225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 97.78
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 97.78
PRK09418 780 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 97.7
PF13277253 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C. 97.59
PRK00166275 apaH diadenosine tetraphosphatase; Reviewed 97.56
cd07387257 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2 97.56
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 97.54
COG1692266 Calcineurin-like phosphoesterase [General function 97.46
PRK09420 649 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp 97.45
KOG2863 456 consensus RNA lariat debranching enzyme [RNA proce 97.42
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 97.4
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 97.37
TIGR01390 626 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod 97.36
cd07421304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 97.34
cd07413222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 97.32
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 97.27
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 97.17
cd07422257 MPP_ApaH Escherichia coli ApaH and related protein 97.05
cd07381239 MPP_CapA CapA and related proteins, metallophospha 97.01
COG5555392 Cytolysin, a secreted calcineurin-like phosphatase 96.99
TIGR00668279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 96.89
smart00854239 PGA_cap Bacterial capsule synthesis protein PGA_ca 96.87
COG1407235 Predicted ICC-like phosphoesterases [General funct 96.67
PF09587250 PGA_cap: Bacterial capsule synthesis protein PGA_c 96.27
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 96.17
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic 96.04
KOG2310 646 consensus DNA repair exonuclease MRE11 [Replicatio 95.99
cd07416305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 95.97
cd07415285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 95.57
cd07420321 MPP_RdgC Drosophila melanogaster RdgC and related 95.3
cd07414293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 95.3
PTZ00239303 serine/threonine protein phosphatase 2A; Provision 95.25
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisio 95.18
KOG3325183 consensus Membrane coat complex Retromer, subunit 95.07
KOG4419 602 consensus 5' nucleotidase [Nucleotide transport an 94.92
cd07418377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 94.88
KOG3947305 consensus Phosphoesterases [General function predi 94.87
PTZ00480320 serine/threonine-protein phosphatase; Provisional 94.79
cd07417316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 94.07
KOG4221 1381 consensus Receptor mediating netrin-dependent axon 93.67
PF04042209 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit 93.58
cd07419311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 93.53
smart0006083 FN3 Fibronectin type 3 domain. One of three types 93.23
cd0006393 FN3 Fibronectin type 3 domain; One of three types 92.29
KOG35131051 consensus Neural cell adhesion molecule L1 [Signal 89.7
PF1400862 Metallophos_C: Iron/zinc purple acid phosphatase-l 85.28
PF0813925 LPAM_1: Prokaryotic membrane lipoprotein lipid att 84.91
PRK13792127 lysozyme inhibitor; Provisional 82.72
KOG2476 528 consensus Uncharacterized conserved protein [Funct 80.08
>PLN02533 probable purple acid phosphatase Back     alignment and domain information 
Probab=100.00  E-value=1.1e-70  Score=529.44  Aligned_cols=364  Identities=59%  Similarity=1.079  Sum_probs=310.6

Q ss_pred             CcchhhHHHHHHHhhcCCCCccccCCCCCCccc-CCCCCCCCCCceEEEEecCCCeEEEEEEcCCCCCCcEEEEeccCCC
Q 017051            1 MELKFVLTAFVFISATVTTAEYIRPQPRRTLEF-PWDPKPSSHPQQVHISLAGDSHMRVTWITDDESSPSVVEYGTSPGG   79 (378)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~p~~v~l~~~~~~~~~i~W~t~~~~~~~~v~y~~~~~~   79 (378)
                      |.+-|.++.++++....++.+|+|++|+..+.+ +.+......|+||||++++.++|+|+|.|.+. ..+.|+||++++.
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~qvhls~~~~~~m~V~W~T~~~-~~~~V~yG~~~~~   79 (427)
T PLN02533          1 MVKVLGLVAILLIVLAGNVLSYDRPGTRKNLVIHPDNEDDPTHPDQVHISLVGPDKMRISWITQDS-IPPSVVYGTVSGK   79 (427)
T ss_pred             ChhhHHHHHHHHhhhccCcccccCCCccccccccccCCCCCCCCceEEEEEcCCCeEEEEEECCCC-CCCEEEEecCCCC
Confidence            445555555566666667799999998875543 23457888999999999999999999999964 5689999999888


Q ss_pred             CCeeEEeeeeEEeee-eeccCeEEEEEECCCCCCCEEEEEeCc--cCceeEEECCCCCCCeEEEEEcccCCCCChHHHHH
Q 017051           80 YNCGAEGESTSYRYL-FYRSGKIHHTVIGPLEHDTVYFYRCGR--QGPEFEFKTPPAQFPITFAVAGDLGQTGWTKSTLD  156 (378)
Q Consensus        80 ~~~~~~~~~~~~~~~-~~~~~~~h~~~l~~L~p~t~Y~Y~v~~--~s~~~~F~t~p~~~~~~f~~~gD~~~~~~~~~~~~  156 (378)
                      ++..+.|.+++|.+. ...++++|+|+|+||+|+|+|+|||+.  ++++++|+|+|...+++|+++||+|...+...+++
T Consensus        80 l~~~a~g~~~~~~~~~~~~~g~iH~v~l~~L~p~T~Y~Yrvg~~~~s~~~~F~T~p~~~~~~f~v~GDlG~~~~~~~tl~  159 (427)
T PLN02533         80 YEGSANGTSSSYHYLLIYRSGQINDVVIGPLKPNTVYYYKCGGPSSTQEFSFRTPPSKFPIKFAVSGDLGTSEWTKSTLE  159 (427)
T ss_pred             CcceEEEEEEEEeccccccCCeEEEEEeCCCCCCCEEEEEECCCCCccceEEECCCCCCCeEEEEEEeCCCCcccHHHHH
Confidence            888888887777642 246789999999999999999999985  47889999999878999999999998777778889


Q ss_pred             HhhcCCCcEEEeccccccccchhhhHHHHHHhhHhhhhCCceeecCCCCccCCCCcc-cchhhhchhcccCCCCCCCCCC
Q 017051          157 HIGQCKYDVHLLPGDLSYADYMQHRWDTFGELVQPLASARPWMVTQGNHEKESIPLI-MDAFQSYNARWKMPFEESGSNS  235 (378)
Q Consensus       157 ~i~~~~~d~vi~~GDl~~~~~~~~~~~~~~~~~~~l~~~~P~~~v~GNHD~~~~~~~-~~~~~~~~~~~~~p~~~~~~~~  235 (378)
                      .+.+.+|||||++||++|++..+..|+.|++.++++.+.+|+|+++||||....+.. ...+..|.++|.+|.+..+...
T Consensus       160 ~i~~~~pD~vl~~GDl~y~~~~~~~wd~f~~~i~~l~s~~P~m~~~GNHE~~~~~~~~~~~f~~y~~rf~mP~~~~g~~~  239 (427)
T PLN02533        160 HVSKWDYDVFILPGDLSYANFYQPLWDTFGRLVQPLASQRPWMVTHGNHELEKIPILHPEKFTAYNARWRMPFEESGSTS  239 (427)
T ss_pred             HHHhcCCCEEEEcCccccccchHHHHHHHHHHhhhHhhcCceEEeCccccccccccccCcCccchhhcccCCccccCCCC
Confidence            998899999999999999888788999999999999888999999999999643211 2467788899999986655567


Q ss_pred             CceEEEEeCCEEEEEEcCcCCCCCcHHHHHHHHHHhhhccCCCCCeEEEEeccccccCCCCCCCC--chHHHHHHHHHHH
Q 017051          236 NLYYSFDVAGAHLIMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQGE--GDGMMAIMEPLLY  313 (378)
Q Consensus       236 ~~~ysf~~g~v~fi~ldt~~~~~~~~~Q~~WL~~~L~~~~~~~~~~~iv~~H~P~~~~~~~~~~~--~~~~~~~l~~l~~  313 (378)
                      +.||+|++|++|||+||++.++....+|++||+++|++++++++||+||++|+|+|++...+.+.  ...+++.|+++|.
T Consensus       240 ~~yYSfd~g~vhfI~Lds~~~~~~~~~Q~~WLe~dL~~~~r~~~pwiIv~~H~P~y~s~~~~~~~~~~~~~r~~le~Ll~  319 (427)
T PLN02533        240 NLYYSFNVYGVHIIMLGSYTDFEPGSEQYQWLENNLKKIDRKTTPWVVAVVHAPWYNSNEAHQGEKESVGMKESMETLLY  319 (427)
T ss_pred             CceEEEEECCEEEEEEeCCccccCchHHHHHHHHHHHhhcccCCCEEEEEeCCCeeecccccCCcchhHHHHHHHHHHHH
Confidence            89999999999999999998887789999999999999887778999999999999876544332  2346789999999


Q ss_pred             hcCCcEEEecCccccceeecccCCCcCCCccEEEEeCCCCCCCCcccccccc
Q 017051          314 AASVDLVLAGHVHAYERSIRVNNGKPDPCGAVYITIGDGGNKEGLARKYVLT  365 (378)
Q Consensus       314 ~~~vdlvl~GH~H~y~r~~~~~~~~~~~~g~~yiv~G~gG~~~~~~~~~~~p  365 (378)
                      +++||++|+||+|.|+|+.|+++++.+++|++||++|+||+.++....+.+|
T Consensus       320 ~~~VdlvlsGH~H~YeR~~p~~~~~~~~~gpvyiv~G~gG~~e~~~~~~~~~  371 (427)
T PLN02533        320 KARVDLVFAGHVHAYERFDRVYQGKTDKCGPVYITIGDGGNREGLATKYIDP  371 (427)
T ss_pred             HhCCcEEEecceecccccccccCCccCCCCCEEEEeCCCccccccccccCCC
Confidence            9999999999999999999999999999999999999999999876666444

>KOG1378 consensus Purple acid phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PTZ00422 glideosome-associated protein 50; Provisional Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>PF09423 PhoD: PhoD-like phosphatase; InterPro: IPR018946 This entry contains a number of putative proteins as well as Alkaline phosphatase D which catalyses the reaction: A phosphate monoester + H(2)O = an alcohol + phosphate ; PDB: 2YEQ_B Back     alignment and domain information
>KOG2679 consensus Purple (tartrate-resistant) acid phosphatase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>COG3540 PhoD Phosphodiesterase/alkaline phosphatase D [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR03767 P_acnes_RR metallophosphoesterase, PPA1498 family Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR03768 RPA4764 metallophosphoesterase, RPA4764 family Back     alignment and domain information
>KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only] Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>KOG3770 consensus Acid sphingomyelinase and PHM5 phosphate metabolism protein [Lipid transport and metabolism] Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07389 MPP_PhoD Bacillus subtilis PhoD and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1768 Predicted phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>KOG3662 consensus Cell division control protein/predicted DNA repair exonuclease [Replication, recombination and repair] Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>cd08162 MPP_PhoA_N Synechococcus sp Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PF13277 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1692 Calcineurin-like phosphoesterase [General function prediction only] Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>KOG2863 consensus RNA lariat debranching enzyme [RNA processing and modification] Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07381 MPP_CapA CapA and related proteins, metallophosphatase domain Back     alignment and domain information
>COG5555 Cytolysin, a secreted calcineurin-like phosphatase [Cell motility and secretion] Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>smart00854 PGA_cap Bacterial capsule synthesis protein PGA_cap Back     alignment and domain information
>COG1407 Predicted ICC-like phosphoesterases [General function prediction only] Back     alignment and domain information
>PF09587 PGA_cap: Bacterial capsule synthesis protein PGA_cap; InterPro: IPR019079 CapA is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>KOG2310 consensus DNA repair exonuclease MRE11 [Replication, recombination and repair] Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>KOG3325 consensus Membrane coat complex Retromer, subunit VPS29/PEP11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4419 consensus 5' nucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>KOG3947 consensus Phosphoesterases [General function prediction only] Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>KOG4221 consensus Receptor mediating netrin-dependent axon guidance [Signal transduction mechanisms] Back     alignment and domain information
>PF04042 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit B; InterPro: IPR007185 DNA polymerase epsilon is essential for cell viability and chromosomal DNA replication in budding yeast Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>KOG3513 consensus Neural cell adhesion molecule L1 [Signal transduction mechanisms] Back     alignment and domain information
>PF14008 Metallophos_C: Iron/zinc purple acid phosphatase-like protein C; PDB: 3KBP_B 1KBP_B 4KBP_C 2QFP_B 2QFR_A 1XZW_B Back     alignment and domain information
>PF08139 LPAM_1: Prokaryotic membrane lipoprotein lipid attachment site; InterPro: IPR012640 In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II) Back     alignment and domain information
>PRK13792 lysozyme inhibitor; Provisional Back     alignment and domain information
>KOG2476 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query378
1kbp_A432 Kidney Bean Purple Acid Phosphatase Length = 432 6e-63
2qfp_A424 Crystal Structure Of Red Kidney Bean Purple Acid Ph 6e-63
4dsy_A426 Crystal Structure Of Red Kidney Bean Purple Acid Ph 7e-63
1xzw_A426 Sweet Potato Purple Acid PhosphatasePHOSPHATE COMPL 2e-62
>pdb|1KBP|A Chain A, Kidney Bean Purple Acid Phosphatase Length = 432 Back     alignment and structure 
Iteration: 1

 Score =  238 bits (606), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 144/339 (42%), Positives = 189/339 (55%), Gaps = 28/339 (8%)
Query: 43  PQQVHIS---LAGDSHMRVTWITDDESSPSVVEYGTSPGGYNCGAEGESTSYRYLFYRSG 99
           PQQVHI+   L G + M ++W+T DE   S V Y +   G    A+G+ ++YR+  Y SG
Sbjct: 27  PQQVHITQGDLVGRA-MIISWVTMDEPGSSAVRYWSEKNGRKRIAKGKMSTYRFFNYSSG 85
Query: 100 KIHHTVIGPLEHDTVYFYRCGRQGP--EFEFKTPPA---QFPITFAVAGDLGQTGWTKST 154
            IHHT I  L+++T Y+Y  G +     F F TPP      P TF + GDLGQ+  + +T
Sbjct: 86  FIHHTTIRKLKYNTKYYYEVGLRNTTRRFSFITPPQTGLDVPYTFGLIGDLGQSFDSNTT 145
Query: 155 LDH--IGQCKYDVHLLPGDLSYAD-YMQH---RWDTFGELVQPLASARPWMVTQGNHEKE 208
           L H  +   K    L  GDLSYAD Y  H   RWDT+G   +   + +PW+ T GNHE E
Sbjct: 146 LSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRFTERSVAYQPWIWTAGNHEIE 205
Query: 209 SIPLI--MDAFQSYNARWKMPFEESGSNSNLYYSFDVAGAHLIMLGSYADYDEYSDQYRW 266
             P I   + F+ ++ R+ +P+E S S S  +YS   A AH+I+L SY+ Y   + QY W
Sbjct: 206 FAPEINETEPFKPFSYRYHVPYEASQSTSPFWYSIKRASAHIIVLSSYSAYGRGTPQYTW 265
Query: 267 LKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQGEGDGMMAIMEPLLYAASVDLVLAGHVH 326
           LK +L KV R +TPWL+VL+H P YNS   H  EG+ M    E       VD+V AGHVH
Sbjct: 266 LKKELRKVKRSETPWLIVLMHSPLYNSYNHHFMEGEAMRTKFEAWFVKYKVDVVFAGHVH 325
Query: 327 AYERSIRVNNGK-----------PDPCGAVYITIGDGGN 354
           AYERS RV+N              D    VYITIGD GN
Sbjct: 326 AYERSERVSNIAYKITDGLCTPVKDQSAPVYITIGDAGN 364
>pdb|2QFP|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase In Complex With Fluoride Length = 424 Back     alignment and structure
>pdb|4DSY|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase In Complex With Maybridge Fragment Cc24201 Length = 426 Back     alignment and structure
>pdb|1XZW|A Chain A, Sweet Potato Purple Acid PhosphatasePHOSPHATE COMPLEX Length = 426 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query378
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 1e-114
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 1e-112
1ute_A313 Protein (II purple acid phosphatase); tartrate res 1e-35
3tgh_A342 Glideosome-associated protein 50; phosphatase fold 3e-31
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 3e-11
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fo 3e-10
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 6e-10
2nxf_A322 Putative dimetal phosphatase; dinuclear metal cent 2e-08
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 5e-06
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Length = 426 Back     alignment and structure
 Score =  337 bits (866), Expect = e-114
 Identities = 144/369 (39%), Positives = 196/369 (53%), Gaps = 33/369 (8%)

Query: 27  PRRTLEFPWD------PKPSSHPQQVHISLAGD--SHMRVTWITD-DESSPSVVEYGTSP 77
               ++ PWD      P   + PQQVHI+        + ++W T  D++  + V Y +  
Sbjct: 3   NAEDVDMPWDSDVFAVPSGYNAPQQVHITQGDYEGRGVIISWTTPYDKAGANKVFYWSEN 62

Query: 78  GGYNCGAEGESTSYRYLFYRSGKIHHTVIGPLEHDTVYFYRCG--RQGPEFEFKTPPA-- 133
                 A G   +Y+Y  Y S  IHH  I  LE+DT Y+YR G      +F F TPP   
Sbjct: 63  SKSQKRAMGTVVTYKYYNYTSAFIHHCTIKDLEYDTKYYYRLGFGDAKRQFWFVTPPKPG 122

Query: 134 -QFPITFAVAGDLGQTGWTKSTLDHIGQ--CKYDVHLLPGDLSYADYM----QHRWDTFG 186
              P  F + GD+GQT  + +TL H  Q   K    L  GDLSY++       +RWDT+G
Sbjct: 123 PDVPYVFGLIGDIGQTHDSNTTLTHYEQNSAKGQAVLFMGDLSYSNRWPNHDNNRWDTWG 182

Query: 187 ELVQPLASARPWMVTQGNHEKESIPLIMDA--FQSYNARWKMPFEESGSNSNLYYSFDVA 244
              +   + +PW+ T GNHE +  P I +   F  +  R+  P E SGS   L+Y+   A
Sbjct: 183 RFSERSVAYQPWIWTAGNHEIDYAPDIGEYQPFVPFTNRYPTPHEASGSGDPLWYAIKRA 242

Query: 245 GAHLIMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQGEGDGM 304
            AH+I+L SY+ + +YS QY+W   +L KV+R +TPWL+VL+H P YNS EAH  EG+ M
Sbjct: 243 SAHIIVLSSYSGFVKYSPQYKWFTSELEKVNRSETPWLIVLVHAPLYNSYEAHYMEGEAM 302

Query: 305 MAIMEPLLYAASVDLVLAGHVHAYERSIRVNNGKPD-----------PCGAVYITIGDGG 353
            AI EP      VD+V +GHVH+YERS RV+N   +               VYITIGDGG
Sbjct: 303 RAIFEPYFVYYKVDIVFSGHVHSYERSERVSNVAYNIVNAKCTPVSDESAPVYITIGDGG 362

Query: 354 NKEGLARKY 362
           N EGLA + 
Sbjct: 363 NSEGLASEM 371
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Length = 424 Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Length = 313 Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Length = 342 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Length = 274 Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Length = 330 Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Length = 443 Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Length = 322 Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Length = 228 Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Length = 260 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query378
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 100.0
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 100.0
2yeq_A527 Apased, PHOD, alkaline phosphatase D; hydrolase, p 100.0
3tgh_A342 Glideosome-associated protein 50; phosphatase fold 99.97
1ute_A313 Protein (II purple acid phosphatase); tartrate res 99.96
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fo 99.92
2nxf_A322 Putative dimetal phosphatase; dinuclear metal cent 99.92
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 99.91
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 99.87
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 99.72
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 99.7
2q8u_A336 Exonuclease, putative; structural genomics, joint 99.6
3av0_A 386 DNA double-strand break repair protein MRE11; DNA 99.57
3rl5_A296 Metallophosphoesterase mpped2; alpha-beta fold, me 99.54
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 99.52
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 99.49
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 99.48
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 99.45
3tho_B 379 Exonuclease, putative; adenosine triphosphate, bac 99.43
3ck2_A176 Conserved uncharacterized protein (predicted phosp 99.41
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 99.41
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 99.38
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 99.33
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 99.3
4fbw_A 417 DNA repair protein RAD32; DNA double-strand break 99.29
4fbk_A 472 DNA repair and telomere maintenance protein NBS1, 99.26
3t1i_A 431 Double-strand break repair protein MRE11A; DNA rep 99.24
1ii7_A333 MRE11 nuclease; RAD50, DNA double-strand break rep 99.21
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 99.04
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 98.88
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 98.85
3qfk_A 527 Uncharacterized protein; structural genomics, cent 98.81
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 98.69
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 98.68
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 98.66
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 98.66
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 98.64
1t70_A255 Phosphatase; crystal, X-RAY crystallography, struc 98.52
2z06_A252 Putative uncharacterized protein TTHA0625; metal b 98.51
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 98.49
1t71_A281 Phosphatase, conserved HYPO; crystal, X-RAY crysta 98.47
3gve_A341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 98.32
3jyf_A339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 98.12
4h1s_A 530 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo 98.01
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 97.76
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 97.7
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 97.65
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 97.6
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 97.58
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 97.55
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 97.54
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 97.52
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 97.46
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 97.43
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 97.4
1x4x_A106 Fibronectin type-III domain containing protein 3A; 97.38
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 97.36
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 97.35
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 97.3
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 97.29
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 97.29
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 97.27
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 97.26
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 97.26
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 97.25
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 97.24
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 97.19
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 97.15
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 97.13
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 97.13
1x5x_A109 Fibronectin type-III domain containing protein 3A; 97.12
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 97.11
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 97.09
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 97.09
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 97.08
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 97.08
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 97.08
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 97.06
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 97.04
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 97.02
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 97.0
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 96.96
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 96.92
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 96.91
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 96.9
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 96.9
3e0j_A476 DNA polymerase subunit delta-2; DNA polymerase del 96.89
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 96.87
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 96.87
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 96.87
3k2m_C101 Monobody HA4; engineered binding protein, antibody 96.86
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 96.86
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 96.85
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 96.83
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 96.81
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 96.8
3t04_D103 Monobody 7C12; engineered binding protein, antibod 96.8
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 96.79
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 96.79
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 96.79
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 96.78
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 96.77
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 96.77
2crz_A110 Fibronectin type-III domain containing protein 3A; 96.75
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 96.75
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 96.73
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 96.72
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 96.68
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 96.68
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 96.64
1x3d_A118 Fibronectin type-III domain containing protein 3A; 96.63
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 96.59
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 96.58
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 96.58
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 96.58
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 96.57
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 96.57
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 96.49
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 96.46
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 96.43
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 96.43
2crm_A120 Fibronectin type-III domain containing protein 3A; 96.41
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 96.35
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 96.35
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 96.32
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 96.31
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 96.31
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 96.23
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 96.22
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 96.21
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 96.2
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 96.16
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 96.16
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 96.15
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 95.94
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 95.94
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 95.93
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 95.91
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 95.88
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 95.86
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 95.78
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 95.78
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 95.74
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 95.71
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 95.65
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 95.65
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 95.54
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 95.52
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 95.48
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 95.47
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 95.39
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 95.34
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 95.3
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 95.23
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 95.17
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 95.16
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 95.11
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 95.1
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 95.0
1oww_A98 FN, fibronectin first type III module, CIG; fibron 94.91
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 94.88
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 94.86
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 94.84
1eer_B227 Epobp, erythropoietin receptor; signal transductio 94.44
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 94.38
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 94.23
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 94.06
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 94.01
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 93.83
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 93.71
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 93.38
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 93.29
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 93.22
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 93.22
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 92.85
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 92.51
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 92.38
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 92.35
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 91.98
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 91.91
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 91.89
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 91.63
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 91.42
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 91.31
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 90.67
2erj_C247 Cytokine receptor common gamma chain; immune syste 90.64
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 90.59
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 90.18
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 90.08
3flo_A460 DNA polymerase alpha subunit B; protein-protein co 90.07
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 89.91
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 89.81
2gys_A419 Cytokine receptor common beta chain; dimer of inte 89.22
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 89.13
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 89.04
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 88.69
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 88.44
3b4n_A344 Endo-pectate lyase; pectin, galacturonic acid, rig 85.09
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 83.92
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 83.8
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 83.35
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 83.07
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 82.35
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 81.77
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 80.4
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
Probab=100.00  E-value=3.6e-59  Score=454.52  Aligned_cols=325  Identities=43%  Similarity=0.736  Sum_probs=274.3

Q ss_pred             CCCCCCceEEEEecC--CCeEEEEEEcC-CCCCCcEEEEeccCCCCCeeEEeeeeEEeeeeeccCeEEEEEECCCCCCCE
Q 017051           38 KPSSHPQQVHISLAG--DSHMRVTWITD-DESSPSVVEYGTSPGGYNCGAEGESTSYRYLFYRSGKIHHTVIGPLEHDTV  114 (378)
Q Consensus        38 ~~~~~p~~v~l~~~~--~~~~~i~W~t~-~~~~~~~v~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~l~~L~p~t~  114 (378)
                      .+...|+||||++++  .++|+|+|.|. +.++.+.|+|++.++.+...+.|++++|.+....++++|+|+|+||+|||+
T Consensus        20 ~~~~~p~~v~l~~~~~~~~~~~v~W~t~~~~~~~~~V~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~l~gL~p~t~   99 (426)
T 1xzw_A           20 SGYNAPQQVHITQGDYEGRGVIISWTTPYDKAGANKVFYWSENSKSQKRAMGTVVTYKYYNYTSAFIHHCTIKDLEYDTK   99 (426)
T ss_dssp             CSTTCCEEEEEEECSSSSSCEEEEEEESSCCTTTTEEEEEETTCCCCEEEECEEECCEETTEECCEEEEEEECCCCTTCE
T ss_pred             CCCCCCceEEEEECCCCCCeEEEEEEeCCCCCCCCEEEEecCCCCCceEEEEEEEEEEecCCcCCEEEEEEECCCCCCCE
Confidence            456899999999988  59999999999 777889999999887777778877766665445788999999999999999


Q ss_pred             EEEEeCc--cCceeEEECCCC---CCCeEEEEEcccCCCCChHHHHHHhhcC--CCcEEEeccccccccch----hhhHH
Q 017051          115 YFYRCGR--QGPEFEFKTPPA---QFPITFAVAGDLGQTGWTKSTLDHIGQC--KYDVHLLPGDLSYADYM----QHRWD  183 (378)
Q Consensus       115 Y~Y~v~~--~s~~~~F~t~p~---~~~~~f~~~gD~~~~~~~~~~~~~i~~~--~~d~vi~~GDl~~~~~~----~~~~~  183 (378)
                      |+|||+.  +|++++|+|+|.   ..++||+++||+|.......+++++.+.  +|||||++||++|.++.    ...|+
T Consensus       100 Y~Yrv~~g~~s~~~~f~T~p~~~~~~~~~f~~~gD~~~~~~~~~~l~~i~~~~~~~D~vl~~GD~~y~~~~~~~~~~~~~  179 (426)
T 1xzw_A          100 YYYRLGFGDAKRQFWFVTPPKPGPDVPYVFGLIGDIGQTHDSNTTLTHYEQNSAKGQAVLFMGDLSYSNRWPNHDNNRWD  179 (426)
T ss_dssp             EEEEECCGGGCEEEEEECCCCCCTTCCEEEEEECSCTTBHHHHHHHHHHHHCTTCCSEEEECSCCCCGGGSGGGCTHHHH
T ss_pred             EEEEECCCCccceeEEECCCCCCCCCCeEEEEEEeCCCCCchHHHHHHHHhCCCCCCEEEeCCChhhcccCCcccchHHH
Confidence            9999985  588999999985   5689999999998765456677787755  89999999999997654    46799


Q ss_pred             HHHHhhHhhhhCCceeecCCCCccCCCCc--ccchhhhchhcccCCCCCCCCCCCceEEEEeCCEEEEEEcCcCCCCCcH
Q 017051          184 TFGELVQPLASARPWMVTQGNHEKESIPL--IMDAFQSYNARWKMPFEESGSNSNLYYSFDVAGAHLIMLGSYADYDEYS  261 (378)
Q Consensus       184 ~~~~~~~~l~~~~P~~~v~GNHD~~~~~~--~~~~~~~~~~~~~~p~~~~~~~~~~~ysf~~g~v~fi~ldt~~~~~~~~  261 (378)
                      .|.+.++++.+.+|+++++||||+...+.  ....+..|.++|.+|.+..+...+.||+|++|+++||+||++..+..+.
T Consensus       180 ~~~~~l~~l~~~~P~~~v~GNHD~~~~~~~~~~~~~~~~~~~f~~p~~~~~~~~~~~ys~~~g~~~~i~Ldt~~~~~~~~  259 (426)
T 1xzw_A          180 TWGRFSERSVAYQPWIWTAGNHEIDYAPDIGEYQPFVPFTNRYPTPHEASGSGDPLWYAIKRASAHIIVLSSYSGFVKYS  259 (426)
T ss_dssp             HHHHHHHHHHTTSCEECCCCGGGCCCBGGGTBCSTTHHHHHHSCCCCGGGTCSSTTSEEEEETTEEEEECCTTSCCSTTS
T ss_pred             HHHHHHHHHHhcCCEEEeccccccccCCccccccCChhheEEEeCCcccCCCCCCCeEEEEECCEEEEEeeCcccCCCCH
Confidence            99999999888899999999999965321  1235677888898987655555678999999999999999988777778


Q ss_pred             HHHHHHHHHhhhccCCCCCeEEEEeccccccCCCCCCCCchHHHHHHHHHHHhcCCcEEEecCccccceeecccCCC---
Q 017051          262 DQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQGEGDGMMAIMEPLLYAASVDLVLAGHVHAYERSIRVNNGK---  338 (378)
Q Consensus       262 ~Q~~WL~~~L~~~~~~~~~~~iv~~H~P~~~~~~~~~~~~~~~~~~l~~l~~~~~vdlvl~GH~H~y~r~~~~~~~~---  338 (378)
                      +|++||+++|+++++++++|+||++|+|+++....+.++...+++.|.++|++++||++|+||+|.|+|..|+++++   
T Consensus       260 ~Q~~WL~~~L~~~~~~~~~w~Iv~~H~P~~~~~~~~~~~~~~~r~~l~~ll~~~~VdlvlsGH~H~~~r~~p~~~~~~~~  339 (426)
T 1xzw_A          260 PQYKWFTSELEKVNRSETPWLIVLVHAPLYNSYEAHYMEGEAMRAIFEPYFVYYKVDIVFSGHVHSYERSERVSNVAYNI  339 (426)
T ss_dssp             HHHHHHHHHHHHCCTTTCCEEEEECSSCSSCCBSTTTTTTHHHHHHHHHHHHHTTCSEEEECSSSSEEEECSEECCCCCS
T ss_pred             HHHHHHHHHHHhhhhcCCCEEEEEeccCceeCCCcccCCCHHHHHHHHHHHHHhCCCEEEEcChhhheeeeeecCccccc
Confidence            99999999999987667899999999999987654445556689999999999999999999999999999988765   


Q ss_pred             --------cCCCccEEEEeCCCCCCCCccccc
Q 017051          339 --------PDPCGAVYITIGDGGNKEGLARKY  362 (378)
Q Consensus       339 --------~~~~g~~yiv~G~gG~~~~~~~~~  362 (378)
                              .+++|++||++|+||+.++....+
T Consensus       340 ~~g~~~~~~~~~g~~yi~~G~gG~~~~~~~~~  371 (426)
T 1xzw_A          340 VNAKCTPVSDESAPVYITIGDGGNSEGLASEM  371 (426)
T ss_dssp             TTCCCCCEECTTSCEEEEECCSCCTTCCCCCB
T ss_pred             cCCccccccCCCccEEEEeCCCcccccccccc
Confidence                    346899999999999987654333
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9 Back     alignment and structure
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>3e0j_A DNA polymerase subunit delta-2; DNA polymerase delta, P66 subunit, P50 subunit, human, DNA replication, DNA-directed DNA polymerase; HET: DNA; 3.00A {Homo sapiens} Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>3flo_A DNA polymerase alpha subunit B; protein-protein complex, phosphoesterase fold, OB fold, zinc motif, DNA replication, nucleus; HET: DNA; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 378
d2qfra2312 d.159.1.1 (A:121-432) Plant purple acid phosphatas 3e-57
d2qfra1112 b.1.12.1 (A:9-120) Purple acid phosphatase, N-term 1e-31
d1xzwa1119 b.1.12.1 (A:1-119) Purple acid phosphatase, N-term 6e-30
d1utea_302 d.159.1.1 (A:) Mammalian purple acid phosphatase { 2e-15
d2nxfa1320 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homo 2e-08
d1uf3a_228 d.159.1.6 (A:) Hypothetical protein TT1561 {Thermu 3e-06
d3d03a1271 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ 9e-05
d2hy1a1256 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide pho 1e-04
d2yvta1257 d.159.1.6 (A:4-260) Uncharacterized protein Aq_195 0.002
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 312 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Purple acid phosphatase-like
domain: Plant purple acid phosphatase, catalytic domain
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score =  187 bits (475), Expect = 3e-57
 Identities = 103/246 (41%), Positives = 133/246 (54%), Gaps = 19/246 (7%)

Query: 136 PITFAVAGDLGQTGWTKSTLDHIGQC--KYDVHLLPGDLSYAD----YMQHRWDTFGELV 189
           P TF + GDLGQ+  + +TL H      K    L  GDLSYAD    +   RWDT+G   
Sbjct: 7   PYTFGLIGDLGQSFDSNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRFT 66

Query: 190 QPLASARPWMVTQGNHEKESIPLI--MDAFQSYNARWKMPFEESGSNSNLYYSFDVAGAH 247
           +   + +PW+ T GNHE E  P I   + F+ ++ R+ +P+E S S S  +YS   A AH
Sbjct: 67  ERSVAYQPWIWTAGNHEIEFAPEINETEPFKPFSYRYHVPYEASQSTSPFWYSIKRASAH 126

Query: 248 LIMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPWLLVLLHVPWYNSNEAHQGEGDGMMAI 307
           +I+L SY+ Y   + QY WLK +L KV R +TPWL+VL+H P YNS   H  EG+ M   
Sbjct: 127 IIVLSSYSAYGRGTPQYTWLKKELRKVKRSETPWLIVLMHSPLYNSYNHHFMEGEAMRTK 186

Query: 308 MEPLLYAASVDLVLAGHVHAYERSIRVNNGK-----------PDPCGAVYITIGDGGNKE 356
            E       VD+V AGHVHAYERS RV+N              D    VYITIGD GN  
Sbjct: 187 FEAWFVKYKVDVVFAGHVHAYERSERVSNIAYKITNGLCTPVKDQSAPVYITIGDAGNYG 246

Query: 357 GLARKY 362
            +    
Sbjct: 247 VIDSNM 252
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 112 Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Length = 119 Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Length = 302 Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Length = 320 Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Length = 228 Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Length = 271 Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 256 Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Length = 257 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query378
d2qfra2312 Plant purple acid phosphatase, catalytic domain {K 100.0
d1utea_302 Mammalian purple acid phosphatase {Pig (Sus scrofa 99.97
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 99.92
d2nxfa1320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 99.89
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 99.89
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 99.88
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 99.87
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 99.78
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 99.76
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 99.44
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 99.44
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 99.41
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 99.37
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 99.32
d1ii7a_333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.29
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 98.99
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 98.74
d1usha2337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 98.62
d3c9fa2322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 98.5
d2z1aa2302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 98.04
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 97.89
d1x5xa196 Fibronectin type-III domain containing protein 3a, 97.83
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.77
d1x4xa193 Fibronectin type-III domain containing protein 3a, 97.76
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 97.76
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 97.74
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.71
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 97.61
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 97.6
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 97.6
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 97.59
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 97.59
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 97.59
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 97.57
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 97.54
d1va9a1109 Down syndrome cell adhesion molecule-like protein 97.54
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 97.52
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 97.48
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 97.48
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 97.47
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 97.47
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 97.45
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 97.44
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 97.43
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 97.43
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 97.42
d2z06a1252 Hypothetical protein TTHA0625 {Thermus thermophilu 97.41
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 97.4
d1t70a_255 Putative phosphatase DR1281 {Deinococcus radiodura 97.4
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 97.39
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 97.39
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 97.39
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 97.39
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 97.38
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 97.37
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 97.33
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 97.33
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.3
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.27
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 97.27
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 97.26
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 97.24
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 97.22
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 97.21
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.21
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 97.2
d1t71a_281 Hypothetical protein MPN349 {Mycoplasma pneumoniae 97.2
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 97.19
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 97.16
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 97.13
d2crza197 Fibronectin type-III domain containing protein 3a, 97.12
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 97.11
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 97.06
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 97.03
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 96.98
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 96.96
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 96.95
d1x3da1105 Fibronectin type-III domain containing protein 3a, 96.92
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 96.9
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 96.87
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 96.82
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 96.82
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 96.76
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 96.75
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 96.74
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 96.69
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 96.59
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 96.54
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 96.43
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 96.39
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 96.37
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 96.31
d2crma1107 Fibronectin type-III domain containing protein 3a, 96.3
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 96.28
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 96.26
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 96.24
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 96.06
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 95.89
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 95.82
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 95.77
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 94.91
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 94.59
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 94.25
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha iso 93.95
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 93.54
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human 93.4
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 93.26
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 92.84
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 92.81
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 92.02
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 89.97
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 87.76
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 85.18
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Purple acid phosphatase-like
domain: Plant purple acid phosphatase, catalytic domain
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=1e-46  Score=348.75  Aligned_cols=234  Identities=44%  Similarity=0.728  Sum_probs=196.7

Q ss_pred             CCCCCCCeEEEEEcccCCCCChHHHHHHh--hcCCCcEEEeccccccccch----hhhHHHHHHhhHhhhhCCceeecCC
Q 017051          130 TPPAQFPITFAVAGDLGQTGWTKSTLDHI--GQCKYDVHLLPGDLSYADYM----QHRWDTFGELVQPLASARPWMVTQG  203 (378)
Q Consensus       130 t~p~~~~~~f~~~gD~~~~~~~~~~~~~i--~~~~~d~vi~~GDl~~~~~~----~~~~~~~~~~~~~l~~~~P~~~v~G  203 (378)
                      |.| +.|+||+++||+|........+..+  ...+|||||++||++|+++.    ..+|+.|++.++++...+|+++++|
T Consensus         2 ~g~-~~p~~F~v~GD~g~~~~~~~~~~~~~~~~~~pdfvl~~GDl~Y~~~~~~~~~~~wd~~~~~~~~~~~~~P~~~~~G   80 (312)
T d2qfra2           2 TGL-DVPYTFGLIGDLGQSFDSNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRFTERSVAYQPWIWTAG   80 (312)
T ss_dssp             CCS-SCCEEEEEECSCCSBHHHHHHHHHHHHCSSCCSEEEECSCCCCGGGSGGGCTHHHHHHHHHHHHHHTTSCEEECCC
T ss_pred             CCC-CCCEEEEEEeeCCCCCchHHHHHHHHHcCCCCCEEEECCCCCcCCCCcccchHHHHHHHHHHHHHhhcceEEEecc
Confidence            445 5789999999998776655666553  46789999999999986543    5689999999999998899999999


Q ss_pred             CCccCCCCc--ccchhhhchhcccCCCCCCCCCCCceEEEEeCCEEEEEEcCcCCCCCcHHHHHHHHHHhhhccCCCCCe
Q 017051          204 NHEKESIPL--IMDAFQSYNARWKMPFEESGSNSNLYYSFDVAGAHLIMLGSYADYDEYSDQYRWLKDDLSKVDRKKTPW  281 (378)
Q Consensus       204 NHD~~~~~~--~~~~~~~~~~~~~~p~~~~~~~~~~~ysf~~g~v~fi~ldt~~~~~~~~~Q~~WL~~~L~~~~~~~~~~  281 (378)
                      |||+...+.  ....+..|..+|.+|.+......+.||+|++|+++||+||++..+..+.+|++||+++|+++++++++|
T Consensus        81 NHD~~~~~~~~~~~~~~~~~~~f~~P~~~~~~~~~~~Ysf~~g~v~fi~Lds~~~~~~~~~Q~~WL~~~L~~~~~~~~~w  160 (312)
T d2qfra2          81 NHEIEFAPEINETEPFKPFSYRYHVPYEASQSTSPFWYSIKRASAHIIVLSSYSAYGRGTPQYTWLKKELRKVKRSETPW  160 (312)
T ss_dssp             GGGTCCBGGGTBCSTTHHHHHHCCCCGGGGTCSSTTSEEEEETTEEEEECCTTSCCSTTSHHHHHHHHHHHTCCTTTCCE
T ss_pred             cccccccccccccccccchhhhccCCccccCCCCCceEEEEECCEEEEEeeccccccchHHHHHHHHHHHHHHhhcCCCE
Confidence            999853322  124677888899999876666678899999999999999999888888899999999999988778899


Q ss_pred             EEEEeccccccCCCCCCCCchHHHHHHHHHHHhcCCcEEEecCccccceeecccCCC-----------cCCCccEEEEeC
Q 017051          282 LLVLLHVPWYNSNEAHQGEGDGMMAIMEPLLYAASVDLVLAGHVHAYERSIRVNNGK-----------PDPCGAVYITIG  350 (378)
Q Consensus       282 ~iv~~H~P~~~~~~~~~~~~~~~~~~l~~l~~~~~vdlvl~GH~H~y~r~~~~~~~~-----------~~~~g~~yiv~G  350 (378)
                      +||++|+|+|++..........+++.|+++|++++||++|+||+|.|+|++|+++++           .+++|++||++|
T Consensus       161 ~iv~~H~P~y~~~~~~~~~~~~~r~~l~~l~~~~~Vdlv~~GH~H~YeRt~p~~~~~~~~~~~~~~~~~~~~g~vyiv~G  240 (312)
T d2qfra2         161 LIVLMHSPLYNSYNHHFMEGEAMRTKFEAWFVKYKVDVVFAGHVHAYERSERVSNIAYKITNGLCTPVKDQSAPVYITIG  240 (312)
T ss_dssp             EEEECSSCSSCCBSTTTTTTHHHHHHHHHHHHHTTCSEEEECSSSSEEEECSEECCCCCSSSCCCSCEECTTSCEEEEEC
T ss_pred             EEEEccccccccCCCCcccchhHHHHHHHHHHHcCcEEEEEccCcceEEEeeccCCcccccCCccccccCCCcCEEEEEC
Confidence            999999999998766555666789999999999999999999999999999998765           246799999999


Q ss_pred             CCCCCCCccccccc
Q 017051          351 DGGNKEGLARKYVL  364 (378)
Q Consensus       351 ~gG~~~~~~~~~~~  364 (378)
                      +||+.++....+.+
T Consensus       241 ~gG~~~~~~~~~~~  254 (312)
T d2qfra2         241 DAGNYGVIDSNMIQ  254 (312)
T ss_dssp             CSCTTSCCCCCBCS
T ss_pred             cCCCcccccccccC
Confidence            99987666555543
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z06a1 d.159.1.10 (A:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t70a_ d.159.1.9 (A:) Putative phosphatase DR1281 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure