Citrus Sinensis ID: 017070


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MAHSAVSQVAVAVPVGTDSTLRSAPLFKTQNLRLGEKSWAPVLSLDLKSRNPRLRNRYVVCMSVQQASKSKVAVSPLELEERSQPPLNLYKPKEPYTATIVSVERVVGAKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGNPHNVRLYSIASTRYGDSFDGKTASLCVRRAVYYDPESGKEDPSKSGICSNFLCNSKPGDKVLITGPSGKIMLLPEDNPNATHIMIATGTGIAPFRGYLRRMFMESVPTYKFGGLAWLFLGVANPDSLLYDDEFTKYLQDYPDNFRYDKALSREQKNKKGGKMYVQDKIEEYSDEIFKRLDGGAHIYFCGLKGMMPGIQETLKRVAEQRGESWDQKLSQLKKNKQWHVEVY
ccccccccEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccCCccccccccccccccccCCcccccccHHHHHHHHHHHcccccccHHHHHHHcccccccccccccccccccccccccccccccccEEEcccccccccccccEEEEEEEEEEECcccccccccccEEEccccccccccccEEEEEEEcccccccccccccccEEEEEcccccHHHHHHHHHHHccccccccccccEEEEEccccccccccHHHHHHHHHHccccEEEEEEEcccccccccccccHHHHHHHcHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHcccEEEEcc
******S***VAVPVG****LRSAPLFKTQNLRLGEKSWAPVLSLDLKSRNPRLRNRYVVCMS****************EERSQPPLNLYKPKEPYTATIVSVERVVGAKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGNPHNVRLYSIASTRYGDSFDGKTASLCVRRAVYYDPESGKEDPSKSGICSNFLCNSKPGDKVLITGPSGKIMLLPEDNPNATHIMIATGTGIAPFRGYLRRMFMESVPTYKFGGLAWLFLGVANPDSLLYDDEFTKYLQDYPDNFRYDKALSREQKNKKGGKMYVQDKIEEYSDEIFKRLDGGAHIYFCGLKGMMPGIQETLKRVAEQRGESWDQKLSQLKKNKQWHVEVY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAHSAVSQVAVAVPVGTDSTLRSAPLFKTQNLRLGEKSWAPVLSLDLKSRNPRLRNRYVVCMSVQQASKSKVAVSPLELEERSQPPLNLYKPKEPYTATIVSVERVVGAKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGNPHNVRLYSIASTRYGDSFDGKTASLCVRRAVYYDPESGKEDPSKSGICSNFLCNSKPGDKVLITGPSGKIMLLPEDNPNATHIMIATGTGIAPFRGYLRRMFMESVPTYKFGGLAWLFLGVANPDSLLYDDEFTKYLQDYPDNFRYDKALSREQKNKKGGKMYVQDKIEEYSDEIFKRLDGGAHIYFCGLKGMMPGIQETLKRVAEQRGESWDQKLSQLKKNKQWHVEVY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ferredoxin--NADP reductase, root isozyme 1, chloroplastic Maintains the supply of reduced ferredoxin under non-photosynthetic conditions.confidentQ9M0V6
Ferredoxin--NADP reductase, root isozyme, chloroplastic May play a key role in regulating the relative amounts of cyclic and non-cyclic electron flow to meet the demands of the plant for ATP and reducing power. Is involved in nitrate assimilation.confidentP41345
Ferredoxin--NADP reductase, root-type isozyme, chloroplastic May play a key role in regulating the relative amounts of cyclic and non-cyclic electron flow to meet the demands of the plant for ATP and reducing power. Is involved in nitrate assimilation.probableO04397

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.18.-.-Acting on iron-sulfur proteins as donors.probable
1.18.1.-With NAD(+) or NADP(+) as acceptor.probable
1.18.1.2Transferred entry: 1.18.1.2.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LO8, chain A
Confidence level:very confident
Coverage over the Query: 78-378
View the alignment between query and template
View the model in PyMOL
Template: 1KRH, chain A
Confidence level:very confident
Coverage over the Query: 40-178,192-353
View the alignment between query and template
View the model in PyMOL