Citrus Sinensis ID: 017084


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------
MKLQKLSVAFKILSFNLIIIILLQVESLTPANNDYAFFDINSLGSSTTAATTPALKPDGGSVKNRSSTSRKPYSSCEVWSRACSKEVMELARRPETVDWLKSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRAWVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSREHLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAGCGFFHAVISGKKGGAANPHRSVDPVLAASAAVISLQGLVSREANPLDSQVVSVTYFNGGDHLDMIPDAVVIGGTLRAFSNTSFYQLLQRIEEVLFFFFFLNEPIRKFIRIY
ccccccHHHHHHHHHHHHHHHHHcccccccccccccCEECccccccccccccccccccccccccccccccccccccHcccHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccEEEccccccEEEEEEccccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccccHHHHHHccccccccEEEEEccccccccEEEEEccccccccccEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHccccccccccEEEEEEEECccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEc
*****LSVAFKILSFNLIIIILLQVESLTPANNDYAFFDINSLGS*********************************WSRACSKEVMELARRPETVDWLKSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRAWVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSREHLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAGCGFFHAVISGKKGGAANPHRSVDPVLAASAAVISLQGLVSREANPLDSQVVSVTYFNGGDHLDMIPDAVVIGGTLRAFSNTSFYQLLQRIEEVLFFFFFLNEPIRKFIRIY
xxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLQKLSVAFKILSFNLIIIILLQVESLTPANNDYAFFDINSLGSSTTAATTPALKPDGGSVKNRSSTSRKPYSSCEVWSRACSKEVMELARRPETVDWLKSVRRTIHQNPELAFQEFETSRLLRAELDRMEIGYKYPLAKTGIRAWVGTGGPPFVALRADMDALPIQEAVEWEYKSKVAGKMHACGHDAHVAMLIGAAKILKSREHLLKGTVILIFQPAEEAGNGAKRMMADGALEDVEAIFAVHVSHEHPTGVIGSRPGPLLAGCGFFHAVISGKKGGAANPHRSVDPVLAASAAVISLQGLVSREANPLDSQVVSVTYFNGGDHLDMIPDAVVIGGTLRAFSNTSFYQLLQRIEEVLFFFFFLNEPIRKFIRIY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
IAA-amino acid hydrolase ILR1-like 6 Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).probableQ8VYX0
IAA-amino acid hydrolase ILR1-like 2 Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).probableQ5N8F2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XMB, chain A
Confidence level:very confident
Coverage over the Query: 86-365
View the alignment between query and template
View the model in PyMOL