Citrus Sinensis ID: 017103

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------
MLAIAGGQSSLADYCTYFVAYSDGSCTDTNSARAPDRMLGEVRGSNSRCMASSLVRTGFVRGSMTQGNGCYQHRCVNNSLEVAVDGIWKVCPEAGGPVQFPGFNGELICPAYHELCSTGPIAVFGQCPNSCTFNGDCVDGKCHCFLGFHGHDCSKRSCPDNCNGHGKCLSNGACECENGYTGIDCSTAVCDEQCSLHGGVCDNGVCEFRCSDYAGYTCQNSSKLISSLSVCKYVLEKDAGGQHCAPSESSILQQLEEVVVTPNYHRLFPGGARKLFNIFGTSYCDEAAKRLACWISIQKCDKDGDNRLRVCHSACQSYNLACGASLDCSDQTLFSSKEEGEGQCTGSSDIRLSWLDRLRGGLYLKNSSSKGMFVKSS
cccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccEEEccccEEEccccccccccccccccEEEcccccccccccccccccccccccccccEEEccEEEcccccccccccccccccccccccEEccccEEEccccccccccccccccccccccccEEEccccEEEEcccccccccccccccccccccccccccccccEEEccccccccccccccEEccccccccccccccccccccEEEEcccccccccccccccccccccccccEEccccccccEEEcccccccccccccccccccccccccccccccccEEEEcEEEEEcccccccEEEcc
cEEEcccccccccEEEEccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccccccccccEEEccEEEccccccccccccccccccccccEEcccEEEEccccccccccccccccccccccEEccccEEEEcccccccccccccccccccccccEEcccEEEEEcccccccccccccEEcccEEEEcccccccccccccccccccccccccccEcccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccEcccccccccccccccccccccccccccHHHHcEEEEEEEccccccEEEEcc
mlaiaggqsslaDYCTYFVAysdgsctdtnsarapdrmlgevrgsnsrcmASSLVRtgfvrgsmtqgngcyqhrcvnnslevAVDGIwkvcpeaggpvqfpgfngelicpayhelcstgpiavfgqcpnsctfngdcvdgkchcflgfhghdcskrscpdncnghgkclsngacecengytgidcstavcdeqcslhggvcdngvcefrcsdyagytcqnsskLISSLSVCKYVlekdaggqhcapsessILQQLEEvvvtpnyhrlfpggaRKLFNIFGTSYCDEAAKRLACWISIQkcdkdgdnrlRVCHSACQsynlacgasldcsdqtlfsskeegegqctgssdirLSWLDRLrgglylknssskgmfvkss
mlaiaggqsslADYCTYFVAYSDGSCTDTNSARAPDRMLgevrgsnsrcmASSLVRTGFVRGSMTQGNGCYQHRCVNNSLEVAVDGIWKVCPEAGGPVQFPGFNGELICPAYHELCSTGPIAVFGQCPNSCTFNGDCVDGKCHCFLGFHGHDCSKRSCPDNCNGHGKCLSNGACECENGYTGIDCSTAVCDEQCSLHGGVCDNGVCEFRCSDYAGYTCQNSSKLISSLSVCKYVLEKDAGGQHCAPSESSILQQLEEVVVTPNYHRLFPGGARKLFNIFGTSYCDEAAKRLACWISIQKCDKDGDNRLRVCHSACQSYNLACGASLDCSDQTLFSskeegegqctgssdirlSWLDRLRGglylknssskgmfvkss
MLAIAGGQSSLADYCTYFVAYSDGSCTDTNSARAPDRMLGEVRGSNSRCMASSLVRTGFVRGSMTQGNGCYQHRCVNNSLEVAVDGIWKVCPEAGGPVQFPGFNGELICPAYHELCSTGPIAVFGQCPNSCTFNGDCVDGKCHCFLGFHGHDCSKRSCPDNCNGHGKCLSNGACECENGYTGIDCSTAVCDEQCSLHGGVCDNGVCEFRCSDYAGYTCQNSSKLISSLSVCKYVLEKDAGGQHCAPSESSILQQLEEVVVTPNYHRLFPGGARKLFNIFGTSYCDEAAKRLACWISIQKCDKDGDNRLRVCHSACQSYNLACGASLDCSDQTLFSSKEEGEGQCTGSSDIRLSWLDRLRGGLYLKNSSSKGMFVKSS
*********SLADYCTYFVAYSDGSC***********************MASSLVRTGFVRGSMTQGNGCYQHRCVNNSLEVAVDGIWKVCPEAGGPVQFPGFNGELICPAYHELCSTGPIAVFGQCPNSCTFNGDCVDGKCHCFLGFHGHDCSKRSCPDNCNGHGKCLSNGACECENGYTGIDCSTAVCDEQCSLHGGVCDNGVCEFRCSDYAGYTCQNSSKLISSLSVCKYVLEKDAGGQHCAPSESSILQQLEEVVVTPNYHRLFPGGARKLFNIFGTSYCDEAAKRLACWISIQKCDKDGDNRLRVCHSACQSYNLACGASLDCSDQTLF**************DIRLSWLDRLRGGLYL*************
MLAI*GGQSSLADYCTYFVAYSDGSCTDTNSARAPDRMLGEVRGSNSRCMASSLVRTGFVRGSMTQGNGCYQHRCVNNSLEVAVDGIWKVCPEAGGPVQFPGFNGELICPAYHELCSTGPIAVFGQCPNSCTFNGDCVDGKCHCFLGFHGHDCSKRSCPDNCNGHGKCLSNGACECENGYTGIDCSTAVCDEQCSLHGGVCDNGVCEFRCSDYAGYTCQNSSKLISSLSVCKYVLEKDAGGQHCAPSESSILQQLEEVVVTPNYHRLFPGGARKLFNIFGTSYCDEAAKRLACWISIQKCDKDGDNRLRVCHSACQSYNLACGASLDCSDQTLF*********CTGSSDIRLSWLDRLRGGLYLKNSSS*GMFV***
********SSLADYCTYFVAYSDGSCTDTNSARAPDRMLGEVRGSNSRCMASSLVRTGFVRGSMTQGNGCYQHRCVNNSLEVAVDGIWKVCPEAGGPVQFPGFNGELICPAYHELCSTGPIAVFGQCPNSCTFNGDCVDGKCHCFLGFHGHDCSKRSCPDNCNGHGKCLSNGACECENGYTGIDCSTAVCDEQCSLHGGVCDNGVCEFRCSDYAGYTCQNSSKLISSLSVCKYVLEKD*********ESSILQQLEEVVVTPNYHRLFPGGARKLFNIFGTSYCDEAAKRLACWISIQKCDKDGDNRLRVCHSACQSYNLACGASLDCSDQTLFS************SDIRLSWLDRLRGGLYLKNSSSKGMFVKSS
MLAIAGGQSSLADYCTYFVAYSDGSCTDTNSARAPDRMLGEVRGSNSRCMASSLVRTGFVRGSMTQGNGCYQHRCVNNSLEVAVDGIWKVCPEAGGPVQFPGFNGELICPAYHELCSTGPIAVFGQCPNSCTFNGDCVDGKCHCFLGFHGHDCSKRSCPDNCNGHGKCLSNGACECENGYTGIDCSTAVCDEQCSLHGGVCDNGVCEFRCSDYAGYTCQNSSKLISSLSVCKYVLEKDAGGQHCAPSESSILQQLEEVVVTPNYHRLFPGGARKLFNIFGTSYCDEAAKRLACWISIQKCDKDGDNRLRVCHSACQSYNLACGASLDCSDQTLFSSKEEGEGQCTGSSDIRLSWLDRLRGGLYLKNSS*K*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAIAGGQSSLADYCTYFVAYSDGSCTDTNSARAPDRMLGEVRGSNSRCMASSLVRTGFVRGSMTQGNGCYQHRCVNNSLEVAVDGIWKVCPEAGGPVQFPGFNGELICPAYHELCSTGPIAVFGQCPNSCTFNGDCVDGKCHCFLGFHGHDCSKRSCPDNCNGHGKCLSNGACECENGYTGIDCSTAVCDEQCSLHGGVCDNGVCEFRCSDYAGYTCQNSSKLISSLSVCKYVLEKDAGGQHCAPSESSILQQLEEVVVTPNYHRLFPGGARKLFNIFGTSYCDEAAKRLACWISIQKCDKDGDNRLRVCHSACQSYNLACGASLDCSDQTLFSSKEEGEGQCTGSSDIRLSWLDRLRGGLYLKNSSSKGMFVKSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query377 2.2.26 [Sep-21-2011]
Q9UQP3 1299 Tenascin-N OS=Homo sapien yes no 0.254 0.073 0.408 5e-17
Q80Z71 1560 Tenascin-N OS=Mus musculu yes no 0.259 0.062 0.388 2e-15
P24821 2201 Tenascin OS=Homo sapiens no no 0.246 0.042 0.484 2e-15
Q29116 1746 Tenascin OS=Sus scrofa GN no no 0.233 0.050 0.452 1e-14
Q80YX1 2110 Tenascin OS=Mus musculus no no 0.257 0.045 0.445 2e-14
P22105 4289 Tenascin-X OS=Homo sapien no no 0.209 0.018 0.481 6e-13
P10039 1808 Tenascin OS=Gallus gallus yes no 0.156 0.032 0.583 8e-13
Q6N022 2769 Teneurin-4 OS=Homo sapien no no 0.230 0.031 0.434 4e-12
Q3UHK6 2771 Teneurin-4 OS=Mus musculu no no 0.230 0.031 0.434 6e-12
Q9W7R3 2824 Teneurin-4 OS=Danio rerio no no 0.230 0.030 0.456 6e-12
>sp|Q9UQP3|TENN_HUMAN Tenascin-N OS=Homo sapiens GN=TNN PE=1 SV=2 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 40/98 (40%), Positives = 53/98 (54%), Gaps = 2/98 (2%)

Query: 109 CPAYHELCSTGPIAVFGQCPNSCTFNGDCVDGKCHCFLGFHGHDCSKRSCPDNCNGHGKC 168
           C  + E    GP      CP +C+ +G CVDG+C C   + G DC   +CP+NC+GHG+C
Sbjct: 153 CSCHCEEGREGPACERLACPGACSGHGRCVDGRCLCHEPYVGADCGYPACPENCSGHGEC 212

Query: 169 LSNGACECENGYTGIDCSTAVCDEQCSLHGGVCDNGVC 206
           +  G C+C   +   DCS   C   CS H G CD G C
Sbjct: 213 V-RGVCQCHEDFMSEDCSEKRCPGDCSGH-GFCDTGEC 248
Involved in neurite outgrowth and cell migration in hippocampal explants.
Homo sapiens (taxid: 9606)
>sp|Q80Z71|TENN_MOUSE Tenascin-N OS=Mus musculus GN=Tnn PE=1 SV=2 Back     alignment and function description
>sp|P24821|TENA_HUMAN Tenascin OS=Homo sapiens GN=TNC PE=1 SV=3 Back     alignment and function description
>sp|Q29116|TENA_PIG Tenascin OS=Sus scrofa GN=TNC PE=1 SV=1 Back     alignment and function description
>sp|Q80YX1|TENA_MOUSE Tenascin OS=Mus musculus GN=Tnc PE=1 SV=1 Back     alignment and function description
>sp|P22105|TENX_HUMAN Tenascin-X OS=Homo sapiens GN=TNXB PE=1 SV=3 Back     alignment and function description
>sp|P10039|TENA_CHICK Tenascin OS=Gallus gallus GN=TNC PE=1 SV=2 Back     alignment and function description
>sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=TENM4 PE=1 SV=2 Back     alignment and function description
>sp|Q3UHK6|TEN4_MOUSE Teneurin-4 OS=Mus musculus GN=Tenm4 PE=1 SV=2 Back     alignment and function description
>sp|Q9W7R3|TEN4_DANRE Teneurin-4 OS=Danio rerio GN=tenm4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query377
449496051 853 PREDICTED: uncharacterized LOC101217702 0.981 0.433 0.867 0.0
356518058 1060 PREDICTED: uncharacterized protein LOC10 0.989 0.351 0.871 0.0
356510268 859 PREDICTED: uncharacterized protein LOC10 0.989 0.434 0.860 0.0
255538552 844 metalloendopeptidase, putative [Ricinus 0.981 0.438 0.864 0.0
356562327 861 PREDICTED: uncharacterized protein LOC10 0.989 0.433 0.833 0.0
147812058 874 hypothetical protein VITISV_007441 [Viti 0.970 0.418 0.852 0.0
356553895 856 PREDICTED: leishmanolysin homolog [Glyci 0.989 0.435 0.836 0.0
225458382 857 PREDICTED: leishmanolysin-like peptidase 0.970 0.427 0.852 0.0
449470154 841 PREDICTED: uncharacterized protein LOC10 0.949 0.425 0.831 0.0
334188145 889 metalloendopeptidase / zinc ion binding 0.954 0.404 0.833 0.0
>gi|449496051|ref|XP_004160023.1| PREDICTED: uncharacterized LOC101217702 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/371 (86%), Positives = 348/371 (93%), Gaps = 1/371 (0%)

Query: 6   GGQSSLADYCTYFVAYSDGSCTDTNSARAPDRMLGEVRGSNSRCMASSLVRTGFVRGSMT 65
           GGQSSLADYCTYFVAYSDGSCTDTNSARAPDRMLGEVRGSNSRCMASSLVRTGFVRGSMT
Sbjct: 483 GGQSSLADYCTYFVAYSDGSCTDTNSARAPDRMLGEVRGSNSRCMASSLVRTGFVRGSMT 542

Query: 66  QGNGCYQHRCVNNSLEVAVDGIWKVCPEAGGPVQFPGFNGELICPAYHELCSTGPIAVFG 125
           QGNGCYQHRC+NNSLEVAVDG+WKVCPEAGGPVQFPGFNGEL+CPAYHELCS   ++V G
Sbjct: 543 QGNGCYQHRCINNSLEVAVDGMWKVCPEAGGPVQFPGFNGELVCPAYHELCSKDSVSVPG 602

Query: 126 QCPNSCTFNGDCVDGKCHCFLGFHGHDCSKRSCPDNCNGHGKCLSNGACECENGYTGIDC 185
           +CPN+C FNGDCVDGKC CFLGFHGHDCSKRSCP+NC+ HG+CLSNG CEC NGYTGIDC
Sbjct: 603 KCPNTCNFNGDCVDGKCFCFLGFHGHDCSKRSCPNNCSDHGRCLSNGLCECGNGYTGIDC 662

Query: 186 STAVCDEQCSLHGGVCDNGVCEFRCSDYAGYTCQNSSKLISSLSVCKYVLEKDAGGQHCA 245
           STA+CDEQCSLHGGVCDNG+CEFRCSDYAGY+CQNSS+LISSLSVCK V+++D  GQHCA
Sbjct: 663 STAICDEQCSLHGGVCDNGICEFRCSDYAGYSCQNSSRLISSLSVCKNVMQRDMTGQHCA 722

Query: 246 PSESSILQQLEEVVVTPNYHRLFPGGARKLFNIFGTSYCDEAAKRLACWISIQKCDKDGD 305
           PSE SILQQLEEVVV PNYHRLFPGGARKLFNIFG SYCD AAK+LACWISIQKCD+DGD
Sbjct: 723 PSEPSILQQLEEVVVMPNYHRLFPGGARKLFNIFGGSYCDAAAKQLACWISIQKCDQDGD 782

Query: 306 NRLRVCHSACQSYNLACGASLDCSDQTLFSSKEEGEGQCTGSSDIRLSWLDRLRGGLYLK 365
           NRLRVCHSACQSYNLACGASLDCSDQTLFSS+EEGEGQCTGS +I+LSW +RLR  L++ 
Sbjct: 783 NRLRVCHSACQSYNLACGASLDCSDQTLFSSEEEGEGQCTGSGEIKLSWFNRLRSNLFVS 842

Query: 366 NSSSK-GMFVK 375
           NS+SK G FVK
Sbjct: 843 NSTSKGGRFVK 853

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356518058|ref|XP_003527701.1| PREDICTED: uncharacterized protein LOC100775874 [Glycine max] Back     alignment and taxonomy information
>gi|356510268|ref|XP_003523861.1| PREDICTED: uncharacterized protein LOC100788818 [Glycine max] Back     alignment and taxonomy information
>gi|255538552|ref|XP_002510341.1| metalloendopeptidase, putative [Ricinus communis] gi|223551042|gb|EEF52528.1| metalloendopeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356562327|ref|XP_003549423.1| PREDICTED: uncharacterized protein LOC100808350 [Glycine max] Back     alignment and taxonomy information
>gi|147812058|emb|CAN70297.1| hypothetical protein VITISV_007441 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356553895|ref|XP_003545286.1| PREDICTED: leishmanolysin homolog [Glycine max] Back     alignment and taxonomy information
>gi|225458382|ref|XP_002281815.1| PREDICTED: leishmanolysin-like peptidase [Vitis vinifera] gi|302142440|emb|CBI19643.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449470154|ref|XP_004152783.1| PREDICTED: uncharacterized protein LOC101217702 [Cucumis sativus] Back     alignment and taxonomy information
>gi|334188145|ref|NP_001190451.1| metalloendopeptidase / zinc ion binding protein [Arabidopsis thaliana] gi|332007454|gb|AED94837.1| metalloendopeptidase / zinc ion binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query377
UNIPROTKB|P24821 2201 TNC "Tenascin" [Homo sapiens ( 0.453 0.077 0.371 3.2e-23
ZFIN|ZDB-GENE-980526-104 1811 tnc "tenascin C" [Danio rerio 0.387 0.080 0.381 1.5e-21
UNIPROTKB|Q29116 1746 TNC "Tenascin" [Sus scrofa (ta 0.490 0.105 0.341 3.7e-21
MGI|MGI:101922 2110 Tnc "tenascin C" [Mus musculus 0.493 0.088 0.328 4e-20
UNIPROTKB|F1N8F4 1808 TNC "Tenascin" [Gallus gallus 0.519 0.108 0.333 4.5e-20
UNIPROTKB|F1MRZ6 2231 TNC "Uncharacterized protein" 0.490 0.082 0.346 5.8e-20
UNIPROTKB|P22105 4289 TNXB "Tenascin-X" [Homo sapien 0.689 0.060 0.294 2.6e-18
UNIPROTKB|P10039 1808 TNC "Tenascin" [Gallus gallus 0.681 0.142 0.294 5.2e-18
UNIPROTKB|F1MPK6 4059 TNXB "Uncharacterized protein" 0.496 0.046 0.344 6.1e-17
UNIPROTKB|F1S708 1280 TNN "Uncharacterized protein" 0.297 0.087 0.368 3.1e-17
UNIPROTKB|P24821 TNC "Tenascin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 284 (105.0 bits), Expect = 3.2e-23, P = 3.2e-23
 Identities = 72/194 (37%), Positives = 97/194 (50%)

Query:    70 CYQH-RCVNNSLEVAVDGIWKV-CPEAGGPVQFPGF----NGELICPAYHELCSTGPIAV 123
             C+   RCV+   E   DG     C E   P    G     NG+ +C   +    TG    
Sbjct:   381 CHNRGRCVDGRCECD-DGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGY----TGEDCS 435

Query:   124 FGQCPNSCTFNGDCVDGKCHCFLGFHGHDCSKRSCPDNCNGHGKCLSNGACECENGYTGI 183
               +CPN C   G CV+GKC C  GF G+DCS  SCP++C+ HG+C+ NG C C++GYTG 
Sbjct:   436 QLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCV-NGMCVCDDGYTGE 494

Query:   184 DCSTAVCDEQCSLHGGVCDNG--VCE--FRCSDYAGYTCQNS----SKLISSLSVC-KYV 234
             DC    C   CS + G+C +G  VCE  F   D A  +C N      + ++   VC +  
Sbjct:   495 DCRDRQCPRDCS-NRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGF 553

Query:   235 LEKDAGGQHCAPSE 248
             + KD   Q C PS+
Sbjct:   554 MGKDCKEQRC-PSD 566
GO:0007155 "cell adhesion" evidence=IEA
GO:0005604 "basement membrane" evidence=IEA
GO:0005614 "interstitial matrix" evidence=IEA
GO:0007528 "neuromuscular junction development" evidence=IEA
GO:0008284 "positive regulation of cell proliferation" evidence=IEA
GO:0010628 "positive regulation of gene expression" evidence=IEA
GO:0014012 "peripheral nervous system axon regeneration" evidence=IEA
GO:0060739 "mesenchymal-epithelial cell signaling involved in prostate gland development" evidence=IEA
GO:0060740 "prostate gland epithelium morphogenesis" evidence=IEA
GO:0045545 "syndecan binding" evidence=IPI
GO:0005576 "extracellular region" evidence=TAS
GO:0009611 "response to wounding" evidence=IEP
GO:0005615 "extracellular space" evidence=IDA
GO:0031012 "extracellular matrix" evidence=ISS;IDA
ZFIN|ZDB-GENE-980526-104 tnc "tenascin C" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q29116 TNC "Tenascin" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:101922 Tnc "tenascin C" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8F4 TNC "Tenascin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MRZ6 TNC "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P22105 TNXB "Tenascin-X" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P10039 TNC "Tenascin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPK6 TNXB "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S708 TNN "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query377
pfam01457521 pfam01457, Peptidase_M8, Leishmanolysin 1e-09
PTZ00337567 PTZ00337, PTZ00337, surface protease GP63; Provisi 1e-08
>gnl|CDD|201806 pfam01457, Peptidase_M8, Leishmanolysin Back     alignment and domain information 
 Score = 59.4 bits (144), Expect = 1e-09
 Identities = 31/121 (25%), Positives = 45/121 (37%), Gaps = 11/121 (9%)

Query: 6   GGQSSLADYCTYFVAYSDGSCTDTNSARAPDRMLGEVRGSNSRCMASSLVRTGFVRGSMT 65
           GG S   DYC + V +S+GSCT   S  +P      V    SRC+  +            
Sbjct: 399 GGSSEFLDYCPFIVGFSNGSCTQDASTASPGLKAFNVFSDASRCIDGTFTPKKCGGIVSH 458

Query: 66  QGNGCYQHRCVNN----SLEVAVDGIWKVCPEAGGPVQFPGFN------GELICPAYHEL 115
               C   +C       S++V     +  C   G  V+    +      G + CP Y E+
Sbjct: 459 YAALCANVKCDTATRTYSVQVYGSSGYYPCT-PGLRVELSTVSDAFERGGYITCPPYVEV 517

Query: 116 C 116
           C
Sbjct: 518 C 518

Length = 521
>gnl|CDD|185563 PTZ00337, PTZ00337, surface protease GP63; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 377
KOG1225525 consensus Teneurin-1 and related extracellular mat 99.52
KOG1225525 consensus Teneurin-1 and related extracellular mat 99.43
PTZ00337567 surface protease GP63; Provisional 99.23
PTZ00257622 Glycoprotein GP63 (leishmanolysin); Provisional 99.13
PF01457521 Peptidase_M8: Leishmanolysin This Prosite motif co 99.03
KOG1219 4289 consensus Uncharacterized conserved protein, conta 98.98
KOG1226783 consensus Integrin beta subunit (N-terminal portio 98.98
KOG1219 4289 consensus Uncharacterized conserved protein, conta 98.82
KOG2556666 consensus Leishmanolysin-like peptidase (Peptidase 98.76
KOG4289 2531 consensus Cadherin EGF LAG seven-pass G-type recep 98.67
KOG1226783 consensus Integrin beta subunit (N-terminal portio 98.65
KOG4289 2531 consensus Cadherin EGF LAG seven-pass G-type recep 98.59
KOG1217487 consensus Fibrillins and related proteins containi 98.22
KOG1217487 consensus Fibrillins and related proteins containi 97.85
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 97.36
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.11
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 96.94
KOG1214 1289 consensus Nidogen and related basement membrane pr 96.86
smart0005163 DSL delta serrate ligand. 96.67
KOG1214 1289 consensus Nidogen and related basement membrane pr 96.2
KOG4260350 consensus Uncharacterized conserved protein [Funct 96.09
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.03
KOG0994 1758 consensus Extracellular matrix glycoprotein Lamini 95.96
smart0005163 DSL delta serrate ligand. 95.8
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 95.32
KOG0994 1758 consensus Extracellular matrix glycoprotein Lamini 95.12
smart0017939 EGF_CA Calcium-binding EGF-like domain. 94.74
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 94.67
smart0017939 EGF_CA Calcium-binding EGF-like domain. 93.62
KOG4260350 consensus Uncharacterized conserved protein [Funct 93.57
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 92.87
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 91.55
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 90.83
cd0005336 EGF Epidermal growth factor domain, found in epide 89.9
KOG1218316 consensus Proteins containing Ca2+-binding EGF-lik 89.74
cd0005336 EGF Epidermal growth factor domain, found in epide 89.66
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 88.8
KOG1218316 consensus Proteins containing Ca2+-binding EGF-lik 87.35
smart0018135 EGF Epidermal growth factor-like domain. 86.75
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 84.71
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 83.65
KOG1836 1705 consensus Extracellular matrix glycoprotein Lamini 81.23
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 80.73
>KOG1225 consensus Teneurin-1 and related extracellular matrix proteins, contain EGF-like repeats [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information 
Probab=99.52  E-value=3e-14  Score=144.83  Aligned_cols=130  Identities=39%  Similarity=0.855  Sum_probs=107.6

Q ss_pred             CccCCCceeeecCCCCcccCCCCCcccccCCCCCCCCCCeeeCCccccCCCCcCCCCCCCCCCCCCCCCceecCCCcccc
Q 017103           97 PVQFPGFNGELICPAYHELCSTGPIAVFGQCPNSCTFNGDCVDGKCHCFLGFHGHDCSKRSCPDNCNGHGKCLSNGACEC  176 (377)
Q Consensus        97 c~C~~G~~G~i~C~~~~~~C~~~~~~~~~~C~~~C~~~G~C~~g~C~C~~G~~G~~C~~~~C~~~C~~~G~C~~~~~C~C  176 (377)
                      +.|+.+|+|+        .|..      ..||..|.++|.|++|.|+|++||+|.+|++..|+..|++|+.++ .++|+|
T Consensus       236 c~c~~~~~g~--------~c~~------~~C~~~c~~~g~c~~G~CIC~~Gf~G~dC~e~~Cp~~cs~~g~~~-~g~CiC  300 (525)
T KOG1225|consen  236 CECPEGYFGP--------LCST------IYCPGGCTGRGQCVEGRCICPPGFTGDDCDELVCPVDCSGGGVCV-DGECIC  300 (525)
T ss_pred             eecCCceeCC--------cccc------ccCCCCCcccceEeCCeEeCCCCCcCCCCCcccCCcccCCCceec-CCEeec
Confidence            3455777777        5663      688899999999999999999999999999989988899999998 459999


Q ss_pred             CCCCCCCCCCCCCCCcccCCCCCeeecCCCceEecCCCCCCCCCCCcCcCCCCccccCcccCCCCcccCCCCCccc
Q 017103          177 ENGYTGIDCSTAVCDEQCSLHGGVCDNGVCEFRCSDYAGYTCQNSSKLISSLSVCKYVLEKDAGGQHCAPSESSIL  252 (377)
Q Consensus       177 ~~G~~G~~C~~~~C~~~c~~~Gg~C~~~~~~~~C~~~~G~~C~~~~~~c~~~~~C~~~~~~~~~~~~C~~~~~~~~  252 (377)
                      ++||+|.+|++..|...|..|| .|+++.+.+. ++|+|..|+.. . |.+.+-|.+       ++.|..+|.+..
T Consensus       301 ~~g~~G~dCs~~~cpadC~g~G-~Ci~G~C~C~-~Gy~G~~C~~~-~-C~~~g~cv~-------gC~C~~Gw~G~d  365 (525)
T KOG1225|consen  301 NPGYSGKDCSIRRCPADCSGHG-KCIDGECLCD-EGYTGELCIQR-A-CSGGGQCVN-------GCKCKKGWRGPD  365 (525)
T ss_pred             CCCccccccccccCCccCCCCC-cccCCceEeC-CCCcCCccccc-c-cCCCceecc-------CceeccCccCCC
Confidence            9999999999999999998887 9996665444 78999999987 2 655555554       377888887665

>KOG1225 consensus Teneurin-1 and related extracellular matrix proteins, contain EGF-like repeats [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PTZ00337 surface protease GP63; Provisional Back     alignment and domain information
>PTZ00257 Glycoprotein GP63 (leishmanolysin); Provisional Back     alignment and domain information
>PF01457 Peptidase_M8: Leishmanolysin This Prosite motif covers only the active site Back     alignment and domain information
>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2556 consensus Leishmanolysin-like peptidase (Peptidase M8 family) [Cell wall/membrane/envelope biogenesis; Defense mechanisms] Back     alignment and domain information
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>KOG4260 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG4260 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>KOG1218 consensus Proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG1218 consensus Proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>KOG1836 consensus Extracellular matrix glycoprotein Laminin subunits alpha and gamma [Extracellular structures] Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query377
2ygq_A324 Wif Domain-Epidermal Growth Factor (Egf)-Like Domai 2e-07
>pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 Back     alignment and structure 
Iteration: 1

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
Query: 126 QCPNSCTFNGDCVDGK-CHCFLGFHGHDCSKRSCPDNCNGHGKCLSNGACECENGYTGID 184
           +CP  C   G C + + C C  GFHG  C K  C   C   G C++ G C C  G+ G++
Sbjct: 150 ECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVN 209
Query: 185 CSTAVCDEQCSLHGGVC 201
           C  A C   C  +GG C
Sbjct: 210 CDKANCSTTC-FNGGTC 225

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query377
1lml_A478 Leishmanolysin; metalloprotease, glycoprotein; 1.8 8e-17
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 6e-16
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 6e-15
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 7e-14
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 6e-12
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 3e-13
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 6e-09
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 7e-09
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 4e-11
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-10
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-08
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 9e-11
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 3e-08
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 4e-08
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 1e-05
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-09
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 9e-07
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 7e-04
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 3e-06
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 5e-06
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 2e-04
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 4e-06
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 6e-05
3g5c_A510 ADAM 22; alpha/beta fold, cross-linked domain, cel 6e-06
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 7e-06
2vh0_B134 Activated factor XA light chain; serine protease, 8e-06
3v4v_B503 Integrin beta-7; cell adhesion, madcam-1, membrane 1e-05
2ddu_A387 Reelin; beta-jelly-roll, signaling protein; 2.05A 1e-05
2ddu_A387 Reelin; beta-jelly-roll, signaling protein; 2.05A 1e-05
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 2e-05
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 8e-05
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 3e-05
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 6e-05
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 3e-05
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 4e-05
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 1e-04
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-04
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 4e-04
>1lml_A Leishmanolysin; metalloprotease, glycoprotein; 1.86A {Leishmania major} SCOP: d.92.1.3 Length = 478 Back     alignment and structure
 Score = 80.5 bits (197), Expect = 8e-17
 Identities = 29/121 (23%), Positives = 42/121 (34%), Gaps = 11/121 (9%)

Query: 6   GGQSSLADYCTYFVAYSDGSCTDTNSARAPDRMLGEVRGSNSRCMASSLVRTGFVRGSMT 65
            G S+  DYC   V YSDGSCT   S      +   V    +RC+  +           +
Sbjct: 347 AGVSAFMDYCPVVVPYSDGSCTQRASEAHASLLPFNVFSDAARCIDGAFRPKATDGIVKS 406

Query: 66  QGNGCYQHRCVNNSLEVAV----DGIWKVCPEAGGPVQFPGF------NGELICPAYHEL 115
               C   +C   +   +V       +  C   G  V+           G + CP Y E+
Sbjct: 407 YAGLCANVQCDTATRTYSVQVHGSNDYTNCTP-GLRVELSTVSNAFEGGGYITCPPYVEV 465

Query: 116 C 116
           C
Sbjct: 466 C 466
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Length = 725 Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Length = 725 Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Length = 725 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} Length = 510 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* Length = 503 Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Length = 387 Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Length = 387 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Length = 280 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query377
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.68
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.68
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.62
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.56
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.52
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.5
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.46
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.43
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.43
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.41
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.37
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.37
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.3
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.28
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.24
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.23
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.11
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.05
2bou_A143 EGF-like module containing mucin-like hormone rece 99.01
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.99
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.97
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.92
1lml_A478 Leishmanolysin; metalloprotease, glycoprotein; 1.8 98.72
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.68
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.68
2bou_A143 EGF-like module containing mucin-like hormone rece 98.67
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.64
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.54
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.52
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.52
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.49
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.36
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.32
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.21
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.18
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.16
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.14
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 98.14
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.12
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.07
2vh0_B134 Activated factor XA light chain; serine protease, 98.03
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.93
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 97.82
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.79
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.76
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 97.75
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 97.73
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.7
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 97.69
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.56
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 97.5
2vh0_B134 Activated factor XA light chain; serine protease, 97.47
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 97.47
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 97.46
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.45
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 97.41
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 97.36
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.31
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 97.29
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 97.25
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.21
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.21
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 97.14
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 97.07
2k2s_B61 Micronemal protein 6; microneme protein complex, c 96.93
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 96.86
1a3p_A45 Epidermal growth factor; disulfide connectivities, 96.86
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 96.86
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 96.78
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 96.73
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 96.7
1a3p_A45 Epidermal growth factor; disulfide connectivities, 96.67
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 96.47
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 96.46
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 96.44
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 96.42
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 96.35
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 96.35
1nql_B53 Epidermal growth factor; cell surface receptor, ty 96.03
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 95.9
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 95.84
1nql_B53 Epidermal growth factor; cell surface receptor, ty 95.76
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 95.74
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 95.48
2k2s_B61 Micronemal protein 6; microneme protein complex, c 95.41
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 95.3
3v65_B386 Low-density lipoprotein receptor-related protein; 95.09
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 95.05
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 94.99
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 94.89
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 94.73
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 94.18
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 93.58
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 93.39
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 93.24
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 93.13
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 93.08
2i9a_A145 Urokinase-type plasminogen activator; growth facto 93.01
3v65_B 386 Low-density lipoprotein receptor-related protein; 92.6
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 92.45
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 92.33
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 91.55
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 91.5
2ddu_A387 Reelin; beta-jelly-roll, signaling protein; 2.05A 91.48
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 90.1
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 89.91
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 89.27
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 89.06
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 89.03
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 88.69
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 88.2
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 88.03
2i9a_A145 Urokinase-type plasminogen activator; growth facto 87.67
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 87.55
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 85.79
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 85.65
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 84.97
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 83.34
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 82.06
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
Probab=99.68  E-value=5.7e-17  Score=157.15  Aligned_cols=127  Identities=31%  Similarity=0.732  Sum_probs=77.6

Q ss_pred             CCCcccCcCCCCEEEeeCCceeecCCCCCCccCCCceeeecCCCCcccCCCCCcccccCCCCCCCCCCeee-CCccccCC
Q 017103           68 NGCYQHRCVNNSLEVAVDGIWKVCPEAGGPVQFPGFNGELICPAYHELCSTGPIAVFGQCPNSCTFNGDCV-DGKCHCFL  146 (377)
Q Consensus        68 d~C~~~pC~ngg~Cv~~~~~~~~C~~~g~c~C~~G~~G~i~C~~~~~~C~~~~~~~~~~C~~~C~~~G~C~-~g~C~C~~  146 (377)
                      +.| ..+|.|+|+|+.  .        +.|.|.+||+|. .|+.             ..|..+|.++|+|+ .++|.|++
T Consensus       149 ~~C-~~~C~~~G~C~~--~--------~~C~C~~G~~G~-~C~~-------------~~C~~~C~~~G~C~~~~~C~C~~  203 (324)
T 2ygq_A          149 AEC-PGGCRNGGFCNE--R--------RICECPDGFHGP-HCEK-------------ALCTPRCMNGGLCVTPGFCICPP  203 (324)
T ss_dssp             CCC-SSCCCSSCEECT--T--------SCEECCTTEESS-SSCE-------------ESSSSCCCTTCEECSSCCEECCT
T ss_pred             CCC-CCCCCCCCEECC--C--------CeEECCCCCcCC-CCCC-------------CCCCCCCCCCCEEcCCCEEeCCC
Confidence            355 358999999953  2        234566999999 5543             23445799999998 48999999


Q ss_pred             CCcCCCCCCCCCCCCCCCCceecCCCccccCCCCCCCCCCCCCCCcccCCCCCeeecCCCceEe-cCCCCCCCCCC
Q 017103          147 GFHGHDCSKRSCPDNCNGHGKCLSNGACECENGYTGIDCSTAVCDEQCSLHGGVCDNGVCEFRC-SDYAGYTCQNS  221 (377)
Q Consensus       147 G~~G~~C~~~~C~~~C~~~G~C~~~~~C~C~~G~~G~~C~~~~C~~~c~~~Gg~C~~~~~~~~C-~~~~G~~C~~~  221 (377)
                      ||+|.+|+...|..+|.++|+|+..++|.|++||+|..|+++.|...| .++|+|+.. ..+.| ++|.|..|+..
T Consensus       204 G~~G~~C~~~~C~~~C~~~G~C~~~~~C~C~~G~~G~~C~~~~C~~~C-~~~g~C~~~-~~C~C~~G~~G~~C~~~  277 (324)
T 2ygq_A          204 GFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPC-RNGGKCIGK-SKCKCSKGYQGDLCSKP  277 (324)
T ss_dssp             TCBTTTTCBCCCSSCCCSSCCBSCSSCBCCCTTCCTTTTC------------------------------------
T ss_pred             CccCCCcccCcCCCCCCCCCeeCCCCeeeCCCCccCCCCCcCcCCCcC-CCCCEECCC-CEEECCCCCcCCCCcCC
Confidence            999999998889889999999998899999999999999988887555 566699852 23334 56888888753
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1lml_A Leishmanolysin; metalloprotease, glycoprotein; 1.86A {Leishmania major} SCOP: d.92.1.3 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 377
d1lmla_475 d.92.1.3 (A:) Leishmanolysin {Leishmania major [Ta 2e-18
>d1lmla_ d.92.1.3 (A:) Leishmanolysin {Leishmania major [TaxId: 5664]} Length = 475 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Leishmanolysin
domain: Leishmanolysin
species: Leishmania major [TaxId: 5664]

 Score = 84.4 bits (208), Expect = 2e-18
 Identities = 29/123 (23%), Positives = 42/123 (34%), Gaps = 11/123 (8%)

Query: 6   GGQSSLADYCTYFVAYSDGSCTDTNSARAPDRMLGEVRGSNSRCMASSLVRTGFVRGSMT 65
            G S+  DYC   V YSDGSCT   S      +   V    +RC+  +           +
Sbjct: 347 AGVSAFMDYCPVVVPYSDGSCTQRASEAHASLLPFNVFSDAARCIDGAFRPKATDGIVKS 406

Query: 66  QGNGCYQHRCVNNSLEVAV----DGIWKVCPEAGGPVQFPGF------NGELICPAYHEL 115
               C   +C   +   +V       +  C   G  V+           G + CP Y E+
Sbjct: 407 YAGLCANVQCDTATRTYSVQVHGSNDYTNCTP-GLRVELSTVSNAFEGGGYITCPPYVEV 465

Query: 116 CST 118
           C  
Sbjct: 466 CQG 468

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query377
d1lmla_475 Leishmanolysin {Leishmania major [TaxId: 5664]} 98.56
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.94
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 97.94
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.92
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.87
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 97.84
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.83
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.82
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.81
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.81
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.76
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.7
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.66
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.65
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.64
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.64
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.53
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.52
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.43
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.39
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.28
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.17
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.15
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.09
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.01
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.85
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 96.83
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.67
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.61
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.59
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 96.42
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 96.26
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 96.2
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 96.12
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.02
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 95.39
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 95.32
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 95.16
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 94.52
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 93.28
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 93.07
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 92.69
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 92.65
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 92.47
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 92.21
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 92.09
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 91.11
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 88.8
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 87.21
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 86.63
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 85.88
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 80.24
>d1lmla_ d.92.1.3 (A:) Leishmanolysin {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Leishmanolysin
domain: Leishmanolysin
species: Leishmania major [TaxId: 5664]

Probab=98.56  E-value=2.2e-09  Score=106.51  Aligned_cols=116  Identities=27%  Similarity=0.468  Sum_probs=82.6

Q ss_pred             CCCCCCCCCCCCCCCceeecCCCcccCCCCCCCccccCCceeCCCCcccCCcccccceecCCCCCCCCCcccCcCCCC--
Q 017103            2 LAIAGGQSSLADYCTYFVAYSDGSCTDTNSARAPDRMLGEVRGSNSRCMASSLVRTGFVRGSMTQGNGCYQHRCVNNS--   79 (377)
Q Consensus         2 ~~~~Gg~~~l~D~Cp~~~~~~~~~C~d~~~~~~~~~~~g~~~G~nsrC~~~~l~~~g~~g~~c~~~d~C~~~pC~ngg--   79 (377)
                      +|++||.+.++||||++++|++..|.+..+...+..+.++.||.+||||.+++.+....+..-.....|++..|..+.  
T Consensus       343 ~~~~~g~~~~~DyCp~~~~~~~~~C~~~~~~~~~~~~~~~~~g~~S~Cf~s~~~~~~~~~~~~~~~~~C~~~~C~~~~~~  422 (475)
T d1lmla_         343 DPSLAGVSAFMDYCPVVVPYSDGSCTQRASEAHASLLPFNVFSDAARCIDGAFRPKATDGIVKSYAGLCANVQCDTATRT  422 (475)
T ss_dssp             STTEECSCTTTTTCCCEEEEEEEETTSCGGGSCTTTGGGCCCSTTEEEEEEEECBCC------CEEEEEEEEEEETTTTE
T ss_pred             CcccCCCchhhccCceeeeccCCcccccccccchhhccccccCCCCEeeCCcccccccCCcccccCCEEEeEECCCCCCE
Confidence            578899999999999999999999998776655667788999999999998776543322222334579999997543  


Q ss_pred             EEEeeCC--ceeecCCCCCCccCCC------ceeeecCCCCcccCCC
Q 017103           80 LEVAVDG--IWKVCPEAGGPVQFPG------FNGELICPAYHELCST  118 (377)
Q Consensus        80 ~Cv~~~~--~~~~C~~~g~c~C~~G------~~G~i~C~~~~~~C~~  118 (377)
                      +-|.+.+  .+..|+ +|+-+-...      +.|.|+||...++|..
T Consensus       423 ~~I~i~g~~~~~~C~-~g~~i~~~~~~~~~~~~G~I~CP~~~~fC~~  468 (475)
T d1lmla_         423 YSVQVHGSNDYTNCT-PGLRVELSTVSNAFEGGGYITCPPYVEVCQG  468 (475)
T ss_dssp             EEEECTTCSSCEECC-TTCEEEGGGTCSSBCTTCEEECCCHHHHHTT
T ss_pred             EEEEEecCceEEECC-CCCEEEecccccccccCcEEECCChHHHHhh
Confidence            4555543  345676 455554332      2578999998778874
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure