Citrus Sinensis ID: 017144
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 376 | ||||||
| 359484559 | 362 | PREDICTED: probable lactoylglutathione l | 0.960 | 0.997 | 0.758 | 1e-165 | |
| 449443163 | 362 | PREDICTED: probable lactoylglutathione l | 0.962 | 1.0 | 0.755 | 1e-165 | |
| 225429965 | 364 | PREDICTED: probable lactoylglutathione l | 0.869 | 0.898 | 0.851 | 1e-164 | |
| 296081860 | 359 | unnamed protein product [Vitis vinifera] | 0.869 | 0.910 | 0.851 | 1e-164 | |
| 225445150 | 355 | PREDICTED: probable lactoylglutathione l | 0.882 | 0.935 | 0.823 | 1e-163 | |
| 255546389 | 369 | lactoylglutathione lyase, putative [Rici | 0.845 | 0.861 | 0.851 | 1e-161 | |
| 255550986 | 389 | lactoylglutathione lyase, putative [Rici | 0.867 | 0.838 | 0.797 | 1e-160 | |
| 224119744 | 355 | predicted protein [Populus trichocarpa] | 0.936 | 0.991 | 0.748 | 1e-160 | |
| 357520937 | 347 | Lactoylglutathione lyase [Medicago trunc | 0.920 | 0.997 | 0.716 | 1e-159 | |
| 449530241 | 354 | PREDICTED: probable lactoylglutathione l | 0.930 | 0.988 | 0.75 | 1e-158 |
| >gi|359484559|ref|XP_003633121.1| PREDICTED: probable lactoylglutathione lyase, chloroplast-like isoform 2 [Vitis vinifera] gi|297738782|emb|CBI28027.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 588 bits (1517), Expect = e-165, Method: Compositional matrix adjust.
Identities = 286/377 (75%), Positives = 323/377 (85%), Gaps = 16/377 (4%)
Query: 1 MLRTLPIASPSSLTVSTYNKTSLPSQSSLKLSPFCVNNDGGNNISYCYSTSRRLALFQLG 60
M+R +P+A+ ++S++ S S+ LS F + SR + +G
Sbjct: 1 MVRIIPMATSFRPSLSSFG-FSTSSRLGFPLSTFNI--------------SRTVTSLHVG 45
Query: 61 AAIPQSHFFGAKALKLLRA-EGSTIEASTSGNMAPTSNTVTEQNVLDWVKSDKRRMLHVV 119
+AIPQS FG A KLLR EG+ + + +GN+A S + ++NVL+WVK DKRRMLHVV
Sbjct: 46 SAIPQSQIFGLNASKLLRGGEGNAMGFNATGNIAHASTSAAQENVLEWVKKDKRRMLHVV 105
Query: 120 YRVGDLDKTIKFYTECLGMKLLRKRDIPEDRYTNAFLGYGPEDSHFVVELTYNYGVDKYD 179
YRVGDLD+TIKFYTECLGMKLLR+RDIPE+RYTNAFLGYGPEDSHFV+ELTYNYGVDKYD
Sbjct: 106 YRVGDLDRTIKFYTECLGMKLLRRRDIPEERYTNAFLGYGPEDSHFVIELTYNYGVDKYD 165
Query: 180 IGTGFGHFGIAVEDVAKTVDLVKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERG 239
IG GFGHFGIAVEDV KTVDL+KAKGGKVTREPGPVKGG+TVIAFIEDPDGYKFELLERG
Sbjct: 166 IGAGFGHFGIAVEDVTKTVDLIKAKGGKVTREPGPVKGGSTVIAFIEDPDGYKFELLERG 225
Query: 240 PTPEPLCQVMLRVGDLDRAINFYKKAFGMELLRKRDNPDYKYTIAVMGYGPEDKNAVLEL 299
PTPEPLCQVMLRVGDLDR+INFY+KAFGMELLRKRDNP+YKYTIA+MGYGPEDKNAVLEL
Sbjct: 226 PTPEPLCQVMLRVGDLDRSINFYEKAFGMELLRKRDNPEYKYTIAMMGYGPEDKNAVLEL 285
Query: 300 TYNHGVTEYDKGNGYAQIAIGTDDVYKTAEAIKLSGGKITREPGPLPGINTKITACLDPD 359
TYN+GV+EYDKGNGYAQIAIGTDDVYKTAEAIKLSGGKITREPGPLPGINTKITAC+DPD
Sbjct: 286 TYNYGVSEYDKGNGYAQIAIGTDDVYKTAEAIKLSGGKITREPGPLPGINTKITACVDPD 345
Query: 360 GWKSVFVDNLDFLKELE 376
GWKSVFVDN+DFLKEL+
Sbjct: 346 GWKSVFVDNIDFLKELD 362
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449443163|ref|XP_004139350.1| PREDICTED: probable lactoylglutathione lyase, chloroplast-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225429965|ref|XP_002283968.1| PREDICTED: probable lactoylglutathione lyase, chloroplast-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296081860|emb|CBI20865.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225445150|ref|XP_002284023.1| PREDICTED: probable lactoylglutathione lyase, chloroplast-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255546389|ref|XP_002514254.1| lactoylglutathione lyase, putative [Ricinus communis] gi|223546710|gb|EEF48208.1| lactoylglutathione lyase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255550986|ref|XP_002516541.1| lactoylglutathione lyase, putative [Ricinus communis] gi|223544361|gb|EEF45882.1| lactoylglutathione lyase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224119744|ref|XP_002331150.1| predicted protein [Populus trichocarpa] gi|222873233|gb|EEF10364.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357520937|ref|XP_003630757.1| Lactoylglutathione lyase [Medicago truncatula] gi|355524779|gb|AET05233.1| Lactoylglutathione lyase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449530241|ref|XP_004172104.1| PREDICTED: probable lactoylglutathione lyase, chloroplast-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 376 | ||||||
| TAIR|locus:2019574 | 350 | AT1G67280 [Arabidopsis thalian | 0.869 | 0.934 | 0.791 | 6.8e-143 | |
| UNIPROTKB|P0AC81 | 135 | gloA "GloA" [Escherichia coli | 0.329 | 0.918 | 0.588 | 7.8e-39 | |
| UNIPROTKB|Q9KT93 | 138 | gloA "Probable lactoylglutathi | 0.329 | 0.898 | 0.588 | 1e-36 | |
| TIGR_CMR|VC_1010 | 138 | VC_1010 "lactoylglutathione ly | 0.329 | 0.898 | 0.588 | 1e-36 | |
| DICTYBASE|DDB_G0291265 | 136 | gloA "glyoxylase I" [Dictyoste | 0.329 | 0.911 | 0.572 | 2.1e-36 | |
| TIGR_CMR|SO_2044 | 136 | SO_2044 "lactoylglutathione ly | 0.329 | 0.911 | 0.552 | 2.4e-35 | |
| ZFIN|ZDB-GENE-040912-38 | 298 | glod4 "glyoxalase domain conta | 0.646 | 0.815 | 0.335 | 2.8e-27 | |
| FB|FBgn0031143 | 293 | CG1532 [Drosophila melanogaste | 0.654 | 0.839 | 0.307 | 6.8e-24 | |
| RGD|1307010 | 298 | Glod4 "glyoxalase domain conta | 0.654 | 0.825 | 0.291 | 2.9e-23 | |
| UNIPROTKB|F1RHJ9 | 496 | GLOD4 "Uncharacterized protein | 0.651 | 0.493 | 0.314 | 4.2e-23 |
| TAIR|locus:2019574 AT1G67280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1397 (496.8 bits), Expect = 6.8e-143, P = 6.8e-143
Identities = 266/336 (79%), Positives = 292/336 (86%)
Query: 47 CYSTSRRLALFQLGAA------IPQSHFFGAKALKLLRAEGSTIEASTSGNMAPTSNTVT 100
C+S S R + L +PQS FG + KLLR + + + SG A + T
Sbjct: 18 CFSDSPRFPISLLSRNLSRTLHVPQSQLFGLTSHKLLRRSVNCLGVAESGKAAQAT---T 74
Query: 101 EQNVLDWVKSDKRRMLHVVYRVGDLDKTIKFYTECLGMKLLRKRDIPEDRYTNAFLGYGP 160
+ ++L WVK+DKRRMLHVVYRVGD+D+TIKFYTECLGMKLLRKRDIPE++YTNAFLGYGP
Sbjct: 75 QDDLLTWVKNDKRRMLHVVYRVGDMDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGP 134
Query: 161 EDSHFVVELTYNYGVDKYDIGTGFGHFGIAVEDVAKTVDLVKAKGGKVTREPGPVKGGNT 220
EDSHFV+ELTYNYGVDKYDIG GFGHFGIAV+DVAKTV+LVKAKGGKV+REPGPVKGG T
Sbjct: 135 EDSHFVIELTYNYGVDKYDIGAGFGHFGIAVDDVAKTVELVKAKGGKVSREPGPVKGGKT 194
Query: 221 VIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRAINFYKKAFGMELLRKRDNPDYK 280
VIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRAI FY+KAFGMELLR RDNP+YK
Sbjct: 195 VIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRAIKFYEKAFGMELLRTRDNPEYK 254
Query: 281 YTIAVMGYGPEDKNAVLELTYNHGVTEYDKGNGYAQIAIGTDDVYKTAEAIKLSGGKITR 340
YTIA+MGYGPEDK VLELTYN+GVTEYDKGN YAQIAIGTDDVYKTAEAIKL GGKITR
Sbjct: 255 YTIAMMGYGPEDKFPVLELTYNYGVTEYDKGNAYAQIAIGTDDVYKTAEAIKLFGGKITR 314
Query: 341 EPGPLPGINTKITACLDPDGWKSVFVDNLDFLKELE 376
EPGPLPGI+TKITACLDPDGWKSVFVDN+DFLKELE
Sbjct: 315 EPGPLPGISTKITACLDPDGWKSVFVDNIDFLKELE 350
|
|
| UNIPROTKB|P0AC81 gloA "GloA" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KT93 gloA "Probable lactoylglutathione lyase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_1010 VC_1010 "lactoylglutathione lyase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0291265 gloA "glyoxylase I" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_2044 SO_2044 "lactoylglutathione lyase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040912-38 glod4 "glyoxalase domain containing 4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0031143 CG1532 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| RGD|1307010 Glod4 "glyoxalase domain containing 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RHJ9 GLOD4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 376 | |||
| PLN02300 | 286 | PLN02300, PLN02300, lactoylglutathione lyase | 0.0 | |
| TIGR00068 | 150 | TIGR00068, glyox_I, lactoylglutathione lyase | 2e-84 | |
| cd07233 | 121 | cd07233, Glyoxalase_I, Glyoxalase I catalyzes the | 2e-58 | |
| TIGR00068 | 150 | TIGR00068, glyox_I, lactoylglutathione lyase | 6e-51 | |
| PRK10291 | 129 | PRK10291, PRK10291, glyoxalase I; Provisional | 2e-47 | |
| cd07233 | 121 | cd07233, Glyoxalase_I, Glyoxalase I catalyzes the | 1e-39 | |
| PRK10291 | 129 | PRK10291, PRK10291, glyoxalase I; Provisional | 3e-38 | |
| pfam00903 | 120 | pfam00903, Glyoxalase, Glyoxalase/Bleomycin resist | 6e-31 | |
| cd08358 | 127 | cd08358, Glo_EDI_BRP_like_21, This conserved domai | 6e-28 | |
| cd06587 | 110 | cd06587, Glo_EDI_BRP_like, This domain superfamily | 1e-23 | |
| pfam00903 | 120 | pfam00903, Glyoxalase, Glyoxalase/Bleomycin resist | 2e-22 | |
| PLN03042 | 185 | PLN03042, PLN03042, Lactoylglutathione lyase; Prov | 5e-18 | |
| PLN02367 | 233 | PLN02367, PLN02367, lactoylglutathione lyase | 5e-17 | |
| COG0346 | 138 | COG0346, GloA, Lactoylglutathione lyase and relate | 2e-15 | |
| pfam12681 | 109 | pfam12681, Glyoxalase_2, Glyoxalase-like domain | 3e-14 | |
| cd08358 | 127 | cd08358, Glo_EDI_BRP_like_21, This conserved domai | 8e-14 | |
| cd06587 | 110 | cd06587, Glo_EDI_BRP_like, This domain superfamily | 3e-13 | |
| PLN02367 | 233 | PLN02367, PLN02367, lactoylglutathione lyase | 4e-12 | |
| PLN03042 | 185 | PLN03042, PLN03042, Lactoylglutathione lyase; Prov | 9e-12 | |
| pfam12681 | 109 | pfam12681, Glyoxalase_2, Glyoxalase-like domain | 8e-11 | |
| COG3324 | 127 | COG3324, COG3324, Predicted enzyme related to lact | 4e-10 | |
| cd07247 | 114 | cd07247, SgaA_N_like, N-terminal domain of Strepto | 4e-09 | |
| cd07249 | 128 | cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) | 5e-09 | |
| COG0346 | 138 | COG0346, GloA, Lactoylglutathione lyase and relate | 7e-09 | |
| cd07242 | 128 | cd07242, Glo_EDI_BRP_like_6, This conserved domain | 9e-09 | |
| COG3324 | 127 | COG3324, COG3324, Predicted enzyme related to lact | 1e-08 | |
| pfam13669 | 110 | pfam13669, Glyoxalase_4, Glyoxalase/Bleomycin resi | 1e-08 | |
| cd07245 | 114 | cd07245, Glo_EDI_BRP_like_9, This conserved domain | 1e-08 | |
| TIGR02295 | 294 | TIGR02295, HpaD, 3,4-dihydroxyphenylacetate 2,3-di | 2e-08 | |
| cd08346 | 126 | cd08346, PcpA_N_like, N-terminal domain of Sphingo | 3e-08 | |
| cd07262 | 123 | cd07262, Glo_EDI_BRP_like_19, This conserved domai | 4e-08 | |
| cd08362 | 120 | cd08362, BphC5-RrK37_N_like, N-terminal, non-catal | 2e-07 | |
| cd07247 | 114 | cd07247, SgaA_N_like, N-terminal domain of Strepto | 3e-07 | |
| TIGR01263 | 353 | TIGR01263, 4HPPD, 4-hydroxyphenylpyruvate dioxygen | 2e-06 | |
| cd07267 | 113 | cd07267, THT_Oxygenase_N, N-terminal domain of 2,4 | 4e-06 | |
| cd08348 | 134 | cd08348, BphC2-C3-RGP6_C_like, The single-domain 2 | 4e-06 | |
| cd07262 | 123 | cd07262, Glo_EDI_BRP_like_19, This conserved domai | 5e-06 | |
| TIGR03081 | 128 | TIGR03081, metmalonyl_epim, methylmalonyl-CoA epim | 9e-06 | |
| cd08354 | 122 | cd08354, Glo_EDI_BRP_like_13, This conserved domai | 2e-05 | |
| cd07251 | 120 | cd07251, Glo_EDI_BRP_like_10, This conserved domai | 2e-05 | |
| cd08349 | 112 | cd08349, BLMA_like, Bleomycin binding protein (BLM | 2e-05 | |
| cd07263 | 120 | cd07263, Glo_EDI_BRP_like_16, This conserved domai | 3e-05 | |
| cd07263 | 120 | cd07263, Glo_EDI_BRP_like_16, This conserved domai | 3e-05 | |
| cd07253 | 125 | cd07253, Glo_EDI_BRP_like_2, This conserved domain | 3e-05 | |
| cd08345 | 113 | cd08345, Fosfomycin_RP, Fosfomycin resistant prote | 4e-05 | |
| cd07254 | 120 | cd07254, Glo_EDI_BRP_like_20, This conserved domai | 5e-05 | |
| cd07255 | 125 | cd07255, Glo_EDI_BRP_like_12, This conserved domai | 6e-05 | |
| cd07255 | 125 | cd07255, Glo_EDI_BRP_like_12, This conserved domai | 7e-05 | |
| cd08360 | 134 | cd08360, MhqB_like_C, C-terminal domain of Burkhol | 9e-05 | |
| cd08352 | 125 | cd08352, Glo_EDI_BRP_like_1, This conserved domain | 1e-04 | |
| cd07244 | 121 | cd07244, FosA, FosA, a Fosfomycin resistance prote | 1e-04 | |
| cd07237 | 154 | cd07237, BphC1-RGP6_C_like, C-terminal domain of 2 | 1e-04 | |
| TIGR02295 | 294 | TIGR02295, HpaD, 3,4-dihydroxyphenylacetate 2,3-di | 2e-04 | |
| cd08343 | 131 | cd08343, ED_TypeI_classII_C, C-terminal domain of | 2e-04 | |
| cd08342 | 136 | cd08342, HPPD_N_like, N-terminal domain of 4-hydro | 4e-04 | |
| cd07266 | 121 | cd07266, HPCD_N_class_II, N-terminal domain of 3,4 | 6e-04 | |
| TIGR03211 | 303 | TIGR03211, catechol_2_3, catechol 2,3 dioxygenase | 0.001 | |
| cd07249 | 128 | cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) | 0.002 | |
| cd07253 | 125 | cd07253, Glo_EDI_BRP_like_2, This conserved domain | 0.003 | |
| cd07239 | 144 | cd07239, BphC5-RK37_C_like, C-terminal, catalytic, | 0.003 |
| >gnl|CDD|215169 PLN02300, PLN02300, lactoylglutathione lyase | Back alignment and domain information |
|---|
Score = 601 bits (1551), Expect = 0.0
Identities = 246/286 (86%), Positives = 268/286 (93%)
Query: 91 NMAPTSNTVTEQNVLDWVKSDKRRMLHVVYRVGDLDKTIKFYTECLGMKLLRKRDIPEDR 150
A S +++L+W K DKRRMLHVVYRVGDLD+TIKFYTECLGMKLLRKRDIPE++
Sbjct: 1 ASAAASTAAEAEDLLEWPKKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEK 60
Query: 151 YTNAFLGYGPEDSHFVVELTYNYGVDKYDIGTGFGHFGIAVEDVAKTVDLVKAKGGKVTR 210
YTNAFLGYGPEDS+FVVELTYNYGVDKYDIGTGFGHFGIAVEDVAKTV+LVKAKGGKVTR
Sbjct: 61 YTNAFLGYGPEDSNFVVELTYNYGVDKYDIGTGFGHFGIAVEDVAKTVELVKAKGGKVTR 120
Query: 211 EPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRAINFYKKAFGMEL 270
EPGPVKGG +VIAF++DPDGYKFEL++RGPTPEPLCQVMLRVGDLDR+I FY+KAFGM+L
Sbjct: 121 EPGPVKGGKSVIAFVKDPDGYKFELIQRGPTPEPLCQVMLRVGDLDRSIKFYEKAFGMKL 180
Query: 271 LRKRDNPDYKYTIAVMGYGPEDKNAVLELTYNHGVTEYDKGNGYAQIAIGTDDVYKTAEA 330
LRKRDNP+YKYTIA+MGYGPEDK VLELTYN+GVTEY KGN YAQIAIGTDDVYKTAEA
Sbjct: 181 LRKRDNPEYKYTIAMMGYGPEDKTTVLELTYNYGVTEYTKGNAYAQIAIGTDDVYKTAEA 240
Query: 331 IKLSGGKITREPGPLPGINTKITACLDPDGWKSVFVDNLDFLKELE 376
IKL GGKITREPGPLPGINTKITACLDPDGWK+VFVDN+DFLKELE
Sbjct: 241 IKLVGGKITREPGPLPGINTKITACLDPDGWKTVFVDNIDFLKELE 286
|
Length = 286 |
| >gnl|CDD|232807 TIGR00068, glyox_I, lactoylglutathione lyase | Back alignment and domain information |
|---|
| >gnl|CDD|176659 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione | Back alignment and domain information |
|---|
| >gnl|CDD|232807 TIGR00068, glyox_I, lactoylglutathione lyase | Back alignment and domain information |
|---|
| >gnl|CDD|182358 PRK10291, PRK10291, glyoxalase I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|176659 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione | Back alignment and domain information |
|---|
| >gnl|CDD|182358 PRK10291, PRK10291, glyoxalase I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216182 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|176706 cd08358, Glo_EDI_BRP_like_21, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|211348 cd06587, Glo_EDI_BRP_like, This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins | Back alignment and domain information |
|---|
| >gnl|CDD|216182 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215548 PLN03042, PLN03042, Lactoylglutathione lyase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177995 PLN02367, PLN02367, lactoylglutathione lyase | Back alignment and domain information |
|---|
| >gnl|CDD|223423 COG0346, GloA, Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|221708 pfam12681, Glyoxalase_2, Glyoxalase-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|176706 cd08358, Glo_EDI_BRP_like_21, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|211348 cd06587, Glo_EDI_BRP_like, This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins | Back alignment and domain information |
|---|
| >gnl|CDD|177995 PLN02367, PLN02367, lactoylglutathione lyase | Back alignment and domain information |
|---|
| >gnl|CDD|215548 PLN03042, PLN03042, Lactoylglutathione lyase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221708 pfam12681, Glyoxalase_2, Glyoxalase-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|225861 COG3324, COG3324, Predicted enzyme related to lactoylglutathione lyase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176671 cd07247, SgaA_N_like, N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|211350 cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) | Back alignment and domain information |
|---|
| >gnl|CDD|223423 COG0346, GloA, Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|176666 cd07242, Glo_EDI_BRP_like_6, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|225861 COG3324, COG3324, Predicted enzyme related to lactoylglutathione lyase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222305 pfam13669, Glyoxalase_4, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|176669 cd07245, Glo_EDI_BRP_like_9, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|213698 TIGR02295, HpaD, 3,4-dihydroxyphenylacetate 2,3-dioxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|211356 cd08346, PcpA_N_like, N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176683 cd07262, Glo_EDI_BRP_like_19, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|176710 cd08362, BphC5-RrK37_N_like, N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176671 cd07247, SgaA_N_like, N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|233334 TIGR01263, 4HPPD, 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|176688 cd07267, THT_Oxygenase_N, N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|176696 cd08348, BphC2-C3-RGP6_C_like, The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 | Back alignment and domain information |
|---|
| >gnl|CDD|176683 cd07262, Glo_EDI_BRP_like_19, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|213772 TIGR03081, metmalonyl_epim, methylmalonyl-CoA epimerase | Back alignment and domain information |
|---|
| >gnl|CDD|176702 cd08354, Glo_EDI_BRP_like_13, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|211351 cd07251, Glo_EDI_BRP_like_10, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|211357 cd08349, BLMA_like, Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm | Back alignment and domain information |
|---|
| >gnl|CDD|211353 cd07263, Glo_EDI_BRP_like_16, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|211353 cd07263, Glo_EDI_BRP_like_16, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|176676 cd07253, Glo_EDI_BRP_like_2, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|176693 cd08345, Fosfomycin_RP, Fosfomycin resistant protein; inhibits the biological function of fosfomycin | Back alignment and domain information |
|---|
| >gnl|CDD|176677 cd07254, Glo_EDI_BRP_like_20, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|211352 cd07255, Glo_EDI_BRP_like_12, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|211352 cd07255, Glo_EDI_BRP_like_12, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|176708 cd08360, MhqB_like_C, C-terminal domain of Burkholderia sp | Back alignment and domain information |
|---|
| >gnl|CDD|211358 cd08352, Glo_EDI_BRP_like_1, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|176668 cd07244, FosA, FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive | Back alignment and domain information |
|---|
| >gnl|CDD|176661 cd07237, BphC1-RGP6_C_like, C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >gnl|CDD|213698 TIGR02295, HpaD, 3,4-dihydroxyphenylacetate 2,3-dioxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|211355 cd08343, ED_TypeI_classII_C, C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|176690 cd08342, HPPD_N_like, N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >gnl|CDD|211354 cd07266, HPCD_N_class_II, N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|234146 TIGR03211, catechol_2_3, catechol 2,3 dioxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|211350 cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) | Back alignment and domain information |
|---|
| >gnl|CDD|176676 cd07253, Glo_EDI_BRP_like_2, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|176663 cd07239, BphC5-RK37_C_like, C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 376 | |||
| PLN02300 | 286 | lactoylglutathione lyase | 100.0 | |
| KOG2943 | 299 | consensus Predicted glyoxalase [Carbohydrate trans | 100.0 | |
| TIGR02295 | 294 | HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T | 100.0 | |
| TIGR03211 | 303 | catechol_2_3 catechol 2,3 dioxygenase. Members of | 99.98 | |
| TIGR03213 | 286 | 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | 99.97 | |
| TIGR01263 | 353 | 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr | 99.87 | |
| COG2514 | 265 | Predicted ring-cleavage extradiol dioxygenase [Gen | 99.84 | |
| TIGR00068 | 150 | glyox_I lactoylglutathione lyase. Glyoxylase I is | 99.83 | |
| PLN02367 | 233 | lactoylglutathione lyase | 99.8 | |
| PLN02367 | 233 | lactoylglutathione lyase | 99.8 | |
| PRK10291 | 129 | glyoxalase I; Provisional | 99.8 | |
| PRK10291 | 129 | glyoxalase I; Provisional | 99.78 | |
| PLN02875 | 398 | 4-hydroxyphenylpyruvate dioxygenase | 99.78 | |
| PLN03042 | 185 | Lactoylglutathione lyase; Provisional | 99.77 | |
| cd07243 | 143 | 2_3_CTD_C C-terminal domain of catechol 2,3-dioxyg | 99.76 | |
| cd08358 | 127 | Glo_EDI_BRP_like_21 This conserved domain belongs | 99.76 | |
| TIGR00068 | 150 | glyox_I lactoylglutathione lyase. Glyoxylase I is | 99.76 | |
| cd07233 | 121 | Glyoxalase_I Glyoxalase I catalyzes the isomerizat | 99.75 | |
| PLN03042 | 185 | Lactoylglutathione lyase; Provisional | 99.74 | |
| COG2514 | 265 | Predicted ring-cleavage extradiol dioxygenase [Gen | 99.74 | |
| cd08353 | 142 | Glo_EDI_BRP_like_7 This conserved domain belongs t | 99.74 | |
| cd08360 | 134 | MhqB_like_C C-terminal domain of Burkholderia sp. | 99.74 | |
| PRK11478 | 129 | putative lyase; Provisional | 99.73 | |
| cd07257 | 153 | THT_oxygenase_C The C-terminal domain of 2,4,5-Tri | 99.73 | |
| cd07265 | 122 | 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg | 99.73 | |
| PLN02300 | 286 | lactoylglutathione lyase | 99.73 | |
| cd07241 | 125 | Glo_EDI_BRP_like_3 This conserved domain belongs t | 99.72 | |
| cd08342 | 136 | HPPD_N_like N-terminal domain of 4-hydroxyphenylpy | 99.72 | |
| cd08358 | 127 | Glo_EDI_BRP_like_21 This conserved domain belongs | 99.72 | |
| PRK04101 | 139 | fosfomycin resistance protein FosB; Provisional | 99.72 | |
| TIGR02295 | 294 | HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T | 99.72 | |
| cd07233 | 121 | Glyoxalase_I Glyoxalase I catalyzes the isomerizat | 99.71 | |
| TIGR03645 | 162 | glyox_marine lactoylglutathione lyase family prote | 99.71 | |
| TIGR03211 | 303 | catechol_2_3 catechol 2,3 dioxygenase. Members of | 99.71 | |
| cd07258 | 141 | PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cuma | 99.71 | |
| cd07237 | 154 | BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro | 99.7 | |
| cd08352 | 125 | Glo_EDI_BRP_like_1 This conserved domain belongs t | 99.7 | |
| cd07256 | 161 | HPCD_C_class_II C-terminal domain of 3,4-dihydroxy | 99.69 | |
| cd08342 | 136 | HPPD_N_like N-terminal domain of 4-hydroxyphenylpy | 99.69 | |
| cd08353 | 142 | Glo_EDI_BRP_like_7 This conserved domain belongs t | 99.69 | |
| cd09013 | 121 | BphC-JF8_N_like N-terminal, non-catalytic, domain | 99.69 | |
| cd07257 | 153 | THT_oxygenase_C The C-terminal domain of 2,4,5-Tri | 99.68 | |
| cd07266 | 121 | HPCD_N_class_II N-terminal domain of 3,4-dihydroxy | 99.68 | |
| cd09014 | 166 | BphC-JF8_C_like C-terminal, catalytic, domain of B | 99.68 | |
| cd08361 | 124 | PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma | 99.68 | |
| TIGR03081 | 128 | metmalonyl_epim methylmalonyl-CoA epimerase. Membe | 99.67 | |
| cd08363 | 131 | FosB FosB, a fosfomycin resistance protein, cataly | 99.67 | |
| cd07252 | 120 | BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro | 99.67 | |
| PF00903 | 128 | Glyoxalase: Glyoxalase/Bleomycin resistance protei | 99.67 | |
| cd07239 | 144 | BphC5-RK37_C_like C-terminal, catalytic, domain of | 99.67 | |
| TIGR03213 | 286 | 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | 99.67 | |
| cd08347 | 157 | PcpA_C_like C-terminal domain of Sphingobium chlor | 99.67 | |
| KOG0638 | 381 | consensus 4-hydroxyphenylpyruvate dioxygenase [Ami | 99.66 | |
| cd08364 | 131 | FosX FosX, a fosfomycin resistance protein, cataly | 99.66 | |
| PRK11478 | 129 | putative lyase; Provisional | 99.66 | |
| cd08360 | 134 | MhqB_like_C C-terminal domain of Burkholderia sp. | 99.66 | |
| cd07243 | 143 | 2_3_CTD_C C-terminal domain of catechol 2,3-dioxyg | 99.66 | |
| cd08343 | 131 | ED_TypeI_classII_C C-terminal domain of type I, cl | 99.66 | |
| cd07255 | 125 | Glo_EDI_BRP_like_12 This conserved domain belongs | 99.65 | |
| cd07247 | 114 | SgaA_N_like N-terminal domain of Streptomyces gris | 99.65 | |
| cd07241 | 125 | Glo_EDI_BRP_like_3 This conserved domain belongs t | 99.65 | |
| TIGR03645 | 162 | glyox_marine lactoylglutathione lyase family prote | 99.65 | |
| cd07253 | 125 | Glo_EDI_BRP_like_2 This conserved domain belongs t | 99.64 | |
| cd08346 | 126 | PcpA_N_like N-terminal domain of Sphingobium chlor | 99.64 | |
| cd08352 | 125 | Glo_EDI_BRP_like_1 This conserved domain belongs t | 99.64 | |
| cd08351 | 123 | ChaP_like ChaP, an enzyme involved in the biosynth | 99.64 | |
| cd07240 | 117 | ED_TypeI_classII_N N-terminal domain of type I, cl | 99.63 | |
| cd07263 | 119 | Glo_EDI_BRP_like_16 This conserved domain belongs | 99.63 | |
| cd07267 | 113 | THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr | 99.63 | |
| cd08362 | 120 | BphC5-RrK37_N_like N-terminal, non-catalytic, doma | 99.63 | |
| cd07242 | 128 | Glo_EDI_BRP_like_6 This conserved domain belongs t | 99.63 | |
| cd07258 | 141 | PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cuma | 99.63 | |
| cd07245 | 114 | Glo_EDI_BRP_like_9 This conserved domain belongs t | 99.62 | |
| cd07249 | 128 | MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als | 99.62 | |
| TIGR03081 | 128 | metmalonyl_epim methylmalonyl-CoA epimerase. Membe | 99.62 | |
| cd07237 | 154 | BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro | 99.62 | |
| PRK06724 | 128 | hypothetical protein; Provisional | 99.62 | |
| cd09011 | 120 | Glo_EDI_BRP_like_23 This conserved domain belongs | 99.61 | |
| cd08348 | 134 | BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro | 99.6 | |
| cd07265 | 122 | 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg | 99.6 | |
| cd07247 | 114 | SgaA_N_like N-terminal domain of Streptomyces gris | 99.6 | |
| cd07256 | 161 | HPCD_C_class_II C-terminal domain of 3,4-dihydroxy | 99.6 | |
| cd07244 | 121 | FosA FosA, a Fosfomycin resistance protein, cataly | 99.58 | |
| cd07264 | 125 | Glo_EDI_BRP_like_15 This conserved domain belongs | 99.58 | |
| cd07263 | 119 | Glo_EDI_BRP_like_16 This conserved domain belongs | 99.58 | |
| cd08359 | 119 | Glo_EDI_BRP_like_22 This conserved domain belongs | 99.57 | |
| cd08354 | 122 | Glo_EDI_BRP_like_13 This conserved domain belongs | 99.57 | |
| cd08345 | 113 | Fosfomycin_RP Fosfomycin resistant protein; inhibi | 99.57 | |
| cd08344 | 112 | MhqB_like_N N-terminal domain of MhqB, a type I ex | 99.57 | |
| cd08343 | 131 | ED_TypeI_classII_C C-terminal domain of type I, cl | 99.57 | |
| cd07253 | 125 | Glo_EDI_BRP_like_2 This conserved domain belongs t | 99.56 | |
| cd08355 | 122 | Glo_EDI_BRP_like_14 This conserved domain belongs | 99.56 | |
| PF12681 | 108 | Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B | 99.56 | |
| cd07238 | 112 | Glo_EDI_BRP_like_5 This conserved domain belongs t | 99.56 | |
| PF00903 | 128 | Glyoxalase: Glyoxalase/Bleomycin resistance protei | 99.56 | |
| cd08355 | 122 | Glo_EDI_BRP_like_14 This conserved domain belongs | 99.55 | |
| PRK06724 | 128 | hypothetical protein; Provisional | 99.55 | |
| cd07262 | 123 | Glo_EDI_BRP_like_19 This conserved domain belongs | 99.55 | |
| cd07249 | 128 | MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als | 99.55 | |
| cd07245 | 114 | Glo_EDI_BRP_like_9 This conserved domain belongs t | 99.55 | |
| PRK04101 | 139 | fosfomycin resistance protein FosB; Provisional | 99.55 | |
| cd07246 | 122 | Glo_EDI_BRP_like_8 This conserved domain belongs t | 99.54 | |
| cd08357 | 125 | Glo_EDI_BRP_like_18 This conserved domain belongs | 99.54 | |
| cd08346 | 126 | PcpA_N_like N-terminal domain of Sphingobium chlor | 99.54 | |
| cd07254 | 120 | Glo_EDI_BRP_like_20 This conserved domain belongs | 99.53 | |
| cd09014 | 166 | BphC-JF8_C_like C-terminal, catalytic, domain of B | 99.53 | |
| cd08347 | 157 | PcpA_C_like C-terminal domain of Sphingobium chlor | 99.53 | |
| cd07239 | 144 | BphC5-RK37_C_like C-terminal, catalytic, domain of | 99.53 | |
| cd09011 | 120 | Glo_EDI_BRP_like_23 This conserved domain belongs | 99.53 | |
| cd07242 | 128 | Glo_EDI_BRP_like_6 This conserved domain belongs t | 99.52 | |
| cd07264 | 125 | Glo_EDI_BRP_like_15 This conserved domain belongs | 99.52 | |
| cd08349 | 112 | BLMA_like Bleomycin binding protein (BLMA) and sim | 99.51 | |
| cd09013 | 121 | BphC-JF8_N_like N-terminal, non-catalytic, domain | 99.51 | |
| cd06587 | 112 | Glo_EDI_BRP_like This domain superfamily is found | 99.51 | |
| cd07246 | 122 | Glo_EDI_BRP_like_8 This conserved domain belongs t | 99.5 | |
| cd08363 | 131 | FosB FosB, a fosfomycin resistance protein, cataly | 99.5 | |
| cd07266 | 121 | HPCD_N_class_II N-terminal domain of 3,4-dihydroxy | 99.5 | |
| COG3185 | 363 | 4-hydroxyphenylpyruvate dioxygenase and related he | 99.5 | |
| COG3324 | 127 | Predicted enzyme related to lactoylglutathione lya | 99.5 | |
| cd08361 | 124 | PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma | 99.49 | |
| cd07261 | 114 | Glo_EDI_BRP_like_11 This conserved domain belongs | 99.49 | |
| cd08351 | 123 | ChaP_like ChaP, an enzyme involved in the biosynth | 99.49 | |
| cd07252 | 120 | BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro | 99.49 | |
| cd08364 | 131 | FosX FosX, a fosfomycin resistance protein, cataly | 99.48 | |
| cd09012 | 124 | Glo_EDI_BRP_like_24 This conserved domain belongs | 99.48 | |
| KOG2944 | 170 | consensus Glyoxalase [Carbohydrate transport and m | 99.48 | |
| COG3324 | 127 | Predicted enzyme related to lactoylglutathione lya | 99.47 | |
| cd08349 | 112 | BLMA_like Bleomycin binding protein (BLMA) and sim | 99.47 | |
| cd08359 | 119 | Glo_EDI_BRP_like_22 This conserved domain belongs | 99.47 | |
| cd08348 | 134 | BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro | 99.47 | |
| cd08350 | 120 | BLMT_like BLMT, a bleomycin resistance protein enc | 99.46 | |
| cd07235 | 122 | MRD Mitomycin C resistance protein (MRD). Mitomyci | 99.46 | |
| KOG2943 | 299 | consensus Predicted glyoxalase [Carbohydrate trans | 99.45 | |
| cd07255 | 125 | Glo_EDI_BRP_like_12 This conserved domain belongs | 99.45 | |
| cd07238 | 112 | Glo_EDI_BRP_like_5 This conserved domain belongs t | 99.45 | |
| PF12681 | 108 | Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B | 99.44 | |
| cd08362 | 120 | BphC5-RrK37_N_like N-terminal, non-catalytic, doma | 99.43 | |
| cd08345 | 113 | Fosfomycin_RP Fosfomycin resistant protein; inhibi | 99.43 | |
| cd07240 | 117 | ED_TypeI_classII_N N-terminal domain of type I, cl | 99.43 | |
| cd08350 | 120 | BLMT_like BLMT, a bleomycin resistance protein enc | 99.43 | |
| cd06587 | 112 | Glo_EDI_BRP_like This domain superfamily is found | 99.43 | |
| cd08354 | 122 | Glo_EDI_BRP_like_13 This conserved domain belongs | 99.42 | |
| KOG2944 | 170 | consensus Glyoxalase [Carbohydrate transport and m | 99.42 | |
| cd09012 | 124 | Glo_EDI_BRP_like_24 This conserved domain belongs | 99.42 | |
| PF13669 | 109 | Glyoxalase_4: Glyoxalase/Bleomycin resistance prot | 99.41 | |
| cd07262 | 123 | Glo_EDI_BRP_like_19 This conserved domain belongs | 99.41 | |
| cd08356 | 113 | Glo_EDI_BRP_like_17 This conserved domain belongs | 99.41 | |
| cd07267 | 113 | THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr | 99.41 | |
| cd07261 | 114 | Glo_EDI_BRP_like_11 This conserved domain belongs | 99.41 | |
| cd07244 | 121 | FosA FosA, a Fosfomycin resistance protein, cataly | 99.41 | |
| cd07254 | 120 | Glo_EDI_BRP_like_20 This conserved domain belongs | 99.41 | |
| cd07235 | 122 | MRD Mitomycin C resistance protein (MRD). Mitomyci | 99.4 | |
| cd07251 | 121 | Glo_EDI_BRP_like_10 This conserved domain belongs | 99.37 | |
| cd08357 | 125 | Glo_EDI_BRP_like_18 This conserved domain belongs | 99.36 | |
| cd08344 | 112 | MhqB_like_N N-terminal domain of MhqB, a type I ex | 99.34 | |
| cd07251 | 121 | Glo_EDI_BRP_like_10 This conserved domain belongs | 99.31 | |
| PF13669 | 109 | Glyoxalase_4: Glyoxalase/Bleomycin resistance prot | 99.31 | |
| cd08356 | 113 | Glo_EDI_BRP_like_17 This conserved domain belongs | 99.3 | |
| cd07250 | 191 | HPPD_C_like C-terminal domain of 4-hydroxyphenylpy | 99.16 | |
| COG3565 | 138 | Predicted dioxygenase of extradiol dioxygenase fam | 99.08 | |
| cd07250 | 191 | HPPD_C_like C-terminal domain of 4-hydroxyphenylpy | 99.05 | |
| TIGR01263 | 353 | 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr | 98.9 | |
| COG0346 | 138 | GloA Lactoylglutathione lyase and related lyases [ | 98.9 | |
| PF14506 | 125 | CppA_N: CppA N-terminal; PDB: 3E0R_D. | 98.87 | |
| cd06588 | 128 | PhnB_like Escherichia coli PhnB and similar protei | 98.87 | |
| cd06588 | 128 | PhnB_like Escherichia coli PhnB and similar protei | 98.83 | |
| COG2764 | 136 | PhnB Uncharacterized protein conserved in bacteria | 98.83 | |
| PF13468 | 175 | Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. | 98.82 | |
| COG3607 | 133 | Predicted lactoylglutathione lyase [General functi | 98.82 | |
| COG2764 | 136 | PhnB Uncharacterized protein conserved in bacteria | 98.77 | |
| COG3565 | 138 | Predicted dioxygenase of extradiol dioxygenase fam | 98.7 | |
| COG0346 | 138 | GloA Lactoylglutathione lyase and related lyases [ | 98.65 | |
| COG3607 | 133 | Predicted lactoylglutathione lyase [General functi | 98.63 | |
| PLN02875 | 398 | 4-hydroxyphenylpyruvate dioxygenase | 98.63 | |
| PRK01037 | 357 | trmD tRNA (guanine-N(1)-)-methyltransferase/unknow | 98.47 | |
| KOG0638 | 381 | consensus 4-hydroxyphenylpyruvate dioxygenase [Ami | 98.27 | |
| PRK01037 | 357 | trmD tRNA (guanine-N(1)-)-methyltransferase/unknow | 98.15 | |
| PRK10148 | 147 | hypothetical protein; Provisional | 98.07 | |
| COG3185 | 363 | 4-hydroxyphenylpyruvate dioxygenase and related he | 97.97 | |
| PF14696 | 139 | Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, H | 97.95 | |
| PRK10148 | 147 | hypothetical protein; Provisional | 97.8 | |
| PF14506 | 125 | CppA_N: CppA N-terminal; PDB: 3E0R_D. | 97.71 | |
| PF13468 | 175 | Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. | 97.39 | |
| PF14696 | 139 | Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, H | 97.38 | |
| PF06983 | 116 | 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltrans | 96.2 | |
| PF14507 | 101 | CppA_C: CppA C-terminal; PDB: 3E0R_D. | 95.54 | |
| PF15067 | 236 | FAM124: FAM124 family | 94.9 | |
| PF14507 | 101 | CppA_C: CppA C-terminal; PDB: 3E0R_D. | 94.38 | |
| PF06983 | 116 | 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltrans | 94.29 | |
| PF15067 | 236 | FAM124: FAM124 family | 93.07 |
| >PLN02300 lactoylglutathione lyase | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.7e-44 Score=334.16 Aligned_cols=281 Identities=87% Similarity=1.448 Sum_probs=236.0
Q ss_pred ccccCcccccccccccceeeEEEEEEeCChhHHHHHHHHhcCCEEEEEeecCCCceEEEEEeeCCCCceEEEEEEecCCC
Q 017144 96 SNTVTEQNVLDWVKSDKRRMLHVVYRVGDLDKTIKFYTECLGMKLLRKRDIPEDRYTNAFLGYGPEDSHFVVELTYNYGV 175 (376)
Q Consensus 96 ~~~~~p~~~~~~~~~~~~~i~Hv~l~v~Dl~~a~~FY~~vLG~~~~~~~~~~~~~~~~~~l~~g~~~~~~~l~l~~~~~~ 175 (376)
+..+..+.+.+|.++.+.+|.||.|.|+|++++++||+++|||++..+...++..+..+|+.+++...++.+++....+.
T Consensus 6 ~~~~~~~~~~~~~~~~i~~l~Hv~l~V~Dle~s~~FY~~vLG~~~~~~~~~~~~~~~~~~l~~g~~~~~~~lel~~~~~~ 85 (286)
T PLN02300 6 STAAEAEDLLEWPKKDKRRMLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSNFVVELTYNYGV 85 (286)
T ss_pred ccChhhhhhhcCCccccceEEEEEEEeCCHHHHHHHHHHhcCCEEEEeeecCCCcEEEEEEccCCCCCceEEEEeccCCC
Confidence 33445667899998999999999999999999999999999999987665555556677887766555677888765444
Q ss_pred CCCCCCCCceEEEEEeCCHHHHHHHHHHcCCeeecCCeecCCCCeEEEEEEcCCCCEEEEeecCCCCCCccccccccCCh
Q 017144 176 DKYDIGTGFGHFGIAVEDVAKTVDLVKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDL 255 (376)
Q Consensus 176 ~~~~~~~g~~hi~f~V~d~d~~~~rl~~~G~~i~~~p~~~~~~~~~~~~~~DPdG~~iel~~~~~~~~~~~~v~L~v~D~ 255 (376)
..+..+.|+.|++|.|+|+++++++++++|+++...|...++++.+.+||+||||+.|||++..+.+.++.|+.|.|+|+
T Consensus 86 ~~~~~~~g~~hia~~v~dvd~~~~~l~~~G~~i~~~~~~~~~g~~~~~~~~DPdG~~iEl~~~~~~~~~~~~~~l~~~d~ 165 (286)
T PLN02300 86 DKYDIGTGFGHFGIAVEDVAKTVELVKAKGGKVTREPGPVKGGKSVIAFVKDPDGYKFELIQRGPTPEPLCQVMLRVGDL 165 (286)
T ss_pred CccccCCCccEEEEEeCCHHHHHHHHHHCCCeeecCCcccCCCceEEEEEECCCCCEEEEEeCCCCCCcceeEEEEeCCH
Confidence 44445678999999999999999999999999988887776656678899999999999999999999999999999999
Q ss_pred hHHHHHHHHhhCCEEeceecCCCCCeEEEEeecCCCCCceEEEEcccCCCccccCCCceeEEEEEeCCHHHHHHHHHHcC
Q 017144 256 DRAINFYKKAFGMELLRKRDNPDYKYTIAVMGYGPEDKNAVLELTYNHGVTEYDKGNGYAQIAIGTDDVYKTAEAIKLSG 335 (376)
Q Consensus 256 ~~a~~FY~~~lG~~~~~~~~~~~~~~~~~~l~~~~~~~~~~l~l~~~~~~~~~~~g~g~~hiaf~V~Dl~~~~~~l~~~G 335 (376)
+++.+||+++|||++......++.++.+.++..++......+++..+.+...+..+++.+|++|.|+|+++++++++++|
T Consensus 166 ~~a~~Fy~~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lel~~~~~~~~~~~g~~~~~i~~~v~di~~~~~~~~~~G 245 (286)
T PLN02300 166 DRSIKFYEKAFGMKLLRKRDNPEYKYTIAMMGYGPEDKTTVLELTYNYGVTEYTKGNAYAQIAIGTDDVYKTAEAIKLVG 245 (286)
T ss_pred HHHHHHHHhccCCEEEeeecccccceEEEEEecCCCCCccEEEEeecCCCCccccCCceeEEEEecCCHHHHHHHHHHcC
Confidence 99999999999999986555555567777776544334556777665554445668899999999999999999999999
Q ss_pred CeeecCCccCCCCCceEEEEECCCCCeEEEEeccccccccC
Q 017144 336 GKITREPGPLPGINTKITACLDPDGWKSVFVDNLDFLKELE 376 (376)
Q Consensus 336 ~~~~~~p~~~~~~~~~~~~~~DPdG~~iel~~~~~~~~~~~ 376 (376)
++++.+|...|+.+.+.++|+||||+.++|+++++|+||||
T Consensus 246 ~~v~~~p~~~p~~~~~~~~~~DPdG~~i~~~~~~~~~~~~~ 286 (286)
T PLN02300 246 GKITREPGPLPGINTKITACLDPDGWKTVFVDNIDFLKELE 286 (286)
T ss_pred CeEecCCccCCCCceEEEEEECCCCCEEEEEccchhhhhcC
Confidence 99999988888655588999999999999999999999997
|
|
| >KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase | Back alignment and domain information |
|---|
| >TIGR03211 catechol_2_3 catechol 2,3 dioxygenase | Back alignment and domain information |
|---|
| >TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | Back alignment and domain information |
|---|
| >TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00068 glyox_I lactoylglutathione lyase | Back alignment and domain information |
|---|
| >PLN02367 lactoylglutathione lyase | Back alignment and domain information |
|---|
| >PLN02367 lactoylglutathione lyase | Back alignment and domain information |
|---|
| >PRK10291 glyoxalase I; Provisional | Back alignment and domain information |
|---|
| >PRK10291 glyoxalase I; Provisional | Back alignment and domain information |
|---|
| >PLN02875 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >PLN03042 Lactoylglutathione lyase; Provisional | Back alignment and domain information |
|---|
| >cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase | Back alignment and domain information |
|---|
| >cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR00068 glyox_I lactoylglutathione lyase | Back alignment and domain information |
|---|
| >cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione | Back alignment and domain information |
|---|
| >PLN03042 Lactoylglutathione lyase; Provisional | Back alignment and domain information |
|---|
| >COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08360 MhqB_like_C C-terminal domain of Burkholderia sp | Back alignment and domain information |
|---|
| >PRK11478 putative lyase; Provisional | Back alignment and domain information |
|---|
| >cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway | Back alignment and domain information |
|---|
| >cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase | Back alignment and domain information |
|---|
| >PLN02300 lactoylglutathione lyase | Back alignment and domain information |
|---|
| >cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PRK04101 fosfomycin resistance protein FosB; Provisional | Back alignment and domain information |
|---|
| >TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase | Back alignment and domain information |
|---|
| >cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione | Back alignment and domain information |
|---|
| >TIGR03645 glyox_marine lactoylglutathione lyase family protein | Back alignment and domain information |
|---|
| >TIGR03211 catechol_2_3 catechol 2,3 dioxygenase | Back alignment and domain information |
|---|
| >cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) | Back alignment and domain information |
|---|
| >cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases | Back alignment and domain information |
|---|
| >cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp | Back alignment and domain information |
|---|
| >cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway | Back alignment and domain information |
|---|
| >cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases | Back alignment and domain information |
|---|
| >cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp | Back alignment and domain information |
|---|
| >cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) | Back alignment and domain information |
|---|
| >TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase | Back alignment and domain information |
|---|
| >cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin | Back alignment and domain information |
|---|
| >cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein | Back alignment and domain information |
|---|
| >cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins | Back alignment and domain information |
|---|
| >TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase | Back alignment and domain information |
|---|
| >cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 | Back alignment and domain information |
|---|
| >PRK11478 putative lyase; Provisional | Back alignment and domain information |
|---|
| >cd08360 MhqB_like_C C-terminal domain of Burkholderia sp | Back alignment and domain information |
|---|
| >cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase | Back alignment and domain information |
|---|
| >cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain | Back alignment and domain information |
|---|
| >cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains | Back alignment and domain information |
|---|
| >cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >TIGR03645 glyox_marine lactoylglutathione lyase family protein | Back alignment and domain information |
|---|
| >cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins | Back alignment and domain information |
|---|
| >cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain | Back alignment and domain information |
|---|
| >cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase | Back alignment and domain information |
|---|
| >cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins | Back alignment and domain information |
|---|
| >cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) | Back alignment and domain information |
|---|
| >cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) | Back alignment and domain information |
|---|
| >TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase | Back alignment and domain information |
|---|
| >cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >PRK06724 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase | Back alignment and domain information |
|---|
| >cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains | Back alignment and domain information |
|---|
| >cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases | Back alignment and domain information |
|---|
| >cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive | Back alignment and domain information |
|---|
| >cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin | Back alignment and domain information |
|---|
| >cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins | Back alignment and domain information |
|---|
| >cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain | Back alignment and domain information |
|---|
| >cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A | Back alignment and domain information |
|---|
| >cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein | Back alignment and domain information |
|---|
| >cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PRK06724 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) | Back alignment and domain information |
|---|
| >cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PRK04101 fosfomycin resistance protein FosB; Provisional | Back alignment and domain information |
|---|
| >cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp | Back alignment and domain information |
|---|
| >cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins | Back alignment and domain information |
|---|
| >cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins | Back alignment and domain information |
|---|
| >cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm | Back alignment and domain information |
|---|
| >cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp | Back alignment and domain information |
|---|
| >cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins | Back alignment and domain information |
|---|
| >cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin | Back alignment and domain information |
|---|
| >cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases | Back alignment and domain information |
|---|
| >COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only] | Back alignment and domain information |
|---|
| >cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) | Back alignment and domain information |
|---|
| >cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins | Back alignment and domain information |
|---|
| >cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 | Back alignment and domain information |
|---|
| >cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only] | Back alignment and domain information |
|---|
| >cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm | Back alignment and domain information |
|---|
| >cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 | Back alignment and domain information |
|---|
| >cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins | Back alignment and domain information |
|---|
| >cd07235 MRD Mitomycin C resistance protein (MRD) | Back alignment and domain information |
|---|
| >KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A | Back alignment and domain information |
|---|
| >cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins | Back alignment and domain information |
|---|
| >cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin | Back alignment and domain information |
|---|
| >cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain | Back alignment and domain information |
|---|
| >cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins | Back alignment and domain information |
|---|
| >cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins | Back alignment and domain information |
|---|
| >cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A | Back alignment and domain information |
|---|
| >cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase | Back alignment and domain information |
|---|
| >cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive | Back alignment and domain information |
|---|
| >cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07235 MRD Mitomycin C resistance protein (MRD) | Back alignment and domain information |
|---|
| >cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins | Back alignment and domain information |
|---|
| >cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A | Back alignment and domain information |
|---|
| >cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases | Back alignment and domain information |
|---|
| >cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only] | Back alignment and domain information |
|---|
| >cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) | Back alignment and domain information |
|---|
| >TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF14506 CppA_N: CppA N-terminal; PDB: 3E0R_D | Back alignment and domain information |
|---|
| >cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E | Back alignment and domain information |
|---|
| >cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E | Back alignment and domain information |
|---|
| >COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B | Back alignment and domain information |
|---|
| >COG3607 Predicted lactoylglutathione lyase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only] | Back alignment and domain information |
|---|
| >COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3607 Predicted lactoylglutathione lyase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02875 4-hydroxyphenylpyruvate dioxygenase | Back alignment and domain information |
|---|
| >PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF14696 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal ; PDB: 1CJX_A 2R5V_A | Back alignment and domain information |
|---|
| >PRK10148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14506 CppA_N: CppA N-terminal; PDB: 3E0R_D | Back alignment and domain information |
|---|
| >PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B | Back alignment and domain information |
|---|
| >PF14696 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal ; PDB: 1CJX_A 2R5V_A | Back alignment and domain information |
|---|
| >PF06983 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A | Back alignment and domain information |
|---|
| >PF14507 CppA_C: CppA C-terminal; PDB: 3E0R_D | Back alignment and domain information |
|---|
| >PF15067 FAM124: FAM124 family | Back alignment and domain information |
|---|
| >PF14507 CppA_C: CppA C-terminal; PDB: 3E0R_D | Back alignment and domain information |
|---|
| >PF06983 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A | Back alignment and domain information |
|---|
| >PF15067 FAM124: FAM124 family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 376 | ||||
| 1f9z_A | 135 | Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I | 8e-41 | ||
| 1f9z_A | 135 | Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I | 1e-31 | ||
| 2c21_A | 144 | Specificity Of The Trypanothione-Dependednt Leishma | 5e-30 | ||
| 2c21_A | 144 | Specificity Of The Trypanothione-Dependednt Leishma | 2e-20 | ||
| 3zi1_A | 330 | Crystal Structure Of Human Glyoxalase Domain-contai | 1e-23 | ||
| 2za0_A | 184 | Crystal Structure Of Mouse Glyoxalase I Complexed W | 3e-13 | ||
| 2za0_A | 184 | Crystal Structure Of Mouse Glyoxalase I Complexed W | 7e-11 | ||
| 3vw9_A | 187 | Human Glyoxalase I With An N-Hydroxypyridone Inhibi | 7e-13 | ||
| 3vw9_A | 187 | Human Glyoxalase I With An N-Hydroxypyridone Inhibi | 4e-10 | ||
| 1fro_A | 183 | Human Glyoxalase I With Benzyl-Glutathione Inhibito | 7e-13 | ||
| 1fro_A | 183 | Human Glyoxalase I With Benzyl-Glutathione Inhibito | 6e-10 | ||
| 1bh5_A | 183 | Human Glyoxalase I Q33e, E172q Double Mutant Length | 2e-12 | ||
| 1bh5_A | 183 | Human Glyoxalase I Q33e, E172q Double Mutant Length | 2e-09 |
| >pdb|1F9Z|A Chain A, Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I From Escherichia Coli Length = 135 | Back alignment and structure |
|
| >pdb|1F9Z|A Chain A, Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I From Escherichia Coli Length = 135 | Back alignment and structure |
| >pdb|2C21|A Chain A, Specificity Of The Trypanothione-Dependednt Leishmania Major Glyoxalase I: Structure And Biochemical Comparison With The Human Enzyme Length = 144 | Back alignment and structure |
| >pdb|2C21|A Chain A, Specificity Of The Trypanothione-Dependednt Leishmania Major Glyoxalase I: Structure And Biochemical Comparison With The Human Enzyme Length = 144 | Back alignment and structure |
| >pdb|3ZI1|A Chain A, Crystal Structure Of Human Glyoxalase Domain-containing Protein 4 (glod4) Length = 330 | Back alignment and structure |
| >pdb|2ZA0|A Chain A, Crystal Structure Of Mouse Glyoxalase I Complexed With Methyl-Gerfelin Length = 184 | Back alignment and structure |
| >pdb|2ZA0|A Chain A, Crystal Structure Of Mouse Glyoxalase I Complexed With Methyl-Gerfelin Length = 184 | Back alignment and structure |
| >pdb|3VW9|A Chain A, Human Glyoxalase I With An N-Hydroxypyridone Inhibitor Length = 187 | Back alignment and structure |
| >pdb|3VW9|A Chain A, Human Glyoxalase I With An N-Hydroxypyridone Inhibitor Length = 187 | Back alignment and structure |
| >pdb|1FRO|A Chain A, Human Glyoxalase I With Benzyl-Glutathione Inhibitor Length = 183 | Back alignment and structure |
| >pdb|1FRO|A Chain A, Human Glyoxalase I With Benzyl-Glutathione Inhibitor Length = 183 | Back alignment and structure |
| >pdb|1BH5|A Chain A, Human Glyoxalase I Q33e, E172q Double Mutant Length = 183 | Back alignment and structure |
| >pdb|1BH5|A Chain A, Human Glyoxalase I Q33e, E172q Double Mutant Length = 183 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 376 | |||
| 2c21_A | 144 | Trypanothione-dependent glyoxalase I; lyase, gluta | 2e-63 | |
| 2c21_A | 144 | Trypanothione-dependent glyoxalase I; lyase, gluta | 6e-39 | |
| 1f9z_A | 135 | Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro | 6e-63 | |
| 1f9z_A | 135 | Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro | 4e-41 | |
| 2za0_A | 184 | Glyoxalase I; lyase, lactoylglutathione lyase, met | 3e-45 | |
| 2za0_A | 184 | Glyoxalase I; lyase, lactoylglutathione lyase, met | 5e-33 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 1e-39 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 1e-23 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 4e-04 | |
| 3oxh_A | 282 | RV0577 protein; kinase regulation, antibiotic resi | 4e-38 | |
| 3oxh_A | 282 | RV0577 protein; kinase regulation, antibiotic resi | 1e-12 | |
| 3oxh_A | 282 | RV0577 protein; kinase regulation, antibiotic resi | 2e-10 | |
| 3rmu_A | 134 | Methylmalonyl-COA epimerase, mitochondrial; struct | 3e-36 | |
| 3rmu_A | 134 | Methylmalonyl-COA epimerase, mitochondrial; struct | 5e-23 | |
| 3l7t_A | 134 | SMU.1112C, putative uncharacterized protein; metal | 2e-33 | |
| 3l7t_A | 134 | SMU.1112C, putative uncharacterized protein; metal | 5e-20 | |
| 2p25_A | 126 | Glyoxalase family protein; structural genomics, MC | 9e-33 | |
| 2p25_A | 126 | Glyoxalase family protein; structural genomics, MC | 6e-19 | |
| 3r6a_A | 144 | Uncharacterized protein; PSI biology, structural g | 5e-32 | |
| 3r6a_A | 144 | Uncharacterized protein; PSI biology, structural g | 9e-21 | |
| 3hdp_A | 133 | Glyoxalase-I; glutathione,lyase, methylglyoxal,110 | 9e-30 | |
| 3hdp_A | 133 | Glyoxalase-I; glutathione,lyase, methylglyoxal,110 | 3e-20 | |
| 3kol_A | 156 | Oxidoreductase, glyoxalase/bleomycin resistance pr | 4e-27 | |
| 3kol_A | 156 | Oxidoreductase, glyoxalase/bleomycin resistance pr | 6e-14 | |
| 4g6x_A | 155 | Glyoxalase/bleomycin resistance protein/dioxygena; | 8e-27 | |
| 4g6x_A | 155 | Glyoxalase/bleomycin resistance protein/dioxygena; | 1e-18 | |
| 3e5d_A | 127 | Putative glyoxalase I; structural genomics, joint | 6e-25 | |
| 3e5d_A | 127 | Putative glyoxalase I; structural genomics, joint | 1e-16 | |
| 1ss4_A | 153 | Glyoxalase family protein; structural genomics, PS | 8e-25 | |
| 1ss4_A | 153 | Glyoxalase family protein; structural genomics, PS | 6e-16 | |
| 2rk9_A | 145 | Glyoxalase/bleomycin resistance protein/dioxygena; | 1e-22 | |
| 2rk9_A | 145 | Glyoxalase/bleomycin resistance protein/dioxygena; | 5e-17 | |
| 3r4q_A | 160 | Lactoylglutathione lyase; structural genomics, PSI | 4e-21 | |
| 3r4q_A | 160 | Lactoylglutathione lyase; structural genomics, PSI | 3e-09 | |
| 2r6u_A | 148 | Uncharacterized protein; structural genomics, PSI- | 3e-20 | |
| 2r6u_A | 148 | Uncharacterized protein; structural genomics, PSI- | 2e-19 | |
| 1twu_A | 139 | Hypothetical protein YYCE; structural genomics, pr | 4e-20 | |
| 1twu_A | 139 | Hypothetical protein YYCE; structural genomics, pr | 4e-15 | |
| 2qqz_A | 126 | Glyoxalase family protein, putative; alpha-beta st | 8e-19 | |
| 2qqz_A | 126 | Glyoxalase family protein, putative; alpha-beta st | 5e-09 | |
| 3ghj_A | 141 | Putative integron gene cassette protein; integron | 2e-18 | |
| 3ghj_A | 141 | Putative integron gene cassette protein; integron | 1e-05 | |
| 1sp8_A | 418 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 1e-17 | |
| 3uh9_A | 145 | Metallothiol transferase FOSB 2; structural genomi | 1e-17 | |
| 3uh9_A | 145 | Metallothiol transferase FOSB 2; structural genomi | 4e-06 | |
| 1r9c_A | 139 | Glutathione transferase; fosfomycin resistance pro | 1e-17 | |
| 1r9c_A | 139 | Glutathione transferase; fosfomycin resistance pro | 5e-10 | |
| 3huh_A | 152 | Virulence protein STM3117; structural genomics, ny | 2e-17 | |
| 3huh_A | 152 | Virulence protein STM3117; structural genomics, ny | 7e-10 | |
| 3ct8_A | 146 | Protein BH2160, putative glyoxalase; NP_243026.1, | 2e-17 | |
| 3ct8_A | 146 | Protein BH2160, putative glyoxalase; NP_243026.1, | 8e-09 | |
| 1xqa_A | 113 | Glyoxalase/bleomycin resistance protein; dioxygena | 3e-17 | |
| 1xqa_A | 113 | Glyoxalase/bleomycin resistance protein; dioxygena | 2e-08 | |
| 2rk0_A | 136 | Glyoxalase/bleomycin resistance protein/dioxygena; | 2e-16 | |
| 2rk0_A | 136 | Glyoxalase/bleomycin resistance protein/dioxygena; | 4e-06 | |
| 1zsw_A | 338 | Metallo protein, glyoxalase family protein; hypoth | 2e-16 | |
| 1npb_A | 141 | Fosfomycin-resistance protein; manganese binding, | 5e-16 | |
| 1npb_A | 141 | Fosfomycin-resistance protein; manganese binding, | 9e-04 | |
| 2p7o_A | 133 | Glyoxalase family protein; fosfomycin resistance p | 1e-15 | |
| 2p7o_A | 133 | Glyoxalase family protein; fosfomycin resistance p | 7e-08 | |
| 1mpy_A | 307 | Catechol 2,3-dioxygenase; extradiol dioxygenase, n | 1e-15 | |
| 1mpy_A | 307 | Catechol 2,3-dioxygenase; extradiol dioxygenase, n | 1e-08 | |
| 3bqx_A | 150 | Glyoxalase-related enzyme; VOC superfamily, PSI-2, | 5e-15 | |
| 3bqx_A | 150 | Glyoxalase-related enzyme; VOC superfamily, PSI-2, | 1e-09 | |
| 3hpy_A | 309 | Catechol 2,3-dioxygenase; repeated motifs, aromati | 5e-15 | |
| 2qnt_A | 141 | AGR_C_3434P, uncharacterized protein ATU1872; glyo | 6e-15 | |
| 2qnt_A | 141 | AGR_C_3434P, uncharacterized protein ATU1872; glyo | 6e-13 | |
| 1jc4_A | 148 | Methylmalonyl-COA epimerase; vicinal oxygen chelat | 8e-15 | |
| 1jc4_A | 148 | Methylmalonyl-COA epimerase; vicinal oxygen chelat | 3e-06 | |
| 2rbb_A | 141 | Glyoxalase/bleomycin resistance protein/dioxygena; | 9e-15 | |
| 2rbb_A | 141 | Glyoxalase/bleomycin resistance protein/dioxygena; | 3e-11 | |
| 3g12_A | 128 | Putative lactoylglutathione lyase; glyoxalase, ble | 9e-15 | |
| 3g12_A | 128 | Putative lactoylglutathione lyase; glyoxalase, ble | 2e-10 | |
| 3rri_A | 135 | Glyoxalase/bleomycin resistance protein/dioxygena; | 1e-14 | |
| 3rri_A | 135 | Glyoxalase/bleomycin resistance protein/dioxygena; | 1e-06 | |
| 1nki_A | 135 | Probable fosfomycin resistance protein; potassium | 1e-14 | |
| 1nki_A | 135 | Probable fosfomycin resistance protein; potassium | 4e-04 | |
| 1f1u_A | 323 | Homoprotocatechuate 2,3-dioxygenase; extradiol, ma | 2e-14 | |
| 1f1u_A | 323 | Homoprotocatechuate 2,3-dioxygenase; extradiol, ma | 6e-06 | |
| 3eck_A | 365 | Protein (homoprotocatechuate 2,3-dioxygenase); oxi | 2e-14 | |
| 3eck_A | 365 | Protein (homoprotocatechuate 2,3-dioxygenase); oxi | 2e-04 | |
| 3lm4_A | 339 | Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein | 2e-14 | |
| 3b59_A | 310 | Glyoxalase/bleomycin resistance protein/dioxygena; | 1e-13 | |
| 3isq_A | 393 | 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta | 1e-13 | |
| 3pkv_A | 252 | Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox | 4e-13 | |
| 1lgt_A | 297 | Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy | 1e-12 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 1e-12 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 3e-07 | |
| 3zw5_A | 147 | Glyoxalase domain-containing protein 5; lyase; 1.6 | 2e-12 | |
| 3zw5_A | 147 | Glyoxalase domain-containing protein 5; lyase; 1.6 | 5e-05 | |
| 3ey7_A | 133 | Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot | 2e-12 | |
| 3ey7_A | 133 | Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot | 1e-05 | |
| 3itw_A | 137 | Protein TIOX; bleomycin resistance fold, bisinterc | 7e-12 | |
| 3itw_A | 137 | Protein TIOX; bleomycin resistance fold, bisinterc | 8e-10 | |
| 3m2o_A | 164 | Glyoxalase/bleomycin resistance protein; unknown f | 1e-11 | |
| 3m2o_A | 164 | Glyoxalase/bleomycin resistance protein; unknown f | 4e-09 | |
| 2pjs_A | 119 | AGR_C_3564P, uncharacterized protein ATU1953; glyo | 2e-11 | |
| 2pjs_A | 119 | AGR_C_3564P, uncharacterized protein ATU1953; glyo | 8e-09 | |
| 2a4x_A | 138 | Mitomycin-binding protein; ALFA/beta protein, mito | 2e-11 | |
| 2a4x_A | 138 | Mitomycin-binding protein; ALFA/beta protein, mito | 3e-07 | |
| 2i7r_A | 118 | Conserved domain protein; structural genomics cons | 2e-11 | |
| 2i7r_A | 118 | Conserved domain protein; structural genomics cons | 8e-10 | |
| 2zyq_A | 300 | Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e | 1e-10 | |
| 2zyq_A | 300 | Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e | 2e-07 | |
| 3gm5_A | 159 | Lactoylglutathione lyase and related lyases; sheet | 2e-10 | |
| 3gm5_A | 159 | Lactoylglutathione lyase and related lyases; sheet | 1e-05 | |
| 2wl9_A | 305 | Catechol 2,3-dioxygenase; aromatic hydrocarbons ca | 3e-10 | |
| 2wl9_A | 305 | Catechol 2,3-dioxygenase; aromatic hydrocarbons ca | 4e-07 | |
| 1kw3_B | 292 | 2,3-dihydroxybiphenyl dioxygenase; four TIME repet | 5e-10 | |
| 1kw3_B | 292 | 2,3-dihydroxybiphenyl dioxygenase; four TIME repet | 2e-07 | |
| 1sqd_A | 424 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 6e-10 | |
| 2ehz_A | 302 | 1,2-dihydroxynaphthalene dioxygenase; extradiol di | 6e-10 | |
| 2ehz_A | 302 | 1,2-dihydroxynaphthalene dioxygenase; extradiol di | 3e-05 | |
| 1t47_A | 381 | 4-hydroxyphenylpyruvate dioxygenase; triketone inh | 2e-09 | |
| 3rhe_A | 148 | NAD-dependent benzaldehyde dehydrogenase; structur | 5e-09 | |
| 3rhe_A | 148 | NAD-dependent benzaldehyde dehydrogenase; structur | 4e-06 | |
| 2kjz_A | 144 | ATC0852; protein of unknown function, dimer, struc | 8e-09 | |
| 2kjz_A | 144 | ATC0852; protein of unknown function, dimer, struc | 6e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 | |
| 3bt3_A | 148 | Glyoxalase-related enzyme, ARAC type; VOC superfam | 2e-07 | |
| 3bt3_A | 148 | Glyoxalase-related enzyme, ARAC type; VOC superfam | 9e-07 | |
| 3sk2_A | 132 | EHPR; antibiotic resistance, griseoluteate-binding | 4e-07 | |
| 3sk2_A | 132 | EHPR; antibiotic resistance, griseoluteate-binding | 5e-06 | |
| 3fcd_A | 134 | Lyase, ORF125EGC139; lactoylglutathione lyase, YEC | 6e-07 | |
| 3fcd_A | 134 | Lyase, ORF125EGC139; lactoylglutathione lyase, YEC | 2e-05 | |
| 1ecs_A | 126 | Bleomycin resistance protein; arm-exchange, antibi | 1e-06 | |
| 1ecs_A | 126 | Bleomycin resistance protein; arm-exchange, antibi | 1e-04 | |
| 2r5v_A | 357 | PCZA361.1; dioxygenase, non-heme iron, vancomycin, | 5e-06 | |
| 1xy7_A | 166 | Unknown protein; structural genomics, protein stru | 6e-06 | |
| 1xy7_A | 166 | Unknown protein; structural genomics, protein stru | 3e-05 | |
| 1cjx_A | 357 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 1e-05 | |
| 1qto_A | 122 | Bleomycin-binding protein; arm-exchange, antibioti | 2e-04 | |
| 1xrk_A | 124 | Bleomycin resistance protein; arm exchange, ligand | 8e-04 |
| >2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Length = 144 | Back alignment and structure |
|---|
Score = 198 bits (505), Expect = 2e-63
Identities = 70/143 (48%), Positives = 84/143 (58%), Gaps = 5/143 (3%)
Query: 112 KRRMLHVVYRVGDLDKTIKFYTECLGMKLLRKRDIPEDRYTNAFLGYGPEDSHFVVELTY 171
RRMLH + RVGDLD++IKFYTE LGMK+LRK D+PED+YT FLGYGPE S V+ELTY
Sbjct: 6 SRRMLHTMIRVGDLDRSIKFYTERLGMKVLRKWDVPEDKYTLVFLGYGPEMSSTVLELTY 65
Query: 172 NYGVDKYDIGTGFGHFGIAVEDVAKTVDLVKAKGGKVTREPGPVKGGNTVIAFIEDPDGY 231
NYGV Y +GH I VEDV + V ++ + E +AF+ DPDGY
Sbjct: 66 NYGVTSYKHDEAYGHIAIGVEDVKELVADMRKHDVPIDYEDES-----GFMAFVVDPDGY 120
Query: 232 KFELLERGPTPEPLCQVMLRVGD 254
ELL E M G
Sbjct: 121 YIELLNEKTMMEKAEADMKEQGT 143
|
| >2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Length = 144 | Back alignment and structure |
|---|
| >1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Length = 135 | Back alignment and structure |
|---|
| >1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Length = 135 | Back alignment and structure |
|---|
| >2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Length = 184 | Back alignment and structure |
|---|
| >2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Length = 184 | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Length = 161 | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Length = 161 | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Length = 161 | Back alignment and structure |
|---|
| >3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Length = 282 | Back alignment and structure |
|---|
| >3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Length = 282 | Back alignment and structure |
|---|
| >3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Length = 282 | Back alignment and structure |
|---|
| >3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Length = 134 | Back alignment and structure |
|---|
| >3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Length = 134 | Back alignment and structure |
|---|
| >2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Length = 126 | Back alignment and structure |
|---|
| >2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Length = 126 | Back alignment and structure |
|---|
| >3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Length = 144 | Back alignment and structure |
|---|
| >3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Length = 144 | Back alignment and structure |
|---|
| >3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Length = 133 | Back alignment and structure |
|---|
| >3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Length = 133 | Back alignment and structure |
|---|
| >3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Length = 156 | Back alignment and structure |
|---|
| >3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Length = 156 | Back alignment and structure |
|---|
| >4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Length = 155 | Back alignment and structure |
|---|
| >4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Length = 155 | Back alignment and structure |
|---|
| >3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Length = 127 | Back alignment and structure |
|---|
| >3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Length = 127 | Back alignment and structure |
|---|
| >1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Length = 153 | Back alignment and structure |
|---|
| >1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Length = 153 | Back alignment and structure |
|---|
| >2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Length = 145 | Back alignment and structure |
|---|
| >2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Length = 145 | Back alignment and structure |
|---|
| >3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Length = 160 | Back alignment and structure |
|---|
| >3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Length = 160 | Back alignment and structure |
|---|
| >2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Length = 148 | Back alignment and structure |
|---|
| >2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Length = 148 | Back alignment and structure |
|---|
| >1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Length = 139 | Back alignment and structure |
|---|
| >1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Length = 139 | Back alignment and structure |
|---|
| >2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Length = 126 | Back alignment and structure |
|---|
| >2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Length = 126 | Back alignment and structure |
|---|
| >3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Length = 141 | Back alignment and structure |
|---|
| >3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Length = 141 | Back alignment and structure |
|---|
| >1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Length = 418 | Back alignment and structure |
|---|
| >1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Length = 139 | Back alignment and structure |
|---|
| >1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Length = 139 | Back alignment and structure |
|---|
| >3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygenase, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Length = 152 | Back alignment and structure |
|---|
| >3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygenase, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Length = 152 | Back alignment and structure |
|---|
| >3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Length = 146 | Back alignment and structure |
|---|
| >3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Length = 146 | Back alignment and structure |
|---|
| >1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Length = 113 | Back alignment and structure |
|---|
| >1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Length = 113 | Back alignment and structure |
|---|
| >2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Length = 136 | Back alignment and structure |
|---|
| >2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Length = 136 | Back alignment and structure |
|---|
| >1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Length = 338 | Back alignment and structure |
|---|
| >1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Length = 141 | Back alignment and structure |
|---|
| >1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Length = 141 | Back alignment and structure |
|---|
| >2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Length = 133 | Back alignment and structure |
|---|
| >2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Length = 133 | Back alignment and structure |
|---|
| >1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Length = 307 | Back alignment and structure |
|---|
| >1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Length = 307 | Back alignment and structure |
|---|
| >3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Length = 150 | Back alignment and structure |
|---|
| >3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Length = 150 | Back alignment and structure |
|---|
| >3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Length = 309 | Back alignment and structure |
|---|
| >2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Length = 141 | Back alignment and structure |
|---|
| >2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Length = 141 | Back alignment and structure |
|---|
| >1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Length = 148 | Back alignment and structure |
|---|
| >1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Length = 148 | Back alignment and structure |
|---|
| >2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Length = 141 | Back alignment and structure |
|---|
| >2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Length = 141 | Back alignment and structure |
|---|
| >3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Length = 128 | Back alignment and structure |
|---|
| >3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Length = 128 | Back alignment and structure |
|---|
| >3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Length = 135 | Back alignment and structure |
|---|
| >3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Length = 135 | Back alignment and structure |
|---|
| >1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Length = 135 | Back alignment and structure |
|---|
| >1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Length = 135 | Back alignment and structure |
|---|
| >1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Length = 323 | Back alignment and structure |
|---|
| >1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Length = 323 | Back alignment and structure |
|---|
| >3eck_A Protein (homoprotocatechuate 2,3-dioxygenase); oxidoreductase, extradiol, FEII, crystal packing; HET: XXG; 1.60A {Brevibacterium fuscum} SCOP: d.32.1.3 d.32.1.3 PDB: 3ecj_A* 3ojn_A* 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* Length = 365 | Back alignment and structure |
|---|
| >3eck_A Protein (homoprotocatechuate 2,3-dioxygenase); oxidoreductase, extradiol, FEII, crystal packing; HET: XXG; 1.60A {Brevibacterium fuscum} SCOP: d.32.1.3 d.32.1.3 PDB: 3ecj_A* 3ojn_A* 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* Length = 365 | Back alignment and structure |
|---|
| >3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Length = 339 | Back alignment and structure |
|---|
| >3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Length = 310 | Back alignment and structure |
|---|
| >3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Length = 393 | Back alignment and structure |
|---|
| >3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Length = 252 | Back alignment and structure |
|---|
| >1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Length = 297 | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Length = 335 | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Length = 335 | Back alignment and structure |
|---|
| >3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Length = 133 | Back alignment and structure |
|---|
| >3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Length = 133 | Back alignment and structure |
|---|
| >3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Length = 137 | Back alignment and structure |
|---|
| >3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Length = 137 | Back alignment and structure |
|---|
| >2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Length = 119 | Back alignment and structure |
|---|
| >2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Length = 119 | Back alignment and structure |
|---|
| >2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Length = 138 | Back alignment and structure |
|---|
| >2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Length = 138 | Back alignment and structure |
|---|
| >2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Length = 118 | Back alignment and structure |
|---|
| >2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Length = 118 | Back alignment and structure |
|---|
| >2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Length = 300 | Back alignment and structure |
|---|
| >2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Length = 300 | Back alignment and structure |
|---|
| >3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Length = 159 | Back alignment and structure |
|---|
| >3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Length = 159 | Back alignment and structure |
|---|
| >2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Length = 305 | Back alignment and structure |
|---|
| >2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Length = 305 | Back alignment and structure |
|---|
| >1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Length = 292 | Back alignment and structure |
|---|
| >1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Length = 292 | Back alignment and structure |
|---|
| >1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Length = 424 | Back alignment and structure |
|---|
| >2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Length = 302 | Back alignment and structure |
|---|
| >2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Length = 302 | Back alignment and structure |
|---|
| >1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Length = 381 | Back alignment and structure |
|---|
| >3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Length = 148 | Back alignment and structure |
|---|
| >3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Length = 148 | Back alignment and structure |
|---|
| >2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Length = 144 | Back alignment and structure |
|---|
| >2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Length = 144 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Length = 148 | Back alignment and structure |
|---|
| >3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Length = 148 | Back alignment and structure |
|---|
| >3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Length = 132 | Back alignment and structure |
|---|
| >3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Length = 132 | Back alignment and structure |
|---|
| >3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} Length = 134 | Back alignment and structure |
|---|
| >3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} Length = 134 | Back alignment and structure |
|---|
| >1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Length = 126 | Back alignment and structure |
|---|
| >1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Length = 126 | Back alignment and structure |
|---|
| >2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Length = 357 | Back alignment and structure |
|---|
| >1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A Length = 166 | Back alignment and structure |
|---|
| >1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A Length = 166 | Back alignment and structure |
|---|
| >1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 Length = 357 | Back alignment and structure |
|---|
| >1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A Length = 122 | Back alignment and structure |
|---|
| >1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Length = 124 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 376 | |||
| 3zi1_A | 330 | Glyoxalase domain-containing protein 4; isomerase; | 100.0 | |
| 3lm4_A | 339 | Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein | 100.0 | |
| 3hpy_A | 309 | Catechol 2,3-dioxygenase; repeated motifs, aromati | 100.0 | |
| 1f1u_A | 323 | Homoprotocatechuate 2,3-dioxygenase; extradiol, ma | 100.0 | |
| 4ghg_A | 365 | Homoprotocatechuate 2,3-dioxygenase; oxygen activa | 100.0 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 100.0 | |
| 3b59_A | 310 | Glyoxalase/bleomycin resistance protein/dioxygena; | 100.0 | |
| 1mpy_A | 307 | Catechol 2,3-dioxygenase; extradiol dioxygenase, n | 99.98 | |
| 2zyq_A | 300 | Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e | 99.98 | |
| 3oxh_A | 282 | RV0577 protein; kinase regulation, antibiotic resi | 99.98 | |
| 1kw3_B | 292 | 2,3-dihydroxybiphenyl dioxygenase; four TIME repet | 99.97 | |
| 2wl9_A | 305 | Catechol 2,3-dioxygenase; aromatic hydrocarbons ca | 99.97 | |
| 1lgt_A | 297 | Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy | 99.97 | |
| 1zsw_A | 338 | Metallo protein, glyoxalase family protein; hypoth | 99.97 | |
| 2ehz_A | 302 | 1,2-dihydroxynaphthalene dioxygenase; extradiol di | 99.97 | |
| 2r5v_A | 357 | PCZA361.1; dioxygenase, non-heme iron, vancomycin, | 99.96 | |
| 1t47_A | 381 | 4-hydroxyphenylpyruvate dioxygenase; triketone inh | 99.94 | |
| 1sqd_A | 424 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.93 | |
| 1sp8_A | 418 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.92 | |
| 3isq_A | 393 | 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta | 99.91 | |
| 1cjx_A | 357 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.9 | |
| 1f9z_A | 135 | Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro | 99.85 | |
| 4g6x_A | 155 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.81 | |
| 1f9z_A | 135 | Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro | 99.79 | |
| 3l7t_A | 134 | SMU.1112C, putative uncharacterized protein; metal | 99.79 | |
| 3rmu_A | 134 | Methylmalonyl-COA epimerase, mitochondrial; struct | 99.79 | |
| 3pkv_A | 252 | Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox | 99.79 | |
| 2c21_A | 144 | Trypanothione-dependent glyoxalase I; lyase, gluta | 99.79 | |
| 4hc5_A | 133 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.79 | |
| 3hdp_A | 133 | Glyoxalase-I; glutathione,lyase, methylglyoxal,110 | 99.78 | |
| 3e5d_A | 127 | Putative glyoxalase I; structural genomics, joint | 99.78 | |
| 3lm4_A | 339 | Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein | 99.76 | |
| 3uh9_A | 145 | Metallothiol transferase FOSB 2; structural genomi | 99.76 | |
| 3vw9_A | 187 | Lactoylglutathione lyase; glyoxalase, lyase-lyase | 99.76 | |
| 2p25_A | 126 | Glyoxalase family protein; structural genomics, MC | 99.76 | |
| 3huh_A | 152 | Virulence protein STM3117; structural genomics, ny | 99.75 | |
| 2rk0_A | 136 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.75 | |
| 3ey7_A | 133 | Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot | 99.75 | |
| 1ss4_A | 153 | Glyoxalase family protein; structural genomics, PS | 99.75 | |
| 4g6x_A | 155 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.75 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 99.74 | |
| 3hpy_A | 309 | Catechol 2,3-dioxygenase; repeated motifs, aromati | 99.74 | |
| 1jc4_A | 148 | Methylmalonyl-COA epimerase; vicinal oxygen chelat | 99.74 | |
| 3vw9_A | 187 | Lactoylglutathione lyase; glyoxalase, lyase-lyase | 99.74 | |
| 1mpy_A | 307 | Catechol 2,3-dioxygenase; extradiol dioxygenase, n | 99.74 | |
| 1twu_A | 139 | Hypothetical protein YYCE; structural genomics, pr | 99.72 | |
| 1f1u_A | 323 | Homoprotocatechuate 2,3-dioxygenase; extradiol, ma | 99.72 | |
| 3ghj_A | 141 | Putative integron gene cassette protein; integron | 99.72 | |
| 2qqz_A | 126 | Glyoxalase family protein, putative; alpha-beta st | 99.72 | |
| 3kol_A | 156 | Oxidoreductase, glyoxalase/bleomycin resistance pr | 99.72 | |
| 3rmu_A | 134 | Methylmalonyl-COA epimerase, mitochondrial; struct | 99.72 | |
| 2c21_A | 144 | Trypanothione-dependent glyoxalase I; lyase, gluta | 99.71 | |
| 2p7o_A | 133 | Glyoxalase family protein; fosfomycin resistance p | 99.71 | |
| 2zyq_A | 300 | Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e | 99.71 | |
| 1r9c_A | 139 | Glutathione transferase; fosfomycin resistance pro | 99.71 | |
| 3gm5_A | 159 | Lactoylglutathione lyase and related lyases; sheet | 99.71 | |
| 3e5d_A | 127 | Putative glyoxalase I; structural genomics, joint | 99.71 | |
| 2i7r_A | 118 | Conserved domain protein; structural genomics cons | 99.71 | |
| 3l7t_A | 134 | SMU.1112C, putative uncharacterized protein; metal | 99.71 | |
| 3b59_A | 310 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.7 | |
| 3sk2_A | 132 | EHPR; antibiotic resistance, griseoluteate-binding | 99.7 | |
| 4hc5_A | 133 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.7 | |
| 2za0_A | 184 | Glyoxalase I; lyase, lactoylglutathione lyase, met | 99.7 | |
| 1nki_A | 135 | Probable fosfomycin resistance protein; potassium | 99.7 | |
| 3hdp_A | 133 | Glyoxalase-I; glutathione,lyase, methylglyoxal,110 | 99.7 | |
| 3oaj_A | 335 | Putative ring-cleaving dioxygenase MHQO; structura | 99.7 | |
| 3rhe_A | 148 | NAD-dependent benzaldehyde dehydrogenase; structur | 99.69 | |
| 1npb_A | 141 | Fosfomycin-resistance protein; manganese binding, | 99.69 | |
| 2pjs_A | 119 | AGR_C_3564P, uncharacterized protein ATU1953; glyo | 99.68 | |
| 3e0r_A | 244 | C3-degrading proteinase (CPPA protein); MCSG, PSI, | 99.68 | |
| 3zw5_A | 147 | Glyoxalase domain-containing protein 5; lyase; 1.6 | 99.68 | |
| 1xrk_A | 124 | Bleomycin resistance protein; arm exchange, ligand | 99.68 | |
| 2kjz_A | 144 | ATC0852; protein of unknown function, dimer, struc | 99.68 | |
| 1kw3_B | 292 | 2,3-dihydroxybiphenyl dioxygenase; four TIME repet | 99.68 | |
| 3zi1_A | 330 | Glyoxalase domain-containing protein 4; isomerase; | 99.67 | |
| 3bqx_A | 150 | Glyoxalase-related enzyme; VOC superfamily, PSI-2, | 99.67 | |
| 3rri_A | 135 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.67 | |
| 4ghg_A | 365 | Homoprotocatechuate 2,3-dioxygenase; oxygen activa | 99.67 | |
| 3oa4_A | 161 | Glyoxalase, BH1468 protein; structural genomics, p | 99.66 | |
| 1lgt_A | 297 | Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy | 99.66 | |
| 2p25_A | 126 | Glyoxalase family protein; structural genomics, MC | 99.66 | |
| 2r6u_A | 148 | Uncharacterized protein; structural genomics, PSI- | 99.66 | |
| 1xqa_A | 113 | Glyoxalase/bleomycin resistance protein; dioxygena | 99.66 | |
| 3g12_A | 128 | Putative lactoylglutathione lyase; glyoxalase, ble | 99.66 | |
| 3ct8_A | 146 | Protein BH2160, putative glyoxalase; NP_243026.1, | 99.66 | |
| 3r6a_A | 144 | Uncharacterized protein; PSI biology, structural g | 99.66 | |
| 2za0_A | 184 | Glyoxalase I; lyase, lactoylglutathione lyase, met | 99.66 | |
| 1jc4_A | 148 | Methylmalonyl-COA epimerase; vicinal oxygen chelat | 99.66 | |
| 3gm5_A | 159 | Lactoylglutathione lyase and related lyases; sheet | 99.66 | |
| 2rk0_A | 136 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.65 | |
| 3r4q_A | 160 | Lactoylglutathione lyase; structural genomics, PSI | 99.65 | |
| 3itw_A | 137 | Protein TIOX; bleomycin resistance fold, bisinterc | 99.65 | |
| 1ss4_A | 153 | Glyoxalase family protein; structural genomics, PS | 99.64 | |
| 3kol_A | 156 | Oxidoreductase, glyoxalase/bleomycin resistance pr | 99.64 | |
| 2wl9_A | 305 | Catechol 2,3-dioxygenase; aromatic hydrocarbons ca | 99.64 | |
| 2a4x_A | 138 | Mitomycin-binding protein; ALFA/beta protein, mito | 99.64 | |
| 3uh9_A | 145 | Metallothiol transferase FOSB 2; structural genomi | 99.63 | |
| 3ey7_A | 133 | Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot | 99.63 | |
| 1qto_A | 122 | Bleomycin-binding protein; arm-exchange, antibioti | 99.63 | |
| 3m2o_A | 164 | Glyoxalase/bleomycin resistance protein; unknown f | 99.63 | |
| 3fcd_A | 134 | Lyase, ORF125EGC139; lactoylglutathione lyase, YEC | 99.62 | |
| 2ehz_A | 302 | 1,2-dihydroxynaphthalene dioxygenase; extradiol di | 99.62 | |
| 3g12_A | 128 | Putative lactoylglutathione lyase; glyoxalase, ble | 99.62 | |
| 3itw_A | 137 | Protein TIOX; bleomycin resistance fold, bisinterc | 99.61 | |
| 1ecs_A | 126 | Bleomycin resistance protein; arm-exchange, antibi | 99.61 | |
| 1zsw_A | 338 | Metallo protein, glyoxalase family protein; hypoth | 99.6 | |
| 3sk2_A | 132 | EHPR; antibiotic resistance, griseoluteate-binding | 99.6 | |
| 3huh_A | 152 | Virulence protein STM3117; structural genomics, ny | 99.6 | |
| 2rbb_A | 141 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.6 | |
| 2i7r_A | 118 | Conserved domain protein; structural genomics cons | 99.6 | |
| 3ghj_A | 141 | Putative integron gene cassette protein; integron | 99.6 | |
| 2p7o_A | 133 | Glyoxalase family protein; fosfomycin resistance p | 99.6 | |
| 2qnt_A | 141 | AGR_C_3434P, uncharacterized protein ATU1872; glyo | 99.59 | |
| 4gym_A | 149 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.59 | |
| 2kjz_A | 144 | ATC0852; protein of unknown function, dimer, struc | 99.59 | |
| 3r6a_A | 144 | Uncharacterized protein; PSI biology, structural g | 99.59 | |
| 2qqz_A | 126 | Glyoxalase family protein, putative; alpha-beta st | 99.59 | |
| 1twu_A | 139 | Hypothetical protein YYCE; structural genomics, pr | 99.58 | |
| 3bqx_A | 150 | Glyoxalase-related enzyme; VOC superfamily, PSI-2, | 99.57 | |
| 1r9c_A | 139 | Glutathione transferase; fosfomycin resistance pro | 99.57 | |
| 1xrk_A | 124 | Bleomycin resistance protein; arm exchange, ligand | 99.57 | |
| 2pjs_A | 119 | AGR_C_3564P, uncharacterized protein ATU1953; glyo | 99.56 | |
| 3r4q_A | 160 | Lactoylglutathione lyase; structural genomics, PSI | 99.56 | |
| 3rhe_A | 148 | NAD-dependent benzaldehyde dehydrogenase; structur | 99.56 | |
| 2rk9_A | 145 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.55 | |
| 3ct8_A | 146 | Protein BH2160, putative glyoxalase; NP_243026.1, | 99.55 | |
| 1qto_A | 122 | Bleomycin-binding protein; arm-exchange, antibioti | 99.54 | |
| 1ecs_A | 126 | Bleomycin resistance protein; arm-exchange, antibi | 99.54 | |
| 2rbb_A | 141 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.54 | |
| 2a4x_A | 138 | Mitomycin-binding protein; ALFA/beta protein, mito | 99.54 | |
| 2r6u_A | 148 | Uncharacterized protein; structural genomics, PSI- | 99.53 | |
| 3fcd_A | 134 | Lyase, ORF125EGC139; lactoylglutathione lyase, YEC | 99.53 | |
| 1nki_A | 135 | Probable fosfomycin resistance protein; potassium | 99.53 | |
| 1xqa_A | 113 | Glyoxalase/bleomycin resistance protein; dioxygena | 99.52 | |
| 3bt3_A | 148 | Glyoxalase-related enzyme, ARAC type; VOC superfam | 99.52 | |
| 3zw5_A | 147 | Glyoxalase domain-containing protein 5; lyase; 1.6 | 99.51 | |
| 3oxh_A | 282 | RV0577 protein; kinase regulation, antibiotic resi | 99.51 | |
| 3rri_A | 135 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.51 | |
| 4gym_A | 149 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.51 | |
| 1npb_A | 141 | Fosfomycin-resistance protein; manganese binding, | 99.51 | |
| 3m2o_A | 164 | Glyoxalase/bleomycin resistance protein; unknown f | 99.51 | |
| 2qnt_A | 141 | AGR_C_3434P, uncharacterized protein ATU1872; glyo | 99.5 | |
| 3bt3_A | 148 | Glyoxalase-related enzyme, ARAC type; VOC superfam | 99.47 | |
| 2rk9_A | 145 | Glyoxalase/bleomycin resistance protein/dioxygena; | 99.47 | |
| 1xy7_A | 166 | Unknown protein; structural genomics, protein stru | 99.4 | |
| 2r5v_A | 357 | PCZA361.1; dioxygenase, non-heme iron, vancomycin, | 99.4 | |
| 1u6l_A | 149 | Hypothetical protein; structural genomics, PSI, pr | 99.37 | |
| 1xy7_A | 166 | Unknown protein; structural genomics, protein stru | 99.37 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 99.34 | |
| 1u7i_A | 136 | Hypothetical protein; structural genomics, PA1358, | 99.31 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 99.26 | |
| 1u6l_A | 149 | Hypothetical protein; structural genomics, PSI, pr | 99.25 | |
| 3pkv_A | 252 | Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox | 99.22 | |
| 1u7i_A | 136 | Hypothetical protein; structural genomics, PA1358, | 99.21 | |
| 1t47_A | 381 | 4-hydroxyphenylpyruvate dioxygenase; triketone inh | 99.17 | |
| 1sqd_A | 424 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.08 | |
| 1tsj_A | 139 | Conserved hypothetical protein; structural genomic | 99.07 | |
| 1cjx_A | 357 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 99.06 | |
| 3isq_A | 393 | 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta | 99.0 | |
| 3l20_A | 172 | Putative uncharacterized protein; hypothetical pro | 98.99 | |
| 3oms_A | 138 | PHNB protein; structural genomics, PSI-2, protein | 98.97 | |
| 3oms_A | 138 | PHNB protein; structural genomics, PSI-2, protein | 98.96 | |
| 1sp8_A | 418 | 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas | 98.92 | |
| 1tsj_A | 139 | Conserved hypothetical protein; structural genomic | 98.92 | |
| 3l20_A | 172 | Putative uncharacterized protein; hypothetical pro | 98.85 | |
| 3p8a_A | 274 | Uncharacterized protein; mainly antiparallel beta | 98.45 | |
| 3e0r_A | 244 | C3-degrading proteinase (CPPA protein); MCSG, PSI, | 98.23 | |
| 1u69_A | 163 | Hypothetical protein; structural genomics, MSCG, p | 98.12 | |
| 1u69_A | 163 | Hypothetical protein; structural genomics, MSCG, p | 97.66 | |
| 3opy_B | 941 | 6-phosphofructo-1-kinase beta-subunit; ATP binding | 97.14 | |
| 3opy_B | 941 | 6-phosphofructo-1-kinase beta-subunit; ATP binding | 96.91 | |
| 3opy_A | 989 | 6-phosphofructo-1-kinase alpha-subunit; ATP bindin | 84.04 | |
| 3p8a_A | 274 | Uncharacterized protein; mainly antiparallel beta | 81.61 |
| >3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=5.1e-34 Score=271.13 Aligned_cols=248 Identities=31% Similarity=0.585 Sum_probs=195.6
Q ss_pred cccccceeeEEEEEEeCChhHHHHHHHHhcCCEEEEEeecC-----------CCceEEEEEeeCCCCceEEEEEEecCCC
Q 017144 107 WVKSDKRRMLHVVYRVGDLDKTIKFYTECLGMKLLRKRDIP-----------EDRYTNAFLGYGPEDSHFVVELTYNYGV 175 (376)
Q Consensus 107 ~~~~~~~~i~Hv~l~v~Dl~~a~~FY~~vLG~~~~~~~~~~-----------~~~~~~~~l~~g~~~~~~~l~l~~~~~~ 175 (376)
+.+|+.++|.||+|.|+|++++++||+++|||++..+...+ ++.+..+++.+++......+++....+.
T Consensus 20 ~~~M~~~~i~Hv~l~V~Dle~s~~FY~~vLGl~~~~~~~~~~~~~a~~~g~~~~~~~~~~l~~~~~~~~~~leL~~~~~~ 99 (330)
T 3zi1_A 20 FQSMAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGV 99 (330)
T ss_dssp GGGCSCCEEEEEEEECSCHHHHHHHHHHTSCCEEEEEEEEC---------CCCSCEEEEEEESSCTTTCCEEEEEEETTC
T ss_pred eeecccceeeEEEEEeCCHHHHHHHHHHhcCCeEEEEeecchhhhhhccCCcCCceEEEEEecCCCCCccEEEEeccCCC
Confidence 34566789999999999999999999999999998877655 4456678888876656778888876655
Q ss_pred CCCCCCCCceEEEEEeCCHHHHHHHHHHcCCeeecCCeecCCCCeEEEEEEcCCCCEEEEeecCC-CCCCccccccccCC
Q 017144 176 DKYDIGTGFGHFGIAVEDVAKTVDLVKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGP-TPEPLCQVMLRVGD 254 (376)
Q Consensus 176 ~~~~~~~g~~hi~f~V~d~d~~~~rl~~~G~~i~~~p~~~~~~~~~~~~~~DPdG~~iel~~~~~-~~~~~~~v~L~v~D 254 (376)
..+..+.|+.|++|.|+|+ .++++++|+++...| . ..+||+||||+.|||++... .+.++.|+.|.|.|
T Consensus 100 ~~~~~~~g~~hiaf~V~d~---~~~l~~~G~~~~~~~----~---~~~~~~DPdG~~iel~~~~~~~~~~i~hv~L~v~D 169 (330)
T 3zi1_A 100 GDYKLGNDFMGITLASSQA---VSNARKLEWPLTEVA----E---GVFETEAPGGYKFYLQNRSLPQSDPVLKVTLAVSD 169 (330)
T ss_dssp CCCCBCSSEEEEEEECHHH---HHHHHHHTCCCEEEE----T---TEEEEECTTSCEEEEESSCCTTSCSEEEEEEEESC
T ss_pred CccccCCCeeEEEEECchH---HHHHHHcCCceeccC----C---ceEEEECCCCCEEEEEecCCCCCCceeEEEEECCC
Confidence 5566677999999999987 667888999987543 1 27889999999999998764 46789999999999
Q ss_pred hhHHHHHHHHhhCCEEeceecCCCCCeEEEEeecCCCCCceEEEEcccCCCccccCCCceeEEEEEeC--CHHHHHHHHH
Q 017144 255 LDRAINFYKKAFGMELLRKRDNPDYKYTIAVMGYGPEDKNAVLELTYNHGVTEYDKGNGYAQIAIGTD--DVYKTAEAIK 332 (376)
Q Consensus 255 ~~~a~~FY~~~lG~~~~~~~~~~~~~~~~~~l~~~~~~~~~~l~l~~~~~~~~~~~g~g~~hiaf~V~--Dl~~~~~~l~ 332 (376)
++++.+||+++|||++.......+ ..++..++. ...+++....+ ....+.+++|++|.|+ |+++++++|+
T Consensus 170 l~~a~~FY~~vLG~~~~~~~~~~~----~~~l~~g~~--~~~l~l~~~~~--~~~~~~~~~hiaf~v~~~dld~~~~rl~ 241 (330)
T 3zi1_A 170 LQKSLNYWCNLLGMKIYENDEEKQ----RALLGYADN--QCKLELQGVKG--GVDHAAAFGRIAFSCPQKELPDLEDLMK 241 (330)
T ss_dssp HHHHHHHHHHTTCCEEEEEETTTT----EEEEESSTT--SCEEEEEECSS--CCCCBTTCCEEEEEECGGGHHHHHHHHH
T ss_pred HHHHHHHHHHhcCCEEEeeccCCc----EEEEEeCCc--eEEEEECCCCC--CCCCCCCCceEEEEEEcccHHHHHHHHH
Confidence 999999999999999987654332 244555432 45666654432 2334567889999995 7999999999
Q ss_pred HcCCeeecCCccC--CC-CCceEEEEECCCCCeEEEEeccccc
Q 017144 333 LSGGKITREPGPL--PG-INTKITACLDPDGWKSVFVDNLDFL 372 (376)
Q Consensus 333 ~~G~~~~~~p~~~--~~-~~~~~~~~~DPdG~~iel~~~~~~~ 372 (376)
++|+++..++.+. ++ ...+++||+|||||.|||++..+|.
T Consensus 242 ~~G~~i~~~~~~~~~pg~~g~~~~~f~DPdG~~iEl~~~~~~~ 284 (330)
T 3zi1_A 242 RENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFR 284 (330)
T ss_dssp HTTCEEEEEEEEECCTTSCCEEEEEEECTTCCEEEEEEHHHHH
T ss_pred HcCCcEecCceecccCCCCceEEEEEECCCCCEEEEEEecccc
Confidence 9999988776542 21 1248999999999999999998765
|
| >3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* | Back alignment and structure |
|---|
| >1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A | Back alignment and structure |
|---|
| >4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* | Back alignment and structure |
|---|
| >3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* | Back alignment and structure |
|---|
| >2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A | Back alignment and structure |
|---|
| >1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* | Back alignment and structure |
|---|
| >1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 | Back alignment and structure |
|---|
| >2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A | Back alignment and structure |
|---|
| >2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} | Back alignment and structure |
|---|
| >1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A | Back alignment and structure |
|---|
| >1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* | Back alignment and structure |
|---|
| >1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A | Back alignment and structure |
|---|
| >4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} | Back alignment and structure |
|---|
| >1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A | Back alignment and structure |
|---|
| >3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* | Back alignment and structure |
|---|
| >2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 | Back alignment and structure |
|---|
| >4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A | Back alignment and structure |
|---|
| >3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* | Back alignment and structure |
|---|
| >2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A | Back alignment and structure |
|---|
| >2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} | Back alignment and structure |
|---|
| >3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* | Back alignment and structure |
|---|
| >1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 | Back alignment and structure |
|---|
| >4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* | Back alignment and structure |
|---|
| >1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A | Back alignment and structure |
|---|
| >3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* | Back alignment and structure |
|---|
| >1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 | Back alignment and structure |
|---|
| >1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A | Back alignment and structure |
|---|
| >3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} | Back alignment and structure |
|---|
| >2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} | Back alignment and structure |
|---|
| >3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 | Back alignment and structure |
|---|
| >2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A | Back alignment and structure |
|---|
| >2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* | Back alignment and structure |
|---|
| >1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* | Back alignment and structure |
|---|
| >4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* | Back alignment and structure |
|---|
| >1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A | Back alignment and structure |
|---|
| >3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A | Back alignment and structure |
|---|
| >3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} | Back alignment and structure |
|---|
| >1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A | Back alignment and structure |
|---|
| >2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* | Back alignment and structure |
|---|
| >3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} | Back alignment and structure |
|---|
| >3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* | Back alignment and structure |
|---|
| >3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* | Back alignment and structure |
|---|
| >2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} | Back alignment and structure |
|---|
| >3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* | Back alignment and structure |
|---|
| >1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A | Back alignment and structure |
|---|
| >3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} | Back alignment and structure |
|---|
| >3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} | Back alignment and structure |
|---|
| >1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 | Back alignment and structure |
|---|
| >3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} | Back alignment and structure |
|---|
| >2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A | Back alignment and structure |
|---|
| >2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* | Back alignment and structure |
|---|
| >3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* | Back alignment and structure |
|---|
| >1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A | Back alignment and structure |
|---|
| >3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A | Back alignment and structure |
|---|
| >3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} | Back alignment and structure |
|---|
| >3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} | Back alignment and structure |
|---|
| >1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A | Back alignment and structure |
|---|
| >1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 | Back alignment and structure |
|---|
| >3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* | Back alignment and structure |
|---|
| >3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A | Back alignment and structure |
|---|
| >2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} | Back alignment and structure |
|---|
| >2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} | Back alignment and structure |
|---|
| >2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A | Back alignment and structure |
|---|
| >2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} | Back alignment and structure |
|---|
| >2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 | Back alignment and structure |
|---|
| >3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} | Back alignment and structure |
|---|
| >1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A | Back alignment and structure |
|---|
| >2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} | Back alignment and structure |
|---|
| >2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} | Back alignment and structure |
|---|
| >3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A | Back alignment and structure |
|---|
| >1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A | Back alignment and structure |
|---|
| >2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} | Back alignment and structure |
|---|
| >2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* | Back alignment and structure |
|---|
| >2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A | Back alignment and structure |
|---|
| >1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} | Back alignment and structure |
|---|
| >3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} | Back alignment and structure |
|---|
| >1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 | Back alignment and structure |
|---|
| >2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} | Back alignment and structure |
|---|
| >2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} | Back alignment and structure |
|---|
| >1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A | Back alignment and structure |
|---|
| >2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} | Back alignment and structure |
|---|
| >1u6l_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.81A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >1u7i_A Hypothetical protein; structural genomics, PA1358, PSI, PROT structure initiative; HET: MSE; 1.40A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >1u6l_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.81A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* | Back alignment and structure |
|---|
| >1u7i_A Hypothetical protein; structural genomics, PA1358, PSI, PROT structure initiative; HET: MSE; 1.40A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A | Back alignment and structure |
|---|
| >1tsj_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, nysgxrc; 2.60A {Staphylococcus aureus subsp} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* | Back alignment and structure |
|---|
| >3l20_A Putative uncharacterized protein; hypothetical protein, unknown function; 2.45A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3oms_A PHNB protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, methyltransferase, GL family; 1.90A {Bacillus cereus} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >3oms_A PHNB protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, methyltransferase, GL family; 1.90A {Bacillus cereus} SCOP: d.32.1.0 | Back alignment and structure |
|---|
| >1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 | Back alignment and structure |
|---|
| >1tsj_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, nysgxrc; 2.60A {Staphylococcus aureus subsp} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >3l20_A Putative uncharacterized protein; hypothetical protein, unknown function; 2.45A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1u69_A Hypothetical protein; structural genomics, MSCG, pseudomonas aeruginosa PAO1, HYPO protein, protein structure initiative (PSI); 1.60A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >1u69_A Hypothetical protein; structural genomics, MSCG, pseudomonas aeruginosa PAO1, HYPO protein, protein structure initiative (PSI); 1.60A {Pseudomonas aeruginosa} SCOP: d.32.1.7 | Back alignment and structure |
|---|
| >3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} | Back alignment and structure |
|---|
| >3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} | Back alignment and structure |
|---|
| >3opy_A 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} | Back alignment and structure |
|---|
| >3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 376 | ||||
| d1f9za_ | 135 | d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya | 3e-29 | |
| d1f9za_ | 135 | d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya | 3e-20 | |
| d2c21a1 | 139 | d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathion | 2e-26 | |
| d2c21a1 | 139 | d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathion | 1e-16 | |
| d1qipa_ | 176 | d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya | 2e-24 | |
| d1qipa_ | 176 | d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya | 2e-14 | |
| d1twua_ | 137 | d.32.1.8 (A:) Hypothetical protein YycE {Bacillus | 2e-18 | |
| d1twua_ | 137 | d.32.1.8 (A:) Hypothetical protein YycE {Bacillus | 3e-14 | |
| d1zswa1 | 144 | d.32.1.10 (A:1-144) Hypothetical protein BC1024 {B | 1e-17 | |
| d1zswa1 | 144 | d.32.1.10 (A:1-144) Hypothetical protein BC1024 {B | 9e-08 | |
| d1sp8a1 | 172 | d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxyg | 1e-17 | |
| d1sp8a1 | 172 | d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxyg | 9e-10 | |
| d1sqda1 | 167 | d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxyg | 6e-17 | |
| d1sqda1 | 167 | d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxyg | 2e-09 | |
| d1sqia1 | 149 | d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxyge | 9e-17 | |
| d1sqia1 | 149 | d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxyge | 1e-07 | |
| d1mpya2 | 162 | d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (met | 4e-16 | |
| d1mpya2 | 162 | d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (met | 2e-06 | |
| d1jc4a_ | 145 | d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propion | 8e-16 | |
| d1jc4a_ | 145 | d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propion | 1e-06 | |
| d1r9ca_ | 130 | d.32.1.2 (A:) Fosfomycin resistance protein FosX { | 1e-15 | |
| d1r9ca_ | 130 | d.32.1.2 (A:) Fosfomycin resistance protein FosX { | 1e-09 | |
| d1ss4a_ | 149 | d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillu | 3e-15 | |
| d1ss4a_ | 149 | d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillu | 1e-08 | |
| d1t47a1 | 163 | d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxyg | 4e-15 | |
| d1t47a1 | 163 | d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxyg | 2e-08 | |
| d1f1ua1 | 146 | d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxyge | 4e-14 | |
| d1f1ua1 | 146 | d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxyge | 8e-06 | |
| d1mpya1 | 145 | d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metap | 7e-14 | |
| d1mpya1 | 145 | d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metap | 1e-07 | |
| d1f1ua2 | 176 | d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxy | 7e-14 | |
| d1f1ua2 | 176 | d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxy | 3e-06 | |
| d1nkia_ | 134 | d.32.1.2 (A:) Fosfomycin resistance protein A (Fos | 2e-11 | |
| d1nkia_ | 134 | d.32.1.2 (A:) Fosfomycin resistance protein A (Fos | 2e-05 | |
| d1npba_ | 140 | d.32.1.2 (A:) Fosfomycin resistance protein A (Fos | 2e-11 | |
| d1npba_ | 140 | d.32.1.2 (A:) Fosfomycin resistance protein A (Fos | 1e-05 | |
| d1zswa2 | 170 | d.32.1.10 (A:145-314) Hypothetical protein BC1024 | 4e-11 | |
| d2pjsa1 | 111 | d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 | 5e-11 | |
| d2pjsa1 | 111 | d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 | 2e-04 | |
| d1lgta1 | 131 | d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygena | 5e-11 | |
| d1lgta1 | 131 | d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygena | 1e-04 | |
| d1xqaa_ | 113 | d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillu | 3e-10 | |
| d1xqaa_ | 113 | d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillu | 2e-04 | |
| d1klla_ | 128 | d.32.1.2 (A:) Mitomycin resistance protein D, MRD | 4e-10 | |
| d1klla_ | 128 | d.32.1.2 (A:) Mitomycin resistance protein D, MRD | 0.001 | |
| d1cjxa2 | 203 | d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxy | 5e-10 | |
| d1cjxa2 | 203 | d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxy | 6e-06 | |
| d1kw3b1 | 132 | d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygena | 1e-09 | |
| d1kw3b2 | 156 | d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxyge | 2e-09 | |
| d1xrka_ | 120 | d.32.1.2 (A:) Bleomycin resistance protein, BRP {S | 1e-08 | |
| d1xrka_ | 120 | d.32.1.2 (A:) Bleomycin resistance protein, BRP {S | 2e-05 | |
| d2i7ra1 | 115 | d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Str | 2e-08 | |
| d2i7ra1 | 115 | d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Str | 1e-05 | |
| d1sp8a2 | 224 | d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxy | 3e-08 | |
| d1sp8a2 | 224 | d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxy | 6e-07 | |
| d1cjxa1 | 150 | d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxyge | 7e-07 | |
| d1ecsa_ | 120 | d.32.1.2 (A:) Bleomycin resistance protein, BRP {K | 8e-07 | |
| d1t47a2 | 199 | d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxy | 1e-06 | |
| d1t47a2 | 199 | d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxy | 7e-05 | |
| d1sqia2 | 210 | d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxy | 2e-06 | |
| d1sqia2 | 210 | d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxy | 6e-06 | |
| d1xy7a_ | 135 | d.32.1.9 (A:) Hypothetical protein At5g48480 {Thal | 2e-06 | |
| d1xy7a_ | 135 | d.32.1.9 (A:) Hypothetical protein At5g48480 {Thal | 9e-06 | |
| d1jifa_ | 122 | d.32.1.2 (A:) Bleomycin resistance protein, BRP {S | 6e-06 | |
| d1jifa_ | 122 | d.32.1.2 (A:) Bleomycin resistance protein, BRP {S | 3e-04 | |
| d1u6la_ | 137 | d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudom | 6e-05 | |
| d1u6la_ | 137 | d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudom | 3e-04 | |
| d1sqda2 | 230 | d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxy | 3e-04 | |
| d1sqda2 | 230 | d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxy | 4e-04 |
| >d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Length = 135 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase family: Glyoxalase I (lactoylglutathione lyase) domain: Glyoxalase I (lactoylglutathione lyase) species: Escherichia coli [TaxId: 562]
Score = 107 bits (268), Expect = 3e-29
Identities = 74/132 (56%), Positives = 98/132 (74%)
Query: 114 RMLHVVYRVGDLDKTIKFYTECLGMKLLRKRDIPEDRYTNAFLGYGPEDSHFVVELTYNY 173
R+LH + RVGDL ++I FYT+ LGMKLLR + PE +Y+ AF+GYGPE V+ELTYN+
Sbjct: 2 RLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNW 61
Query: 174 GVDKYDIGTGFGHFGIAVEDVAKTVDLVKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKF 233
GVDKY++GT +GH ++V++ A+ + ++ GG VTRE GPVKGG TVIAF+EDPDGYK
Sbjct: 62 GVDKYELGTAYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKI 121
Query: 234 ELLERGPTPEPL 245
EL+E L
Sbjct: 122 ELIEEKDAGRGL 133
|
| >d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Length = 135 | Back information, alignment and structure |
|---|
| >d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Length = 139 | Back information, alignment and structure |
|---|
| >d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Length = 139 | Back information, alignment and structure |
|---|
| >d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Length = 137 | Back information, alignment and structure |
|---|
| >d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Length = 137 | Back information, alignment and structure |
|---|
| >d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 144 | Back information, alignment and structure |
|---|
| >d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 144 | Back information, alignment and structure |
|---|
| >d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 172 | Back information, alignment and structure |
|---|
| >d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 172 | Back information, alignment and structure |
|---|
| >d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 167 | Back information, alignment and structure |
|---|
| >d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 167 | Back information, alignment and structure |
|---|
| >d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 162 | Back information, alignment and structure |
|---|
| >d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 162 | Back information, alignment and structure |
|---|
| >d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Length = 145 | Back information, alignment and structure |
|---|
| >d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Length = 145 | Back information, alignment and structure |
|---|
| >d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Length = 130 | Back information, alignment and structure |
|---|
| >d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Length = 130 | Back information, alignment and structure |
|---|
| >d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Length = 149 | Back information, alignment and structure |
|---|
| >d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Length = 149 | Back information, alignment and structure |
|---|
| >d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 163 | Back information, alignment and structure |
|---|
| >d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 163 | Back information, alignment and structure |
|---|
| >d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 146 | Back information, alignment and structure |
|---|
| >d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 146 | Back information, alignment and structure |
|---|
| >d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 145 | Back information, alignment and structure |
|---|
| >d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 145 | Back information, alignment and structure |
|---|
| >d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 176 | Back information, alignment and structure |
|---|
| >d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 176 | Back information, alignment and structure |
|---|
| >d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 | Back information, alignment and structure |
|---|
| >d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 | Back information, alignment and structure |
|---|
| >d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Length = 140 | Back information, alignment and structure |
|---|
| >d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Length = 140 | Back information, alignment and structure |
|---|
| >d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 170 | Back information, alignment and structure |
|---|
| >d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Length = 111 | Back information, alignment and structure |
|---|
| >d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Length = 111 | Back information, alignment and structure |
|---|
| >d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Length = 131 | Back information, alignment and structure |
|---|
| >d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Length = 131 | Back information, alignment and structure |
|---|
| >d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Length = 113 | Back information, alignment and structure |
|---|
| >d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Length = 113 | Back information, alignment and structure |
|---|
| >d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Length = 128 | Back information, alignment and structure |
|---|
| >d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Length = 128 | Back information, alignment and structure |
|---|
| >d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Length = 203 | Back information, alignment and structure |
|---|
| >d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Length = 203 | Back information, alignment and structure |
|---|
| >d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Length = 132 | Back information, alignment and structure |
|---|
| >d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Length = 156 | Back information, alignment and structure |
|---|
| >d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Length = 120 | Back information, alignment and structure |
|---|
| >d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Length = 120 | Back information, alignment and structure |
|---|
| >d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 | Back information, alignment and structure |
|---|
| >d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 | Back information, alignment and structure |
|---|
| >d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 224 | Back information, alignment and structure |
|---|
| >d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 224 | Back information, alignment and structure |
|---|
| >d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Length = 150 | Back information, alignment and structure |
|---|
| >d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Length = 120 | Back information, alignment and structure |
|---|
| >d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 199 | Back information, alignment and structure |
|---|
| >d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 199 | Back information, alignment and structure |
|---|
| >d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Length = 210 | Back information, alignment and structure |
|---|
| >d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Length = 210 | Back information, alignment and structure |
|---|
| >d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 135 | Back information, alignment and structure |
|---|
| >d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 135 | Back information, alignment and structure |
|---|
| >d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Length = 122 | Back information, alignment and structure |
|---|
| >d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Length = 122 | Back information, alignment and structure |
|---|
| >d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} Length = 137 | Back information, alignment and structure |
|---|
| >d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} Length = 137 | Back information, alignment and structure |
|---|
| >d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 230 | Back information, alignment and structure |
|---|
| >d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 230 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 376 | |||
| d1f9za_ | 135 | Glyoxalase I (lactoylglutathione lyase) {Escherich | 99.81 | |
| d1mpya2 | 162 | Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu | 99.78 | |
| d1ss4a_ | 149 | Hypothetical protein BC1747 {Bacillus cereus (stra | 99.77 | |
| d1zswa1 | 144 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 99.77 | |
| d2i7ra1 | 115 | Hypotheical protein SP0731 {Streptococcus pneumoni | 99.77 | |
| d1f9za_ | 135 | Glyoxalase I (lactoylglutathione lyase) {Escherich | 99.75 | |
| d1lgta1 | 131 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.74 | |
| d1f1ua1 | 146 | Homoprotocatechuate 2,3-dioxygenase {Arthrobacter | 99.74 | |
| d1zswa2 | 170 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 99.74 | |
| d1kw3b1 | 132 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.73 | |
| d1r9ca_ | 130 | Fosfomycin resistance protein FosX {Mesorhizobium | 99.73 | |
| d1jc4a_ | 145 | Methylmalonyl-CoA epimerase {Propionibacterium she | 99.72 | |
| d1xqaa_ | 113 | Hypothetical protein BC3580 {Bacillus cereus [TaxI | 99.72 | |
| d1qipa_ | 176 | Glyoxalase I (lactoylglutathione lyase) {Human (Ho | 99.71 | |
| d1f1ua2 | 176 | Homoprotocatechuate 2,3-dioxygenase {Arthrobacter | 99.7 | |
| d1ss4a_ | 149 | Hypothetical protein BC1747 {Bacillus cereus (stra | 99.69 | |
| d1npba_ | 140 | Fosfomycin resistance protein A (FosA) {Serratia m | 99.69 | |
| d1twua_ | 137 | Hypothetical protein YycE {Bacillus subtilis [TaxI | 99.69 | |
| d2i7ra1 | 115 | Hypotheical protein SP0731 {Streptococcus pneumoni | 99.68 | |
| d1kw3b2 | 156 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.68 | |
| d1mpya1 | 145 | Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu | 99.68 | |
| d2c21a1 | 139 | Glyoxalase I (lactoylglutathione lyase) {Leishmani | 99.68 | |
| d1mpya2 | 162 | Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu | 99.67 | |
| d1nkia_ | 134 | Fosfomycin resistance protein A (FosA) {Pseudomona | 99.67 | |
| d1qipa_ | 176 | Glyoxalase I (lactoylglutathione lyase) {Human (Ho | 99.67 | |
| d1zswa1 | 144 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 99.66 | |
| d1twua_ | 137 | Hypothetical protein YycE {Bacillus subtilis [TaxI | 99.66 | |
| d1sqia1 | 149 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 99.66 | |
| d1jc4a_ | 145 | Methylmalonyl-CoA epimerase {Propionibacterium she | 99.65 | |
| d1t47a1 | 163 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto | 99.64 | |
| d2pjsa1 | 111 | Uncharacterized protein Atu1953 {Agrobacterium tum | 99.64 | |
| d1sqda1 | 167 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 99.63 | |
| d1klla_ | 128 | Mitomycin resistance protein D, MRD {Streptomyces | 99.61 | |
| d1zswa2 | 170 | Hypothetical protein BC1024 {Bacillus cereus [TaxI | 99.6 | |
| d2c21a1 | 139 | Glyoxalase I (lactoylglutathione lyase) {Leishmani | 99.6 | |
| d1sp8a1 | 172 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 99.6 | |
| d1f1ua2 | 176 | Homoprotocatechuate 2,3-dioxygenase {Arthrobacter | 99.59 | |
| d1sqia1 | 149 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 99.57 | |
| d1f1ua1 | 146 | Homoprotocatechuate 2,3-dioxygenase {Arthrobacter | 99.57 | |
| d1kw3b2 | 156 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.56 | |
| d1r9ca_ | 130 | Fosfomycin resistance protein FosX {Mesorhizobium | 99.56 | |
| d1mpya1 | 145 | Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu | 99.56 | |
| d1klla_ | 128 | Mitomycin resistance protein D, MRD {Streptomyces | 99.56 | |
| d2pjsa1 | 111 | Uncharacterized protein Atu1953 {Agrobacterium tum | 99.55 | |
| d1xqaa_ | 113 | Hypothetical protein BC3580 {Bacillus cereus [TaxI | 99.55 | |
| d1lgta1 | 131 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.54 | |
| d1sqda1 | 167 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 99.52 | |
| d1t47a1 | 163 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto | 99.51 | |
| d1kw3b1 | 132 | 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy | 99.51 | |
| d1nkia_ | 134 | Fosfomycin resistance protein A (FosA) {Pseudomona | 99.5 | |
| d1sp8a1 | 172 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 99.47 | |
| d1npba_ | 140 | Fosfomycin resistance protein A (FosA) {Serratia m | 99.47 | |
| d1ecsa_ | 120 | Bleomycin resistance protein, BRP {Klebsiella pneu | 99.46 | |
| d1jifa_ | 122 | Bleomycin resistance protein, BRP {Streptomyces ve | 99.45 | |
| d1ecsa_ | 120 | Bleomycin resistance protein, BRP {Klebsiella pneu | 99.38 | |
| d1xrka_ | 120 | Bleomycin resistance protein, BRP {Streptoalloteic | 99.37 | |
| d1xy7a_ | 135 | Hypothetical protein At5g48480 {Thale cress (Arabi | 99.36 | |
| d1xy7a_ | 135 | Hypothetical protein At5g48480 {Thale cress (Arabi | 99.32 | |
| d1jifa_ | 122 | Bleomycin resistance protein, BRP {Streptomyces ve | 99.26 | |
| d1cjxa1 | 150 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 99.24 | |
| d1xrka_ | 120 | Bleomycin resistance protein, BRP {Streptoalloteic | 99.23 | |
| d1cjxa2 | 203 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 99.14 | |
| d1cjxa1 | 150 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 99.13 | |
| d1cjxa2 | 203 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom | 99.09 | |
| d1t47a2 | 199 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto | 98.96 | |
| d1sqia2 | 210 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 98.93 | |
| d1sp8a2 | 224 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 98.92 | |
| d1u6la_ | 137 | Hypothetical protein PA1353 {Pseudomonas aeruginos | 98.92 | |
| d1sqia2 | 210 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( | 98.9 | |
| d1t47a2 | 199 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto | 98.89 | |
| d1sp8a2 | 224 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z | 98.8 | |
| d1u6la_ | 137 | Hypothetical protein PA1353 {Pseudomonas aeruginos | 98.78 | |
| d1sqda2 | 230 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 98.65 | |
| d1sqda2 | 230 | 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e | 98.59 | |
| d1u7ia_ | 134 | Hypothetical protein PA1358 {Pseudomonas aeruginos | 98.55 | |
| d1u7ia_ | 134 | Hypothetical protein PA1358 {Pseudomonas aeruginos | 98.42 | |
| d1tsja_ | 129 | Hypothetical protein MW1090 {Staphylococcus aureus | 97.97 | |
| d1tsja_ | 129 | Hypothetical protein MW1090 {Staphylococcus aureus | 97.83 | |
| d1u69a_ | 156 | Hypothetical protein PA2721 {Pseudomonas aeruginos | 96.52 | |
| d1u69a_ | 156 | Hypothetical protein PA2721 {Pseudomonas aeruginos | 95.55 |
| >d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase family: Glyoxalase I (lactoylglutathione lyase) domain: Glyoxalase I (lactoylglutathione lyase) species: Escherichia coli [TaxId: 562]
Probab=99.81 E-value=6.4e-19 Score=141.79 Aligned_cols=131 Identities=56% Similarity=1.045 Sum_probs=100.6
Q ss_pred eeeEEEEEEeCChhHHHHHHHHhcCCEEEEEeecCCCceEEEEEeeCCCCceEEEEEEecCCCCCCCCCCCceEEEEEeC
Q 017144 113 RRMLHVVYRVGDLDKTIKFYTECLGMKLLRKRDIPEDRYTNAFLGYGPEDSHFVVELTYNYGVDKYDIGTGFGHFGIAVE 192 (376)
Q Consensus 113 ~~i~Hv~l~v~Dl~~a~~FY~~vLG~~~~~~~~~~~~~~~~~~l~~g~~~~~~~l~l~~~~~~~~~~~~~g~~hi~f~V~ 192 (376)
|+|.||+|.|+|++++++||+++|||++..+............+........................+.+..|+++.++
T Consensus 1 Mkl~Hv~i~V~Dl~~s~~FY~~iLG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (135)
T d1f9za_ 1 MRLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGTAYGHIALSVD 80 (135)
T ss_dssp CCEEEEEEECSCHHHHHHHHHHTTCCEEEEEEEETTTTEEEEEEESSCTTTSCEEEEEEETTCCCCCCCSSEEEEEEECS
T ss_pred CcceEEEEEcCCHHHHHHHHHHHhCCEEEeeccccccceeeeeeccceeeeccccccccccccccccccccceeeccchH
Confidence 58999999999999999999999999998887666655555555544433333333333333344445567889999999
Q ss_pred CHHHHHHHHHHcCCeeecCCeecCCCCeEEEEEEcCCCCEEEEeecCCCCC
Q 017144 193 DVAKTVDLVKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPE 243 (376)
Q Consensus 193 d~d~~~~rl~~~G~~i~~~p~~~~~~~~~~~~~~DPdG~~iel~~~~~~~~ 243 (376)
+++++.++++++|..+...|...+.++.+++|++|||||.|||+|......
T Consensus 81 ~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~DPdG~~iEl~q~~~~~~ 131 (135)
T d1f9za_ 81 NAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIEEKDAGR 131 (135)
T ss_dssp CHHHHHHHHHHTTCEEEEEEEECTTSCCEEEEEECTTSCEEEEEEC-----
T ss_pred HHHHHHHHHHHcCCCeecCCccccCCCeEEEEEECCCCCEEEEEECCCccc
Confidence 999999999999999988888888778889999999999999999776543
|
| >d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} | Back information, alignment and structure |
|---|
| >d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} | Back information, alignment and structure |
|---|
| >d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} | Back information, alignment and structure |
|---|
| >d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} | Back information, alignment and structure |
|---|
| >d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} | Back information, alignment and structure |
|---|
| >d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} | Back information, alignment and structure |
|---|
| >d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} | Back information, alignment and structure |
|---|
| >d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} | Back information, alignment and structure |
|---|
| >d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} | Back information, alignment and structure |
|---|
| >d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} | Back information, alignment and structure |
|---|
| >d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1u69a_ d.32.1.7 (A:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1u69a_ d.32.1.7 (A:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|