Citrus Sinensis ID: 017149


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370------
MIALLIIFLLVFPIFLLLTRRRSSAKGLPPGSLGIPIIGQSLAFLHAIRSNTAEQWLELRARKYDPISKLNLFGKPTIFIHGQAANKLVFSSDSNSISNQQTQAITLILGDRSLLNLTGQDHRRVRDALLSFLKPESLKKYVGKIDGEIRQHIEFHRQGKEQVTVLPLMKTLTFNIICSFLFGLERGKQRDQFLGGLQDMIKGAWAVPVNLPFKTRRMNLTIRSFKQEEIAKGKQRGEFLTWEDLAKMFPPIFGGFRKALKDIEYGRYVIPEGWQIFWVASVTHMDDTIFPEPSKFDPSIFENQASIPPYCYVPFGAGPRICPGYEFARIETLVAIHYIITHFKWKLLCSDNFFSRNPTSFPSKGLPVQITPKKIL
cHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHccccEEEccccccEEEEEcccccccccccccccEEccccHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHccccccHHHHHHHccccccccccccccEEEEEEccEEEccccEEEEEccccccccccccccccccccccccccccccccEEEccccccccccHHHHHHHHHHHHHHHHHccEEEEEcccccEEcccEEccccccEEEEEEcccc
cHHHHHHHHHHHHHHHHHHHccccccccccccccccEHHHHHHHHccccccccHHHHHHHHHHHccEEEEEcccccEEEEEcHHHHHHHHccccccEcccccHHHHHHHccccHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccEEEccEEEccccEEEEEccHHccccHHccccHHccHHHHcccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHccEEEccccccEEEccccccccccEEEEEccccc
MIALLIIFLLVFPIFLLLTrrrssakglppgslgipiiGQSLAFLHAIRSNTAEQWLELRArkydpisklnlfgkptifihgqAANKlvfssdsnsisnQQTQAITLILGdrsllnltgqdHRRVRDALLSflkpeslkkyVGKIDGEIRQHIEFHRqgkeqvtvlpLMKTLTFNIICSFlfglergkqrDQFLGGLQDMIkgawavpvnlpfktrrmNLTIRSFKQEEIAKgkqrgefltwedlakmfppifggFRKALKDieygryvipegWQIFWVASVthmddtifpepskfdpsifenqasippycyvpfgagpricpgyefARIETLVAIHYIITHFKWKLlcsdnffsrnptsfpskglpvqitpkkil
MIALLIIFLLVFPIFLLLTRRRSSAKGLPPGSLGIPIIGQSLAFLHAIRSNTAEQWLELRARKYDPISKLNLFGKPTIFIHGQAANKLVFSSDSNSISNQQTQAITLILGDRSLLNLTGQDHRRVRDAllsflkpeslkkYVGKIDGEIRQHIEFHRQGKEQVTVLPLMKTLTFNIICSFLFGLERGKQRDQFLGGLQDMIKGAwavpvnlpfktrRMNLTIRsfkqeeiakgkqrgefltweDLAKMFPPIFGGFRKALKDIEYGRYVIPEGWQIFWVASVTHMDDTIFPEPSKFDPSIFENQASIPPYCYVPFGAGPRICPGYEFARIETLVAIHYIITHFKWKLLCSDNFFSRnptsfpskglpvqitpkkil
MIAlliifllvfpiflllTRRRSSAKGLPPGSLGIPIIGQSLAFLHAIRSNTAEQWLELRARKYDPISKLNLFGKPTIFIHGQAANKLVFSSDSNSISNQQTQAITLILGDRSLLNLTGQDHRRVRDALLSFLKPESLKKYVGKIDGEIRQHIEFHRQGKEQVTVLPLMKTLTFNIICSFLFGLERGKQRDQFLGGLQDMIKGAWAVPVNLPFKTRRMNLTIRSFKQEEIAKGKQRGEFLTWEDLAKMFPPIFGGFRKALKDIEYGRYVIPEGWQIFWVASVTHMDDTIFPEPSKFDPSIFENQASIPPYCYVPFGAGPRICPGYEFARIETLVAIHYIITHFKWKLLCSDNFFSRNPTSFPSKGLPVQITPKKIL
*IALLIIFLLVFPIFLLLTRRRSSAKGLPPGSLGIPIIGQSLAFLHAIRSNTAEQWLELRARKYDPISKLNLFGKPTIFIHGQAANKLVFS**********TQAITLILGDRSLLNLTGQDHRRVRDALLSFLKPESLKKYVGKIDGEIRQHIEFHRQGKEQVTVLPLMKTLTFNIICSFLFGLERGKQRDQFLGGLQDMIKGAWAVPVNLPFKTRRMNLTIRSFKQEEIAKGKQRGEFLTWEDLAKMFPPIFGGFRKALKDIEYGRYVIPEGWQIFWVASVTHMDDTIFPEPSKFDPSIFENQASIPPYCYVPFGAGPRICPGYEFARIETLVAIHYIITHFKWKLLCSDNFFS*********************
MIALLIIFLLVFPIFLLLTRRR******PPGSLGIPIIGQSLAFLHAIRSNTAEQWLELRARKYDPISKLNLFGKPTIFIHGQAANKLVFSSDSNSISNQQTQAITLILGDRSLLNLTGQDHRRVRDALLS*****S**KYVGKIDGEIRQHIEFHRQGKEQVTVLPLMKTLTFNIICSFLFGLERGKQRDQFLGGLQDMIKGAWAVPVNLPFKTRRMNLTIRSFKQEEIAKGKQRGEFLTWEDLAKMFPPIFGGFRKALKDIEYGRYVIPEGWQIFWVASVTHMDDTIFPEPSKFDPSIFENQASIPPYCYVPFGAGPRICPGYEFARIETLVAIHYIITHFKWKLLCSDNFFSRNPTSFPSKGLPVQITPKK**
MIALLIIFLLVFPIFLLLTRRRSSAKGLPPGSLGIPIIGQSLAFLHAIRSNTAEQWLELRARKYDPISKLNLFGKPTIFIHGQAANKLVFSSDSNSISNQQTQAITLILGDRSLLNLTGQDHRRVRDALLSFLKPESLKKYVGKIDGEIRQHIEFHRQGKEQVTVLPLMKTLTFNIICSFLFGLERGKQRDQFLGGLQDMIKGAWAVPVNLPFKTRRMNLTIRSFKQEEIAKGKQRGEFLTWEDLAKMFPPIFGGFRKALKDIEYGRYVIPEGWQIFWVASVTHMDDTIFPEPSKFDPSIFENQASIPPYCYVPFGAGPRICPGYEFARIETLVAIHYIITHFKWKLLCSDNFFSRNPTSFPSKGLPVQITPKKIL
MIALLIIFLLVFPIFLLLTRRRSSAKGLPPGSLGIPIIGQSLAFLHAIRSNTAEQWLELRARKYDPISKLNLFGKPTIFIHGQAANKLVFSSDSNSISNQQTQAITLILGDRSLLNLTGQDHRRVRDALLSFLKPESLKKYVGKIDGEIRQHIEFHRQGKEQVTVLPLMKTLTFNIICSFLFGLERGKQRDQFLGGLQDMIKGAWAVPVNLPFKTRRMNLTIRSFKQEEIAKGKQRGEFLTWEDLAKMFPPIFGGFRKALKDIEYGRYVIPEGWQIFWVASVTHMDDTIFPEPSKFDPSIFENQASIPPYCYVPFGAGPRICPGYEFARIETLVAIHYIITHFKWKLLCSDNFFSRNPTSFPSKGLPVQITPK***
iHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIALLIIFLLVFPIFLLLTRRRSSAKGLPPGSLGIPIIGQSLAFLHAIRSNTAEQWLELRARKYDPISKLNLFGKPTIFIHGQAANKLVFSSDSNSISNQQTQAITLILGDRSLLNLTGQDHRRVRDALLSFLKPESLKKYVGKIDGEIRQHIEFHRQGKEQVTVLPLMKTLTFNIICSFLFGLERGKQRDQFLGGLQDMIKGAWAVPVNLPFKTRRMNLTIRSFKQEEIAKGKQRGEFLTWEDLAKMFPPIFGGFRKALKDIEYGRYVIPEGWQIFWVASVTHMDDTIFPEPSKFDPSIFENQASIPPYCYVPFGAGPRICPGYEFARIETLVAIHYIITHFKWKLLCSDNFFSRNPTSFPSKGLPVQITPKKIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query376 2.2.26 [Sep-21-2011]
Q84KI1 509 Taxoid 14-beta-hydroxylas N/A no 0.550 0.406 0.345 6e-35
Q6WG30499 Taxadiene 5-alpha hydroxy N/A no 0.513 0.386 0.371 5e-34
Q8W4T9485 Taxane 13-alpha-hydroxyla N/A no 0.513 0.397 0.325 2e-32
Q9AXM6497 Taxane 10-beta-hydroxylas N/A no 0.550 0.416 0.349 3e-32
Q50EK1493 Cytochrome P450 716B1 OS= N/A no 0.388 0.296 0.412 3e-32
Q50EK0497 Cytochrome P450 716B2 OS= N/A no 0.388 0.293 0.412 1e-31
Q6JTJ0500 Taxoid 7-beta-hydroxylase N/A no 0.492 0.37 0.351 8e-30
O81077482 Abscisic acid 8'-hydroxyl no no 0.404 0.315 0.348 2e-24
Q9FH76463 Abscisic acid 8'-hydroxyl no no 0.385 0.313 0.358 2e-23
Q949P1467 Abscisic acid 8'-hydroxyl no no 0.382 0.308 0.343 4e-22
>sp|Q84KI1|T14H_TAXCU Taxoid 14-beta-hydroxylase OS=Taxus cuspidata PE=1 SV=1 Back     alignment and function desciption
 Score =  148 bits (374), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 77/223 (34%), Positives = 125/223 (56%)

Query: 2   IALLIIFLLVFPIFLLLTRRRSSAKGLPPGSLGIPIIGQSLAFLHAIRSNTAEQWLELRA 61
           I L  +  +V P+ L L  +R S+ GLPPG LG P IG+SL FL A+RSNT EQ+L+ R 
Sbjct: 24  IVLSAVAGIVLPLLLFLRSKRRSSVGLPPGKLGYPFIGESLLFLKALRSNTVEQFLDERV 83

Query: 62  RKYDPISKLNLFGKPTIFIHGQAANKLVFSSDSNSISNQQTQAITLILGDRSLLNLTGQD 121
           + +  + K +L G PT+ + G A N+L+ +++   +     ++   ++G++S+    G+ 
Sbjct: 84  KNFGNVFKTSLIGHPTVVLCGPAGNRLILANEEKLVQMSWPKSSMKLMGEKSITAKRGEG 143

Query: 122 HRRVRDALLSFLKPESLKKYVGKIDGEIRQHIEFHRQGKEQVTVLPLMKTLTFNIICSFL 181
           H  +R AL  F  P +L+KY+G++   I  HI    +G +QV+V+ L+  L F+I     
Sbjct: 144 HMIIRSALQGFFSPGALQKYIGQMSKTIENHINEKWKGNDQVSVVALVGDLVFDISACLF 203

Query: 182 FGLERGKQRDQFLGGLQDMIKGAWAVPVNLPFKTRRMNLTIRS 224
           F +    +R++    L+ +  G  AVPV+LP       L  RS
Sbjct: 204 FNINEKHERERLFELLEIIAVGVLAVPVDLPGFAYHRALQARS 246




Catalyzes the conversion of 5-alpha-acetoxy-10beta-ol to 5-alpha-acetoxy-10beta,14beta-dihydroxy taxadiene. Also acts on taxa-4(20),11-dien-5-alpha-yl acetate.
Taxus cuspidata (taxid: 99806)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 1EC: 4EC: 6
>sp|Q6WG30|T5H_TAXCU Taxadiene 5-alpha hydroxylase OS=Taxus cuspidata PE=1 SV=2 Back     alignment and function description
>sp|Q8W4T9|T13H_TAXCU Taxane 13-alpha-hydroxylase OS=Taxus cuspidata GN=CYP725A2 PE=1 SV=1 Back     alignment and function description
>sp|Q9AXM6|T10H_TAXCU Taxane 10-beta-hydroxylase OS=Taxus cuspidata GN=CYP725A1 PE=1 SV=1 Back     alignment and function description
>sp|Q50EK1|C16B1_PICSI Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1 Back     alignment and function description
>sp|Q50EK0|C16B2_PICSI Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP716B2 PE=2 SV=1 Back     alignment and function description
>sp|Q6JTJ0|T7H_TAXCU Taxoid 7-beta-hydroxylase OS=Taxus cuspidata PE=1 SV=1 Back     alignment and function description
>sp|O81077|ABAH2_ARATH Abscisic acid 8'-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP707A2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH76|ABAH3_ARATH Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 Back     alignment and function description
>sp|Q949P1|ABAH1_ARATH Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query376
23495766409 putative 5-alpha-taxadienol-10-beta-hydr 0.888 0.816 0.402 3e-81
363814400474 uncharacterized protein LOC100790001 pre 0.539 0.428 0.658 7e-77
222637147410 hypothetical protein OsJ_24470 [Oryza sa 0.880 0.807 0.388 1e-76
359494123474 PREDICTED: cytochrome P450 716B1-like [V 0.531 0.421 0.647 4e-74
255563939 478 cytochrome P450, putative [Ricinus commu 0.577 0.453 0.586 1e-73
357494403 485 Taxane 13-alpha-hydroxylase [Medicago tr 0.478 0.371 0.675 2e-73
297737417383 unnamed protein product [Vitis vinifera] 0.534 0.524 0.593 2e-70
449446129 478 PREDICTED: cytochrome P450 716B1-like [C 0.603 0.474 0.573 2e-70
359494125472 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.531 0.423 0.596 3e-70
297737414 571 unnamed protein product [Vitis vinifera] 0.518 0.341 0.605 6e-65
>gi|23495766|dbj|BAC19977.1| putative 5-alpha-taxadienol-10-beta-hydroxylase [Oryza sativa Japonica Group] gi|50510104|dbj|BAD30846.1| putative 5-alpha-taxadienol-10-beta-hydroxylase [Oryza sativa Japonica Group] Back     alignment and taxonomy information
 Score =  308 bits (788), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 164/407 (40%), Positives = 226/407 (55%), Gaps = 73/407 (17%)

Query: 13  PIFL-LLTRRRSSAKGLPPGSLGIPIIGQSLAFLHAIRSNTAEQWLELRARKYDPISKLN 71
           PI L L+TRR+ ++  LP GSLG P+IGQ+++ L A+R NT  QW + R +KY P+SK++
Sbjct: 16  PILLHLVTRRKYASYNLPSGSLGFPLIGQTISLLRALRKNTDYQWYQDRIKKYGPVSKMS 75

Query: 72  LFGKPTIFIHGQAANKLVFSSDSNSISNQQTQAITLILGDRSLLNLTGQDHRRVRDALLS 131
           +FG PT+ + G AAN+  F +              LI      LN  G            
Sbjct: 76  VFGSPTVLLTGPAANRFAFCNPD------------LIFTQTKALNALG------------ 111

Query: 132 FLKPESLKKYVGKIDGEIRQHIEFHRQGKEQVTVLPLMKTLTFNIICSFLFGLERGKQRD 191
           +L+PE + KY+ K+D E+R+HI+ H  G++ +TV PL K LTFNI CS  FG E G  R+
Sbjct: 112 YLRPEMVTKYIWKMDKEVRRHIDLHWVGQKTLTVAPLAKRLTFNITCSVFFGEEAGPIRE 171

Query: 192 QFLGGLQDMIKGAWAVPVNLPFKTRRMNLT----IRSF---------------------- 225
                 + ++K   ++PVN+PF      L+    IR                        
Sbjct: 172 ALATDFEALVKATLSIPVNIPFTKFNKGLSASWRIRKLLSRIAYETTSVLIIFLLRYLAN 231

Query: 226 ---------KQEEIAKGKQRGEFLTWEDLAKM-------------FPPIFGGFRKALKDI 263
                    +QEEIA+ K   E LTW+D+++M              P IFG FR A+KDI
Sbjct: 232 EPDILGNITEQEEIARNKGPNEPLTWDDVSRMKYTWKVAMETLRTVPAIFGSFRTAIKDI 291

Query: 264 EYGRYVIPEGWQIFWVASVTHMDDTIFPEPSKFDPSIFENQASIPPYCYVPFGAGPRICP 323
           EY  Y IP+GWQIF    VTH+D   F  P KFDP+ F NQ+SIPPYC+VPFG GPR+CP
Sbjct: 292 EYQGYHIPKGWQIFTDQIVTHLDTNFFDGPRKFDPARFHNQSSIPPYCFVPFGGGPRMCP 351

Query: 324 GYEFARIETLVAIHYIITHFKWKLLCSDNFFSRNPTSFPSKGLPVQI 370
           G EFA+  TLVA+HY++  F+WKL C +  + ++PT  P  GLP+ +
Sbjct: 352 GNEFAKTGTLVAMHYLVRQFRWKLCCKEEGYRKDPTPMPLLGLPIDL 398




Source: Oryza sativa Japonica Group

Species: Oryza sativa

Genus: Oryza

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|363814400|ref|NP_001242838.1| uncharacterized protein LOC100790001 precursor [Glycine max] gi|255638849|gb|ACU19728.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|222637147|gb|EEE67279.1| hypothetical protein OsJ_24470 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|359494123|ref|XP_002278616.2| PREDICTED: cytochrome P450 716B1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255563939|ref|XP_002522969.1| cytochrome P450, putative [Ricinus communis] gi|223537781|gb|EEF39399.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357494403|ref|XP_003617490.1| Taxane 13-alpha-hydroxylase [Medicago truncatula] gi|355518825|gb|AET00449.1| Taxane 13-alpha-hydroxylase [Medicago truncatula] Back     alignment and taxonomy information
>gi|297737417|emb|CBI26618.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449446129|ref|XP_004140824.1| PREDICTED: cytochrome P450 716B1-like [Cucumis sativus] gi|449485575|ref|XP_004157212.1| PREDICTED: cytochrome P450 716B1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359494125|ref|XP_002278541.2| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 716B2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737414|emb|CBI26615.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query376
TAIR|locus:2158961477 CYP716A1 ""cytochrome P450, fa 0.390 0.308 0.413 2.9e-60
TAIR|locus:2052396485 CYP718 ""cytochrome P450, fami 0.433 0.336 0.419 3.3e-57
UNIPROTKB|Q6JTJ0500 Q6JTJ0 "Taxoid 7-beta-hydroxyl 0.558 0.42 0.358 8.4e-55
TAIR|locus:2066138482 CYP707A2 ""cytochrome P450, fa 0.305 0.238 0.410 1.1e-37
TAIR|locus:2158480463 CYP707A3 ""cytochrome P450, fa 0.385 0.313 0.358 1.6e-37
ZFIN|ZDB-GENE-990415-44 492 cyp26a1 "cytochrome P450, subf 0.526 0.402 0.281 1.3e-35
TAIR|locus:2101704513 DWF4 "DWARF 4" [Arabidopsis th 0.303 0.222 0.365 1e-34
TAIR|locus:2091571491 CYP90D1 ""cytochrome P450, fam 0.569 0.435 0.264 6.3e-34
TAIR|locus:2166439472 CPD "CONSTITUTIVE PHOTOMORPHOG 0.534 0.425 0.263 4.9e-33
UNIPROTKB|F1MZS4 497 CYP26A1 "Uncharacterized prote 0.566 0.428 0.273 5.6e-33
TAIR|locus:2158961 CYP716A1 ""cytochrome P450, family 716, subfamily A, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 354 (129.7 bits), Expect = 2.9e-60, Sum P(2) = 2.9e-60
 Identities = 67/162 (41%), Positives = 99/162 (61%)

Query:   226 KQEEIAKGKQRGEFLTWEDLAKM-------------FPPIFGGFRKALKDIEYGRYVIPE 272
             +Q+EI K K+  E L WED+ KM              PP+ G FR+A+    +  + IP+
Sbjct:   316 EQKEILKEKKEKEGLRWEDIEKMRYSWNVACEVMRIVPPLSGTFREAIDHFSFKGFYIPK 375

Query:   273 GWQIFWVASVTHMDDTIFPEPSKFDPSIFENQASIPPYCYVPFGAGPRICPGYEFARIET 332
             GW+++W A+ THM+   FPEP +F+P+ FE      PY YVPFG GPR+CPG E+AR+E 
Sbjct:   376 GWKLYWSATATHMNPDYFPEPERFEPNRFEGSGP-KPYTYVPFGGGPRMCPGKEYARLEI 434

Query:   333 LVAIHYIITHFKW-KLLCSDNFFSRNPTSFPSKGLPVQITPK 373
             L+ +H ++  FKW K+  ++N    +P   P KGLP++I P+
Sbjct:   435 LIFMHNLVNRFKWEKVFPNENKIVVDPLPIPDKGLPIRIFPQ 476


GO:0005506 "iron ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2052396 CYP718 ""cytochrome P450, family 718"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6JTJ0 Q6JTJ0 "Taxoid 7-beta-hydroxylase" [Taxus cuspidata (taxid:99806)] Back     alignment and assigned GO terms
TAIR|locus:2066138 CYP707A2 ""cytochrome P450, family 707, subfamily A, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158480 CYP707A3 ""cytochrome P450, family 707, subfamily A, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-44 cyp26a1 "cytochrome P450, subfamily XXVIA, polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2101704 DWF4 "DWARF 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091571 CYP90D1 ""cytochrome P450, family 90, subfamily D, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166439 CPD "CONSTITUTIVE PHOTOMORPHOGENIC DWARF" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1MZS4 CYP26A1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query376
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 2e-31
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 3e-24
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 4e-24
pfam00067461 pfam00067, p450, Cytochrome P450 2e-22
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 2e-22
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 2e-20
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 6e-20
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 9e-20
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 8e-19
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 1e-18
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 4e-18
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 1e-16
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 6e-15
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 3e-12
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 2e-10
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 5e-09
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 6e-09
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 4e-08
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 1e-07
pfam00067 461 pfam00067, p450, Cytochrome P450 2e-07
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 8e-07
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-05
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 7e-05
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 3e-04
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 0.002
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 0.003
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
 Score =  123 bits (311), Expect = 2e-31
 Identities = 59/163 (36%), Positives = 88/163 (53%), Gaps = 19/163 (11%)

Query: 226 KQEEIAKGKQRGEFLTWEDLAKMFPPIFG---------------GFRKALKDIEYGRYVI 270
           +Q  I K K+ GE LTWED  KM  P+                  FR+A++D+EY  Y+I
Sbjct: 304 EQMAIRKDKEEGESLTWEDTKKM--PLTSRVIQETLRVASILSFTFREAVEDVEYEGYLI 361

Query: 271 PEGWQIFWVASVTHMDDTIFPEPSKFDPSIFENQASIPPYCYVPFGAGPRICPGYEFARI 330
           P+GW++  +    H    IF +P KFDPS FE   +  P  ++PFG G   CPG E A++
Sbjct: 362 PKGWKVLPLFRNIHHSADIFSDPGKFDPSRFE--VAPKPNTFMPFGNGTHSCPGNELAKL 419

Query: 331 ETLVAIHYIITHFKWKLLCSDNFFSRNPTSFPSKGLPVQITPK 373
           E  V IH++ T ++W ++ + N     P + P  GLP+ ++ K
Sbjct: 420 EISVLIHHLTTKYRWSIVGTSNGIQYGPFALPQNGLPIALSRK 462


Length = 463

>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 376
PLN02774463 brassinosteroid-6-oxidase 100.0
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02648480 allene oxide synthase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
Probab=100.00  E-value=4.2e-58  Score=427.06  Aligned_cols=353  Identities=25%  Similarity=0.514  Sum_probs=280.1

Q ss_pred             HHHHHHHHHHhcCCCCCCcccccccccchHHHHHHhhcCCHHHHHHHHHhhcCCceEeecCCCCEEEEeChhHHHHHhhc
Q 017149           13 PIFLLLTRRRSSAKGLPPGSLGIPIIGQSLAFLHAIRSNTAEQWLELRARKYDPISKLNLFGKPTIFIHGQAANKLVFSS   92 (376)
Q Consensus        13 ~~~~~~~~~~~~~~~~ppgp~~~P~~G~~~~~~~~~~~~~~~~~~~~~~~~yg~i~~~~~~~~~~vvv~~p~~~~~i~~~   92 (376)
                      .+++++..+++.+++.||||+++|++||++.+..     ++..++++++++||++|+++++++++++++||+++++++.+
T Consensus        17 ~~~~~~~~~~~~r~~~ppgp~~~P~~G~~~~~~~-----~~~~~~~~~~~~yG~i~~~~~g~~~~v~i~~p~~~~~il~~   91 (463)
T PLN02774         17 SALLRWNEVRYSKKGLPPGTMGWPLFGETTEFLK-----QGPDFMKNQRLRYGSFFKSHILGCPTIVSMDPELNRYILMN   91 (463)
T ss_pred             HHHHHHHhhccCCCCCCCCCCCCCchhhHHHHHH-----hhHHHHHHHHHHhccCccceecCCCeEEEeCHHHHHHHHcC
Confidence            3333434455567788999999999999998764     56678999999999999999999999999999999999988


Q ss_pred             CCccccccchhhHHhhcCCcccccCCChhHHHHHHHHHccCChHHHHh-HHHhHHHHHHHHHHHHhcCCCceehHHHHHH
Q 017149           93 DSNSISNQQTQAITLILGDRSLLNLTGQDHRRVRDALLSFLKPESLKK-YVGKIDGEIRQHIEFHRQGKEQVTVLPLMKT  171 (376)
Q Consensus        93 ~~~~~~~~~~~~~~~~~g~~~i~~~~g~~~~~~R~~~~~~~~~~~l~~-~~~~~~~~~~~~l~~~~~~~~~~d~~~~~~~  171 (376)
                      +...+..+........+|.++++.++|+.|+++|+++.++|++..++. +.+.+.+.+++++++ |..++.+|+.+.++.
T Consensus        92 ~~~~~~~~~~~~~~~~lg~~~~~~~~g~~w~~~R~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~v~~~~~~~~  170 (463)
T PLN02774         92 EGKGLVPGYPQSMLDILGTCNIAAVHGSTHRYMRGSLLSLISPTMIRDHLLPKIDEFMRSHLSG-WDGLKTIDIQEKTKE  170 (463)
T ss_pred             CCCeEEecCCHHHHHHhCccchhhcCCHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHHHh-hCCCCCEEeeHHHHH
Confidence            776665444444445677567888899999999999999999999886 789999999999998 877678999999999


Q ss_pred             HHHHHHHHhhccCCCCchhHHHHHHHHHHHhccccccccCChh---------------------hhhchh-cccch----
Q 017149          172 LTFNIICSFLFGLERGKQRDQFLGGLQDMIKGAWAVPVNLPFK---------------------TRRMNL-TIRSF----  225 (376)
Q Consensus       172 ~~~~~~~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~---------------------~r~~~~-~~~dl----  225 (376)
                      +++++++.++||...++..+++.+.+..+......++..+|..                     +|++.. ..+|+    
T Consensus       171 ~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~lp~~~~~~~~~~~~~~~~~~~~~i~~r~~~~~~~~d~l~~l  250 (463)
T PLN02774        171 MALLSALKQIAGTLSKPISEEFKTEFFKLVLGTLSLPIDLPGTNYRSGVQARKNIVRMLRQLIQERRASGETHTDMLGYL  250 (463)
T ss_pred             HHHHHHHHHHcCCCChHHHHHHHHHHHHHhcccccCCcCCCChhhhHHHHHHHHHHHHHHHHHHHHHhcCCCcccHHHHH
Confidence            9999999999998765544455555544443333334444532                     111100 01121    


Q ss_pred             --------------------------------------------------HHHHHHhhcCC---CCcCCHHHHhcc----
Q 017149          226 --------------------------------------------------KQEEIAKGKQR---GEFLTWEDLAKM----  248 (376)
Q Consensus       226 --------------------------------------------------~~~Ei~~~~~~---~~~~~~~~~~~l----  248 (376)
                                                                        +++|++++.+.   +..++.+++.+|    
T Consensus       251 l~~~~~~~~~s~~ei~~~~~~ll~Ag~dTt~~~l~w~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~~~~~~l~~lpyl~  330 (463)
T PLN02774        251 MRKEGNRYKLTDEEIIDQIITILYSGYETVSTTSMMAVKYLHDHPKALQELRKEHLAIRERKRPEDPIDWNDYKSMRFTR  330 (463)
T ss_pred             HhCccCCCCCCHHHHHHHHHHHHHhcchhHHHHHHHHHHHHHcCHHHHHHHHHHHHHHHhccCCCCCCCHHHHhcCcHHH
Confidence                                                              78888887643   234566666554    


Q ss_pred             ---------cCCccccccccccceeecceeecCcCEEEeechhhccCCCCCCCCCCCCCCCCCCCCCCCCCccccCCCCC
Q 017149          249 ---------FPPIFGGFRKALKDIEYGRYVIPEGWQIFWVASVTHMDDTIFPEPSKFDPSIFENQASIPPYCYVPFGAGP  319 (376)
Q Consensus       249 ---------~p~~~~~~R~~~~d~~l~g~~ip~G~~v~~~~~~~~~d~~~~~~p~~F~P~Rfl~~~~~~~~~~~pFg~G~  319 (376)
                               +|+++.+.|.+.+|++++||.||||+.|+++.+++||||++|+||++|+||||++.+......|+|||+|+
T Consensus       331 a~ikE~lRl~P~v~~~~R~~~~d~~l~g~~IpkGt~v~~~~~~~~rdp~~~~dP~~F~PeRfl~~~~~~~~~~lpFG~G~  410 (463)
T PLN02774        331 AVIFETSRLATIVNGVLRKTTQDMELNGYVIPKGWRIYVYTREINYDPFLYPDPMTFNPWRWLDKSLESHNYFFLFGGGT  410 (463)
T ss_pred             HHHHHHHhcCCCCCCcccccCCCeeECCEEECCCCEEEEehHHhcCCcccCCChhccCchhcCCCCcCCCccccCcCCCC
Confidence                     99999999999999999999999999999999999999999999999999999976522234699999999


Q ss_pred             CCCcChHHHHHHHHHHHHHHHHhceeeeccCCCccccCccccCCCCccEEEee
Q 017149          320 RICPGYEFARIETLVAIHYIITHFKWKLLCSDNFFSRNPTSFPSKGLPVQITP  372 (376)
Q Consensus       320 r~C~G~~~a~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~v~~~~  372 (376)
                      |.|||++||.+|++++++.|+++|++++.+++. ....+++.|+++++|++++
T Consensus       411 r~C~G~~~A~~e~~~~la~Ll~~f~~~~~~~~~-~~~~~~~~p~~g~~~~~~~  462 (463)
T PLN02774        411 RLCPGKELGIVEISTFLHYFVTRYRWEEVGGDK-LMKFPRVEAPNGLHIRVSP  462 (463)
T ss_pred             CcCCcHHHHHHHHHHHHHHHHHhceEEECCCCc-cccCCCCCCCCCceEEeee
Confidence            999999999999999999999999999987653 2333466799999999985



>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query376
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 1e-20
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 2e-10
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 2e-10
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 2e-10
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 7e-10
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 3e-09
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-08
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 2e-08
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-08
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 3e-08
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 3e-08
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 3e-08
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 3e-08
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 4e-08
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 4e-08
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 4e-08
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 4e-08
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 4e-08
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 4e-08
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 4e-08
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 4e-08
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-08
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 4e-08
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 4e-08
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 4e-08
1fah_A471 Structure Of Cytochrome P450 Length = 471 4e-08
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 4e-08
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 4e-08
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-08
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 4e-08
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 4e-08
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 4e-08
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 4e-08
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 4e-08
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 4e-08
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-08
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 4e-08
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 4e-08
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 5e-08
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 5e-08
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 5e-08
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 5e-08
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 6e-08
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 6e-08
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 6e-08
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 8e-08
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 9e-08
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 9e-08
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 9e-08
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 1e-07
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 1e-07
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 1e-07
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 1e-07
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 1e-07
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-07
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 2e-07
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 2e-07
1pkf_A419 Crystal Structure Of Epothilone D-Bound Cytochrome 3e-07
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-07
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 4e-07
1q5d_A419 Epothilone B-Bound Cytochrome P450epok Length = 419 6e-07
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 1e-06
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 1e-06
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 2e-06
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 3e-06
3p3l_A406 Crystal Structure Of The Cytochrome P450 Monooxygen 4e-06
3p3o_A416 Crystal Structure Of The Cytochrome P450 Monooxygen 4e-06
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 5e-06
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 8e-06
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 8e-06
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 9e-06
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 9e-06
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 9e-06
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 9e-06
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 9e-06
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 1e-05
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 1e-05
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 1e-05
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 1e-05
2xkr_A398 Crystal Structure Of Mycobacterium Tuberculosis Cyp 1e-05
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 2e-05
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 2e-05
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-05
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-05
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 2e-05
1ue8_A367 Crystal Structure Of Thermophilic Cytochrome P450 F 2e-05
1io8_A368 Thermophilic Cytochrome P450 (Cyp119) From Sulfolob 4e-05
1f4t_A368 Thermophilic P450: Cyp119 From Sulfolobus Solfactar 5e-05
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 5e-05
1t93_A406 Evidence For Multiple Substrate Recognition And Mol 6e-05
3tzo_A410 The Role Of I87 Of Cyp158a2 In Oxidative Coupling R 6e-05
3tnk_A407 Crystal Structure Of Mutant I87r In Cyp158a2 Length 6e-05
1s1f_A406 Crystal Structure Of Streptomyces Coelicolor A3(2) 6e-05
2d09_A407 A Role For Active Site Water Molecules And Hydroxyl 6e-05
1se6_A406 Crystal Structure Of Streptomyces Coelicolor A3(2) 6e-05
2d0e_A407 Substrate Assited In Oxygen Activation In Cytochrom 6e-05
3sn5_A491 Crystal Structure Of Human Cyp7a1 In Complex With C 8e-05
3dax_A491 Crystal Structure Of Human Cyp7a1 Length = 491 8e-05
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 8e-05
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 1e-04
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 1e-04
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 3e-04
3ejb_B404 Crystal Structure Of P450bioi In Complex With Tetra 2e-04
2rfb_A343 Crystal Structure Of A Cytochrome P450 From The The 2e-04
3aba_A403 Crystal Structure Of Cyp105p1 In Complex With Filip 3e-04
3e5j_A403 Crystal Structure Of Cyp105p1 Wild-type Ligand-free 3e-04
3e5l_A403 Crystal Structure Of Cyp105p1 H72a Mutant Length = 3e-04
3tkt_A450 Crystal Structure Of Cyp108d1 From Novosphingobium 3e-04
3nv5_A452 Crystal Structure Of Cytochrome P450 Cyp101d2 Lengt 4e-04
3pm0_A 507 Structural Characterization Of The Complex Between 4e-04
4dxy_A417 Crystal Structures Of Cyp101d2 Y96a Mutant Length = 5e-04
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure

Iteration: 1

Score = 97.1 bits (240), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 47/132 (35%), Positives = 73/132 (55%), Gaps = 4/132 (3%) Query: 243 EDLAKMFPPIFGGFRKALKDIEYGRYVIPEGWQIFWVASVTHMDDTIFPEPSKFDPSIFE 302 +++ ++ PP+ GGFR+ ++D ++ + P+GW + + S TH D ++P+P KFDP F Sbjct: 309 QEVLRLIPPVGGGFRELIQDCQFQGFHFPKGWLVSYQISQTHADPDLYPDPEKFDPERFT 368 Query: 303 NQASI---PPYCYVPFGAGPRICPGYEFARIETLVAIHYIITHFKWKLLCSDNF-FSRNP 358 S PP+ +VPFG G R C G EFAR+E + +I F W LL N P Sbjct: 369 PDGSATHNPPFAHVPFGGGLRECLGKEFARLEMKLFATRLIQQFDWTLLPGQNLELVVTP 428 Query: 359 TSFPSKGLPVQI 370 + P L V++ Sbjct: 429 SPRPKDNLRVKL 440
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1PKF|A Chain A, Crystal Structure Of Epothilone D-Bound Cytochrome P450epok Length = 419 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|1Q5D|A Chain A, Epothilone B-Bound Cytochrome P450epok Length = 419 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|3P3L|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Wildtype) From Streptomyces Thioluteus Length = 406 Back     alignment and structure
>pdb|3P3O|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Ntermii) From Streptomyces Thioluteus Length = 416 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|2XKR|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cyp142: A Novel Cholesterol Oxidase Length = 398 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|1UE8|A Chain A, Crystal Structure Of Thermophilic Cytochrome P450 From Sulfolobus Tokodaii Length = 367 Back     alignment and structure
>pdb|1IO8|A Chain A, Thermophilic Cytochrome P450 (Cyp119) From Sulfolobus Solfataricus: High Resolution Structural Origin Of Its Thermostability And Functional Properties Length = 368 Back     alignment and structure
>pdb|1F4T|A Chain A, Thermophilic P450: Cyp119 From Sulfolobus Solfactaricus With 4- Phenylimidazole Bound Length = 368 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1T93|A Chain A, Evidence For Multiple Substrate Recognition And Molecular Mechanism Of C-C Reaction By Cytochrome P450 Cyp158a2 From Streptomyces Coelicolor A3(2) Length = 406 Back     alignment and structure
>pdb|3TZO|A Chain A, The Role Of I87 Of Cyp158a2 In Oxidative Coupling Reaction Length = 410 Back     alignment and structure
>pdb|3TNK|A Chain A, Crystal Structure Of Mutant I87r In Cyp158a2 Length = 407 Back     alignment and structure
>pdb|1S1F|A Chain A, Crystal Structure Of Streptomyces Coelicolor A3(2) Cyp158a2 From Antibiotic Biosynthetic Pathways Length = 406 Back     alignment and structure
>pdb|2D09|A Chain A, A Role For Active Site Water Molecules And Hydroxyl Groups Of Substrate For Oxygen Activation In Cytochrome P450 158a2 Length = 407 Back     alignment and structure
>pdb|1SE6|A Chain A, Crystal Structure Of Streptomyces Coelicolor A3(2) Cyp158a2 From Antibiotic Biosynthetic Pathways Length = 406 Back     alignment and structure
>pdb|2D0E|A Chain A, Substrate Assited In Oxygen Activation In Cytochrome P450 158a2 Length = 407 Back     alignment and structure
>pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 Back     alignment and structure
>pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 404 Back     alignment and structure
>pdb|2RFB|A Chain A, Crystal Structure Of A Cytochrome P450 From The Thermoacidophilic Archaeon Picrophilus Torridus Length = 343 Back     alignment and structure
>pdb|3ABA|A Chain A, Crystal Structure Of Cyp105p1 In Complex With Filipin I Length = 403 Back     alignment and structure
>pdb|3E5J|A Chain A, Crystal Structure Of Cyp105p1 Wild-type Ligand-free Form Length = 403 Back     alignment and structure
>pdb|3E5L|A Chain A, Crystal Structure Of Cyp105p1 H72a Mutant Length = 403 Back     alignment and structure
>pdb|3TKT|A Chain A, Crystal Structure Of Cyp108d1 From Novosphingobium Aromaticivorans Dsm12444 Length = 450 Back     alignment and structure
>pdb|3NV5|A Chain A, Crystal Structure Of Cytochrome P450 Cyp101d2 Length = 452 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|4DXY|A Chain A, Crystal Structures Of Cyp101d2 Y96a Mutant Length = 417 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query376
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 3e-81
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 1e-51
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 5e-49
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 5e-39
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 6e-37
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 5e-36
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 4e-35
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-25
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-33
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 3e-27
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 3e-31
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-23
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 2e-29
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 3e-22
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-27
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 4e-22
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-26
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 4e-19
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 3e-26
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 2e-10
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 7e-26
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-07
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 7e-25
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 5e-17
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 1e-24
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 3e-10
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 7e-24
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-23
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 4e-12
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 4e-23
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-08
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-22
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-11
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 3e-21
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 8e-14
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 1e-13
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 6e-06
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 3e-13
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 3e-08
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 6e-13
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 4e-06
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 7e-13
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 7e-08
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 3e-12
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 3e-05
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 3e-12
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 3e-06
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 5e-12
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 6e-07
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 1e-11
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 1e-07
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-11
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 3e-08
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-11
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-05
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 2e-08
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 3e-07
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 5e-07
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 1e-06
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 1e-06
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 1e-06
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 2e-06
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 2e-06
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 3e-06
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 4e-06
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 6e-06
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 6e-06
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 7e-06
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 7e-06
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 9e-06
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 1e-05
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 1e-05
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 1e-05
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 2e-05
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 2e-05
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 2e-05
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 2e-05
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 2e-05
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 2e-05
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 3e-05
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 3e-05
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 3e-05
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 3e-05
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 5e-05
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 5e-05
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 5e-05
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 6e-05
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 6e-05
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 7e-05
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 8e-05
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 1e-04
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 1e-04
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 2e-04
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 2e-04
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 2e-04
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 3e-04
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 4e-04
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 8e-04
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
 Score =  253 bits (648), Expect = 3e-81
 Identities = 54/420 (12%), Positives = 123/420 (29%), Gaps = 83/420 (19%)

Query: 28  LPPGSLGIPIIGQSLAFLHAIRSNTAEQWLELRARKYDPIS-KLNLFGKPTIFIHGQAAN 86
           +P          ++L+ L         +++  + ++    + +     K T  + G  A 
Sbjct: 1   MPKT-PHTKGPDETLSLLAD-----PYRFISRQCQRLGANAFESRFLLKKTNCLKGAKAA 54

Query: 87  KLVFSSDSNSISNQQTQAIT-LILGDRSLLNLTGQDHRRVRDALLSFLKPESLKKYVGKI 145
           ++ + +           AI   +LG   +  L G+ HR  +   +  + PE ++      
Sbjct: 55  EIFYDTTRFEREGAMPVAIQKTLLGQGGVQGLDGETHRHRKQMFMGLMTPERVRALAQLF 114

Query: 146 DGEIRQHIEFHRQGKEQVTVLPLMKTLTFNIICSFLFGLERGKQRDQFLGGLQDMIKGAW 205
           + E R+ +      K ++     +       +C++        +     G L+ +   A 
Sbjct: 115 EAEWRRAVP-GWTRKGEIVFYDELHEPLTRAVCAWAGVPLPDDEAGNRAGELRALFDAAG 173

Query: 206 AVPVNLPFKT---RRMNLTIRSFKQEEIAKGKQRGE------------------------ 238
           +      +     RR++   +   +   A     G                         
Sbjct: 174 SASPRHLWSRLARRRVDAWAKRIIEGIRAGSIGSGSGTAAYAIAWHRDRHDDLLSPHVAA 233

Query: 239 ---------------FLTW-------------EDLAKM-------------FPPIFGGFR 257
                          ++T+               + +              +P       
Sbjct: 234 VELVNVLRPTVAIAVYITFVAHALQTCSGIRAALVQQPDYAELFVQEVRRFYPFFPAVVA 293

Query: 258 KALKDIEYGRYVIPEGWQIFWVASVTHMDDTIFPEPSKFDPSIFENQASIPPYCYVPFGA 317
           +A +D E+     PEG Q+      ++ D   + +P +F P  F        + ++P G 
Sbjct: 294 RASQDFEWEGMAFPEGRQVVLDLYGSNHDAATWADPQEFRPERFRA-WDEDSFNFIPQGG 352

Query: 318 GP----RICPGYEFARIETLVAIHYIITHFKWKLLCSDNFFSRNP-TSFPSKGLPVQITP 372
           G       CPG         VA H ++   ++ +   D         + P  G  ++   
Sbjct: 353 GDHYLGHRCPGEWIVLAIMKVAAHLLVNAMRYDVPDQDLSIDFARLPALPKSGFVMRNVH 412


>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query376
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 100.0
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
Probab=100.00  E-value=6e-58  Score=429.67  Aligned_cols=353  Identities=21%  Similarity=0.304  Sum_probs=279.5

Q ss_pred             HHHHHhcCCCCCCcccccccccchHHHHHHhhcCCHHHHHHHHHhhcCCceEeecCCCCEEEEeChhHHHHHhhcCCccc
Q 017149           18 LTRRRSSAKGLPPGSLGIPIIGQSLAFLHAIRSNTAEQWLELRARKYDPISKLNLFGKPTIFIHGQAANKLVFSSDSNSI   97 (376)
Q Consensus        18 ~~~~~~~~~~~ppgp~~~P~~G~~~~~~~~~~~~~~~~~~~~~~~~yg~i~~~~~~~~~~vvv~~p~~~~~i~~~~~~~~   97 (376)
                      +++...++.+.+|||++||++||++++......++++..+.+++++||+|+++++++.++|+++||+++++|+.++. .+
T Consensus        15 ~~~~~~~pl~~~PGP~~~p~iG~~~~~~~~~~~~~~~~~~~~l~~~YG~i~~~~~g~~~~vvv~dp~~~~~il~~~~-~~   93 (482)
T 3k9v_A           15 MTDGETRNVTDLPGPTNWPLLGSLLEIFWKGGLKKQHDTLAEYHKKYGQIFRMKLGSFDSVHLGSPSLLEALYRTES-AH   93 (482)
T ss_dssp             ----CCEEGGGCCCSCCCTTTBTHHHHHHTTCGGGHHHHHHHHHHHHCSEEEEEETTEEEEEECSHHHHHHHHHTCC-SS
T ss_pred             ccccccCCCCCCCCCCCCCccccHHHHhccCCcccHHHHHHHHHHHcCCEEEEccCCCCEEEEcCHHHHHHHHHhcC-CC
Confidence            36666788899999999999999999875322346889999999999999999999999999999999999998854 44


Q ss_pred             cccch-h---hHHhhc-CCcccccCCChhHHHHHHHHHccC-ChHHHHhHHHhHHHHHHHHHHHHhc-----CCCceehH
Q 017149           98 SNQQT-Q---AITLIL-GDRSLLNLTGQDHRRVRDALLSFL-KPESLKKYVGKIDGEIRQHIEFHRQ-----GKEQVTVL  166 (376)
Q Consensus        98 ~~~~~-~---~~~~~~-g~~~i~~~~g~~~~~~R~~~~~~~-~~~~l~~~~~~~~~~~~~~l~~~~~-----~~~~~d~~  166 (376)
                      .++.. .   ...... +..+++.++|+.|+++|+++.+.| +.+.+..+.+.+.+.++++++. +.     +++.+|+.
T Consensus        94 ~~r~~~~~~~~~~~~~~~~~~l~~~~g~~w~~~Rr~~~~~f~~~~~~~~~~~~i~~~~~~l~~~-l~~~~~~~g~~vd~~  172 (482)
T 3k9v_A           94 PQRLEIKPWKAYRDHRNEAYGLMILEGQEWQRVRSAFQKKLMKPVEIMKLDKKINEVLADFLER-MDELCDERGRIPDLY  172 (482)
T ss_dssp             CCCCCCHHHHHHHHHHTCCCCTTTCCHHHHHHHHHHHHHHHTCHHHHGGGHHHHHHHHHHHHHH-HHHHCCTTSCCTTHH
T ss_pred             CCCCCchHHHHHHHhcCCCCCceeCCCchHHHHHHHhhHHhcChHHHHHHHHHHHHHHHHHHHH-HHHHHhcCCCCCCHH
Confidence            44322 1   122222 237888899999999999999975 7888999999999999999988 42     45689999


Q ss_pred             HHHHHHHHHHHHHhhccCCCC-------chhHHHHHHHHHHHhccccccccCCh----------h---------------
Q 017149          167 PLMKTLTFNIICSFLFGLERG-------KQRDQFLGGLQDMIKGAWAVPVNLPF----------K---------------  214 (376)
Q Consensus       167 ~~~~~~~~~~~~~~~fG~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~p~----------~---------------  214 (376)
                      +++..+++++++.++||.+.+       +....+.+.+..+........ .+|.          +               
T Consensus       173 ~~~~~~t~dvi~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~p~~~~~~l~~~~~~~~~~~~~~~~~~~~  251 (482)
T 3k9v_A          173 SELNKWSFESICLVLYEKRFGLLQKETEEEALTFITAIKTMMSTFGKMM-VTPVELHKRLNTKVWQAHTLAWDTIFKSVK  251 (482)
T ss_dssp             HHHHHHHHHHHHHHHHSCCCCSSSTTSTTSSHHHHHHHHHHHTTGGGGS-SSCHHHHHHHTCHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHcccccCCCCCCcchHHHHHHHHHHHHHHHHHHHH-hhhHHHHHhcCCHHHHHHHHHHHHHHHHHH
Confidence            999999999999999998762       223445555555444332211 1111          0               


Q ss_pred             ----hhhch---hcccch--------------------------------------------------HHHHHHhhcCCC
Q 017149          215 ----TRRMN---LTIRSF--------------------------------------------------KQEEIAKGKQRG  237 (376)
Q Consensus       215 ----~r~~~---~~~~dl--------------------------------------------------~~~Ei~~~~~~~  237 (376)
                          ++++.   ....|+                                                  +++||+++++.+
T Consensus       252 ~~i~~r~~~~~~~~~~d~l~~ll~~~~l~~~ei~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~v~~~~  331 (482)
T 3k9v_A          252 PCIDNRLQRYSQQPGADFLCDIYQQDHLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQAQRRLLQEVQSVLPDN  331 (482)
T ss_dssp             HHHHHHHHHTTTCTTSCHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHSCTT
T ss_pred             HHHHHHHHHhccCCchHHHHHHHhccCCCHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHhCHHHHHHHHHHHHHHhCCC
Confidence                11100   001111                                                  889999998877


Q ss_pred             CcCCHHHHhcc-------------cCCccccccccccceeecceeecCcCEEEeechhhccCCCCCCCCCCCCCCCCCCC
Q 017149          238 EFLTWEDLAKM-------------FPPIFGGFRKALKDIEYGRYVIPEGWQIFWVASVTHMDDTIFPEPSKFDPSIFENQ  304 (376)
Q Consensus       238 ~~~~~~~~~~l-------------~p~~~~~~R~~~~d~~l~g~~ip~G~~v~~~~~~~~~d~~~~~~p~~F~P~Rfl~~  304 (376)
                      ..++.+++.+|             +|+++.++|.+.+|++++||.|||||.|.++.+++||||++|+||++|+||||++.
T Consensus       332 ~~~~~~~l~~lpyl~avi~E~lRl~p~~~~~~r~~~~d~~~~g~~ip~Gt~v~~~~~~~~~d~~~~~~p~~F~PeRfl~~  411 (482)
T 3k9v_A          332 QTPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKPTVLGEYALPKGTVLTLNTQVLGSSEDNFEDSHKFRPERWLQK  411 (482)
T ss_dssp             CCCCGGGGGGCHHHHHHHHHHHHHSCSCCEEEEECSSCEEETTEEECTTCEEEEECSGGGGCTTTCSSTTSCCGGGGTCT
T ss_pred             CCCCHHHHhhCHHHHHHHHHHhhcCCCCcCcccccCCceeeCCEEECCCCEEEEccccccCCCccCCCcCccCccccCCC
Confidence            77777766665             99999999999999999999999999999999999999999999999999999986


Q ss_pred             C-CCCCCccccCCCCCCCCcChHHHHHHHHHHHHHHHHhceeeeccCCC-ccccCccccCCCCccEEEeee
Q 017149          305 A-SIPPYCYVPFGAGPRICPGYEFARIETLVAIHYIITHFKWKLLCSDN-FFSRNPTSFPSKGLPVQITPK  373 (376)
Q Consensus       305 ~-~~~~~~~~pFg~G~r~C~G~~~a~~e~~~~l~~ll~~f~~~~~~~~~-~~~~~~~~~~~~~~~v~~~~R  373 (376)
                      + ...+..|+|||.|+|.|+|++||.+|++++++.|+++|+++..+++. ......++.|..+++|++++|
T Consensus       412 ~~~~~~~~~~pFg~G~r~C~G~~~A~~e~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~R  482 (482)
T 3k9v_A          412 EKKINPFAHLPFGIGKRMCIGRRLAELQLHLALCWIIQKYDIVATDNEPVEMLHLGILVPSRELPIAFRPR  482 (482)
T ss_dssp             TSCCCGGGCCTTCCSTTSCSCHHHHHHHHHHHHHHHHHHEEEEESCCCCCCEEESSSEEESSSCCEEEEEC
T ss_pred             CCCCCCccccCCCCCCcCCccHHHHHHHHHHHHHHHHHhcEEeccCCCCcccccceeecCCCCcceEEeeC
Confidence            5 34567899999999999999999999999999999999999876533 445566889999999999997



>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 376
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 1e-25
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 6e-14
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 3e-23
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 7e-16
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 9e-23
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 5e-22
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 1e-13
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 6e-22
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 4e-16
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 9e-22
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 3e-12
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 6e-20
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 7e-15
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 2e-19
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 3e-19
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 2e-18
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 1e-13
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 3e-17
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 4e-17
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 8e-17
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 2e-15
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 2e-15
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 2e-15
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 2e-15
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 7e-15
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 1e-14
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 3e-13
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 3e-12
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  105 bits (262), Expect = 1e-25
 Identities = 38/130 (29%), Positives = 59/130 (45%), Gaps = 5/130 (3%)

Query: 248 MFPPIFGGFRKALKDIEYGRYVIPEGWQIFWVASVTHMDDTIFPEPSKFDPSIF--ENQA 305
           +FP      R   KD+E     IP+G  +   +   H D   + EP KF P  F  +N+ 
Sbjct: 339 LFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKD 398

Query: 306 SIPPYCYVPFGAGPRICPGYEFARIETLVAIHYIITHFKWKLL---CSDNFFSRNPTSFP 362
           +I PY Y PFG+GPR C G  FA +   +A+  ++ +F +K           S      P
Sbjct: 399 NIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQP 458

Query: 363 SKGLPVQITP 372
            K + +++  
Sbjct: 459 EKPVVLKVES 468


>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query376
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.3e-57  Score=423.80  Aligned_cols=338  Identities=21%  Similarity=0.290  Sum_probs=268.7

Q ss_pred             CcccccccccchHHHHHHhhcCCHHHHHHHHHhhcCCceEeecCCCCEEEEeChhHHHHHhhcCCc-cccccchhhHHhh
Q 017149           30 PGSLGIPIIGQSLAFLHAIRSNTAEQWLELRARKYDPISKLNLFGKPTIFIHGQAANKLVFSSDSN-SISNQQTQAITLI  108 (376)
Q Consensus        30 pgp~~~P~~G~~~~~~~~~~~~~~~~~~~~~~~~yg~i~~~~~~~~~~vvv~~p~~~~~i~~~~~~-~~~~~~~~~~~~~  108 (376)
                      |||++||++||++++.+     +++.++.++++|||+||++++++.++|+|+||+++++|+.++.. .++..........
T Consensus        12 PGP~~~P~iG~~~~~~~-----~~~~~~~~~~~kyG~i~~~~l~~~~~vvv~~p~~~~~il~~~~~~~~~~~~~~~~~~~   86 (472)
T d1tqna_          12 PGPTPLPFLGNILSYHK-----GFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGF   86 (472)
T ss_dssp             CCCCCBTTTBTGGGGGG-----CHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCBCCCCSCCGG
T ss_pred             CCCCCcCceeEHHHhhC-----CHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHhcCCcccccCCcccccccc
Confidence            79999999999998864     79999999999999999999999999999999999999987653 3333222222333


Q ss_pred             cCCcccccCCChhHHHHHHHHHccCChHHHHhHHHhHHHHHHHHHHHHh----cCCCceehHHHHHHHHHHHHHHhhccC
Q 017149          109 LGDRSLLNLTGQDHRRVRDALLSFLKPESLKKYVGKIDGEIRQHIEFHR----QGKEQVTVLPLMKTLTFNIICSFLFGL  184 (376)
Q Consensus       109 ~g~~~i~~~~g~~~~~~R~~~~~~~~~~~l~~~~~~~~~~~~~~l~~~~----~~~~~~d~~~~~~~~~~~~~~~~~fG~  184 (376)
                      .+ +++++++|+.|+++|+++.+.|+.+.++.+.+.+++.++.+++. +    ..+..+|+.+.+.++++++++.++||.
T Consensus        87 ~~-~~i~~~~g~~~~~~R~~~~~~~~~~~l~~~~~~~~~~~~~~~~~-l~~~~~~~~~~dl~~~~~~~~~~v~~~~~~G~  164 (472)
T d1tqna_          87 MK-SAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRN-LRREAETGKPVTLKDVFGAYSMDVITSTSFGV  164 (472)
T ss_dssp             GG-GSTTTCCHHHHHHHHHHTTGGGSHHHHHTTHHHHHHHHHHHHHH-HHHHHHHSSCEEHHHHHHHHHHHHHHHTSSCC
T ss_pred             cC-CceeccCcHHHHHhhhhcCccccchhhhcccchhhhhhhccccc-ccccccccccchhhhhhhccchhhhhheeccc
Confidence            44 78889999999999999999999999999999999999998887 4    357789999999999999999999999


Q ss_pred             CCCchhHHHHHHHHHHHhccc------------cccccCChh---------------------hhhchhc----------
Q 017149          185 ERGKQRDQFLGGLQDMIKGAW------------AVPVNLPFK---------------------TRRMNLT----------  221 (376)
Q Consensus       185 ~~~~~~~~~~~~~~~~~~~~~------------~~~~~~p~~---------------------~r~~~~~----------  221 (376)
                      +.+...+..............            .++...|..                     .+++...          
T Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  244 (472)
T d1tqna_         165 NIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDF  244 (472)
T ss_dssp             CCCGGGCTTCHHHHHHTTCCCCCTTSHHHHHHHHCGGGHHHHHHTTCCSSCHHHHHHHHHHHHHHHTTTTTTCSCCCCCH
T ss_pred             ccccccccchhhhHHHHHHhhhhhccchhcccccccccccccccccccccchhhhHHHHHHHHHhhhcccccccccccch
Confidence            876443222111111111100            011111111                     0000000          


Q ss_pred             --------------------ccch-----------------------------------HHHHHHhhcCCCCcCCHHHHh
Q 017149          222 --------------------IRSF-----------------------------------KQEEIAKGKQRGEFLTWEDLA  246 (376)
Q Consensus       222 --------------------~~dl-----------------------------------~~~Ei~~~~~~~~~~~~~~~~  246 (376)
                                          .+++                                   +++||+++++.....+.+++.
T Consensus       245 ~~~~~~~~~~~~~~~~~~ls~~ei~~~~l~l~~Ag~~tta~~l~~~l~~L~~~Pe~~~klr~Ei~~~~~~~~~~~~~~l~  324 (472)
T d1tqna_         245 LQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVL  324 (472)
T ss_dssp             HHHHHHHHCC----CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHSTTTCCCCHHHHH
T ss_pred             hhhhhhcccccccccccchhhhHHHhhhhhhhhcccccccccceeeccccccCccccccccceeheeccccccchHHHhh
Confidence                                0000                                   889999998877666666555


Q ss_pred             cc-------------cCCccccccccccceeecceeecCcCEEEeechhhccCCCCCCCCCCCCCCCCCCCC--CCCCCc
Q 017149          247 KM-------------FPPIFGGFRKALKDIEYGRYVIPEGWQIFWVASVTHMDDTIFPEPSKFDPSIFENQA--SIPPYC  311 (376)
Q Consensus       247 ~l-------------~p~~~~~~R~~~~d~~l~g~~ip~G~~v~~~~~~~~~d~~~~~~p~~F~P~Rfl~~~--~~~~~~  311 (376)
                      ++             +|+++.+.|.+.+|+.++||.|||||.|+++.+++|+||++|+||++|+||||++.+  ...+..
T Consensus       325 ~~~~l~a~i~E~lRl~p~~~~~~r~~~~d~~~~g~~ipkGt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~~~~~  404 (472)
T d1tqna_         325 QMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYI  404 (472)
T ss_dssp             HCHHHHHHHHHHHHHCCTTCCEEEECCSCEEETTEEECTTCEEEECHHHHHTCTTTSSSTTSCCGGGGSTTTGGGCCTTT
T ss_pred             ccccccceeeeccccCCcccccccccccCccccCceeCCCCEEEEechhhhcCchhCCCccccCccccCCCCcccCCCce
Confidence            44             999999999999999999999999999999999999999999999999999999876  446678


Q ss_pred             cccCCCCCCCCcChHHHHHHHHHHHHHHHHhceeeeccCCC-c--cccCccccCCCCccEEEeeec
Q 017149          312 YVPFGAGPRICPGYEFARIETLVAIHYIITHFKWKLLCSDN-F--FSRNPTSFPSKGLPVQITPKK  374 (376)
Q Consensus       312 ~~pFg~G~r~C~G~~~a~~e~~~~l~~ll~~f~~~~~~~~~-~--~~~~~~~~~~~~~~v~~~~R~  374 (376)
                      |+|||+|+|.|||++||.+|++++++.|+++|||++.+++. +  .....++.|+.++.|++++|+
T Consensus       405 ~~~FG~G~r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~R~  470 (472)
T d1tqna_         405 YTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRD  470 (472)
T ss_dssp             SCTTCCSTTSCTTHHHHHHHHHHHHHHHHTTEEEECCTTCCSSCCBCSSSSCCBSSCCEEEEEETT
T ss_pred             ecCCCCCCccChhHHHHHHHHHHHHHHHHHhCEEEeCCCCCCCceeccceEEeeCCCEEEEEEECC
Confidence            99999999999999999999999999999999999887643 2  334447889999999999997



>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure