Citrus Sinensis ID: 017153


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370------
MATFSSHQTQTHFISKLPANKPRTKPMFTRVRMSYQESAPSVAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVTATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDGNHGLDIFVCGDQVRKGAALNAVQIAEMLL
cccccccccccccccccccccccccccccEEEccccccccEEEEEccccHHHHHHHHHHHHcccccccEEEEEEccccccEEEEccCEEEEEEccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEccccccccccccEEcccccHHHHcccccccccccEEEcccHHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccEEEccEEEcccccccCEEEEEEEcccccHHHHHHHHHcccccEEEEcccccccccccccccccccEEEccccccccccccCEEEEEEcccHHHHHHHHHHHHHHHcc
***************************************PSVAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVTATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDGNHGLDIFVCGDQVRKGAALNAVQIAEMLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATFSSHQTQTHFISKLPANKPRTKPMFTRVRMSYQESAPSVAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVTATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDGNHGLDIFVCGDQVRKGAALNAVQIAEMLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aspartate-semialdehyde dehydrogenase Catalyzes the NADPH-dependent formation of L-aspartate-semialdehyde (L-ASA) by the reductive dephosphorylation of L-aspartyl-4-phosphate.probableO67716
Aspartate-semialdehyde dehydrogenase Catalyzes the NADPH-dependent formation of L-aspartate-semialdehyde (L-ASA) by the reductive dephosphorylation of L-aspartyl-4-phosphate.probableO26890
Aspartate-semialdehyde dehydrogenase Catalyzes the NADPH-dependent formation of L-aspartate-semialdehyde (L-ASA) by the reductive dephosphorylation of L-aspartyl-4-phosphate.probableO31219

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.2.-.-Acting on the aldehyde or oxo group of donors.probable
1.2.1.-With NAD(+) or NADP(+) as acceptor.probable
1.2.1.11Aspartate-semialdehyde dehydrogenase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YV3, chain A
Confidence level:very confident
Coverage over the Query: 53-376
View the alignment between query and template
View the model in PyMOL
Template: 3H8V, chain A
Confidence level:probable
Coverage over the Query: 35-132
View the alignment between query and template
View the model in PyMOL