Citrus Sinensis ID: 017153


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370------
MATFSSHQTQTHFISKLPANKPRTKPMFTRVRMSYQESAPSVAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVTATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDGNHGLDIFVCGDQVRKGAALNAVQIAEMLL
cccccccccccccccccccccccccccccEEEccccccccEEEEEccccHHHHHHHHHHHHcccccccEEEEEEccccccEEEEccEEEEEEEccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEccccccccccccEEcccccHHHHcccccccccccEEEcccHHHHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccEEEccEEEcccccccEEEEEEEEcccccHHHHHHHHHcccccEEEEcccccccccccccccccccEEEccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHcc
cccccccccccEEccccccccccccccHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHccccHHHEEEEccccccccEEEEcccEEEEEEcccccccccEEEEEEcccHHHHHHHHHHHHcccEEEEccccccccccccEEEccccHHHHHHHHHHHccccEEEcccHHHHHHHHHHHHHHHcccEEEEEEEEEEcHHHHcHHHHHHHHHHHHHHHcccccccccccHHEEEEccccHcHHccccccHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEEcccEEEEEEcccccHHHHHHHHHccccEEEEEcccccccccccHccccccEEEEEEEcccccccccccEEEEEcHHHHHHHHHHHHHHHHHHc
matfsshqtqthfisklpankprtkpmftRVRMsyqesapsvAVVGVTGAVGQEFLSvlsdrdfpyRSIKMLASKrsagkqlsfqdkaytveeltedsfdgVDIALFSaggsiskkfgpiavekgsivvdnssafrmvenvplvipevnpeamsgikvgmgkgalianpncsTIICLMaatplhrraKVTRMVVSTYQAASGAGAAAMEELELQTREvlegkpptckifSQQYAFNLfshnapvlengyneeEMKMVKETRKIWNDKDVRVTATCIRVPVMRAHaesvnlqfekpldedtardilknapgvvviddrasnhfptplevsnkddvavgrirrdvsqdgnhgldifvcgdqvrkGAALNAVQIAEMLL
matfsshqtqthfisklpankprtKPMFTRVRMSYQESAPSVAVVGVTGAVGQEFLsvlsdrdfpYRSIKMLaskrsagkqlsfQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETrkiwndkdvrVTATCIRVPVMrahaesvnlqfekpldedTARDILKNAPGVVVIddrasnhfptplevsnkddvavGRIRrdvsqdgnhgldIFVCGDQVRKGAALNAVQIAEMLL
MATFSSHQTQTHFISKLPANKPRTKPMFTRVRMSYQESAPSvavvgvtgavgQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQaasgagaaaMEELELQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVTATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDGNHGLDIFVCGDQVRKGAALNAVQIAEMLL
****************************************SVAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLA*********SFQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVTATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHF**********DVAVGRIRRDVSQDGNHGLDIFVCGDQVRKGAALNAVQI*****
***************************************PSVAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVTATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDGNHGLDIFVCGDQVRKGAALNAVQIAEMLL
************FISKLPANKPRTKPMFTRVRMSYQESAPSVAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVTATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDGNHGLDIFVCGDQVRKGAALNAVQIAEMLL
*************I*KLPANKPRTKPMFTRVRMSYQESAPSVAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVTATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDGNHGLDIFVCGDQVRKGAALNAVQIAEMLL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATFSSHQTQTHFISKLPANKPRTKPMFTRVRMSYQESAPSVAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVTATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDGNHGLDIFVCGDQVRKGAALNAVQIAEMLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query376 2.2.26 [Sep-21-2011]
Q55512338 Aspartate-semialdehyde de N/A no 0.869 0.967 0.525 1e-102
P49420343 Aspartate-semialdehyde de yes no 0.893 0.979 0.494 9e-96
O67716340 Aspartate-semialdehyde de yes no 0.875 0.967 0.507 9e-92
O31219347 Aspartate-semialdehyde de yes no 0.875 0.948 0.464 4e-82
Q59291343 Aspartate-semialdehyde de yes no 0.864 0.947 0.467 4e-79
P23247337 Aspartate-semialdehyde de yes no 0.869 0.970 0.456 1e-78
Q04797346 Aspartate-semialdehyde de yes no 0.861 0.936 0.453 5e-77
Q56732338 Aspartate-semialdehyde de N/A no 0.867 0.964 0.439 6e-76
Q56734338 Aspartate-semialdehyde de yes no 0.867 0.964 0.436 8e-76
Q9ZK28346 Aspartate-semialdehyde de yes no 0.856 0.930 0.434 3e-71
>sp|Q55512|DHAS_SYNY3 Aspartate-semialdehyde dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=asd PE=3 SV=2 Back     alignment and function desciption
 Score =  372 bits (954), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/335 (52%), Positives = 244/335 (72%), Gaps = 8/335 (2%)

Query: 42  VAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDG 101
           VA++G TGAVG E L +L+ R+FP   +K+LAS RSAGK L FQ +   ++ +   +F G
Sbjct: 7   VAILGATGAVGTELLELLASRNFPLAELKLLASPRSAGKTLEFQGEKLPIQAVDGSAFKG 66

Query: 102 VDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMG 161
            D+ L SAGGS SK++     + G+++VDNSSAFRMV  VPLV+PE+NPEA         
Sbjct: 67  CDLVLASAGGSTSKRWAEEITKAGAVMVDNSSAFRMVPEVPLVVPEINPEA------AQN 120

Query: 162 KGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEG 221
              +IANPNC+TI+  +A  PLH+   + R+VV+TYQ+ASGAGA AMEE++ Q+R++LEG
Sbjct: 121 HQGIIANPNCTTILMGVAIYPLHQLQPIKRIVVATYQSASGAGAMAMEEVKHQSRDILEG 180

Query: 222 KPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVTATCIRVPVM 281
           K P  +I     AFNLF HN+P+  N Y EEEMKMV+ETRKI+  +D+R+TATC+RVPV+
Sbjct: 181 KIPQAEILPYPLAFNLFPHNSPITANHYCEEEMKMVQETRKIFAAEDIRITATCVRVPVL 240

Query: 282 RAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRR 341
           RAH+E+VNL+F  P   + A+  +  APGV +++D   N+FP P++ + +DDV VGRIR+
Sbjct: 241 RAHSEAVNLEFATPFPVELAKTAIAKAPGVKLVEDWQKNYFPMPMDATGQDDVLVGRIRQ 300

Query: 342 DVSQDGNHGLDIFVCGDQVRKGAALNAVQIAEMLL 376
           D+S    +GLD+++CGDQ+RKGAALNAVQIAE+L+
Sbjct: 301 DISHP--NGLDLWLCGDQIRKGAALNAVQIAELLV 333




Catalyzes the NADPH-dependent formation of L-aspartate-semialdehyde (L-ASA) by the reductive dephosphorylation of L-aspartyl-4-phosphate.
Synechocystis sp. (strain PCC 6803 / Kazusa) (taxid: 1111708)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 1
>sp|P49420|DHAS_PROMA Aspartate-semialdehyde dehydrogenase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=asd PE=3 SV=2 Back     alignment and function description
>sp|O67716|DHAS_AQUAE Aspartate-semialdehyde dehydrogenase OS=Aquifex aeolicus (strain VF5) GN=asd PE=3 SV=1 Back     alignment and function description
>sp|O31219|DHAS_LEGPN Aspartate-semialdehyde dehydrogenase OS=Legionella pneumophila GN=asd PE=3 SV=1 Back     alignment and function description
>sp|Q59291|DHAS_CAMJE Aspartate-semialdehyde dehydrogenase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168) GN=asd PE=1 SV=2 Back     alignment and function description
>sp|P23247|DHAS2_VIBCH Aspartate-semialdehyde dehydrogenase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=asd2 PE=1 SV=2 Back     alignment and function description
>sp|Q04797|DHAS_BACSU Aspartate-semialdehyde dehydrogenase OS=Bacillus subtilis (strain 168) GN=asd PE=1 SV=1 Back     alignment and function description
>sp|Q56732|DHAS_SHESP Aspartate-semialdehyde dehydrogenase OS=Shewanella sp. (strain DB6705) GN=asd PE=3 SV=1 Back     alignment and function description
>sp|Q56734|DHAS_SHEVD Aspartate-semialdehyde dehydrogenase OS=Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12) GN=asd PE=3 SV=2 Back     alignment and function description
>sp|Q9ZK28|DHAS_HELPJ Aspartate-semialdehyde dehydrogenase OS=Helicobacter pylori (strain J99) GN=asd PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query376
224111424375 predicted protein [Populus trichocarpa] 0.997 1.0 0.853 0.0
255584961377 aspartate semialdehyde dehydrogenase, pu 1.0 0.997 0.854 0.0
224099567375 predicted protein [Populus trichocarpa] 0.997 1.0 0.843 0.0
357521393379 Aspartate-semialdehyde dehydrogenase [Me 0.994 0.986 0.837 0.0
356524624377 PREDICTED: aspartate-semialdehyde dehydr 0.997 0.994 0.835 1e-180
15223910375 semialdehyde dehydrogenase-like protein 0.994 0.997 0.840 1e-179
302353426376 aspartate-semialdehyde dehydrogenase 2 [ 1.0 1.0 0.829 1e-178
356513034376 PREDICTED: aspartate-semialdehyde dehydr 1.0 1.0 0.824 1e-177
359472657379 PREDICTED: aspartate-semialdehyde dehydr 0.946 0.939 0.867 1e-176
224147077344 predicted protein [Populus trichocarpa] 0.914 1.0 0.886 1e-176
>gi|224111424|ref|XP_002315850.1| predicted protein [Populus trichocarpa] gi|222864890|gb|EEF02021.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/376 (85%), Positives = 347/376 (92%), Gaps = 1/376 (0%)

Query: 1   MATFSSHQTQTHFISKLPANKPRTKPMFTRVRMSYQESAPSVAVVGVTGAVGQEFLSVLS 60
           MAT +   +QTH  +KL + KP+     +R+RM+ QE+APS+AVVGVTGAVGQEFLSVLS
Sbjct: 1   MATLTHPTSQTHLFTKL-SLKPKKFTSPSRIRMALQENAPSLAVVGVTGAVGQEFLSVLS 59

Query: 61  DRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFGPI 120
           DRDFPYRSIKMLASKRSAGKQL+FQD+ YT+EELTEDSFDGVDIALFSAGGSISK FGP+
Sbjct: 60  DRDFPYRSIKMLASKRSAGKQLTFQDRNYTIEELTEDSFDGVDIALFSAGGSISKHFGPV 119

Query: 121 AVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAA 180
           AVEKGS+VVDNSSAFRM E +PLVIPEVNPEAM GIKVG GKGALIANPNCSTIICLMAA
Sbjct: 120 AVEKGSVVVDNSSAFRMEEGIPLVIPEVNPEAMEGIKVGTGKGALIANPNCSTIICLMAA 179

Query: 181 TPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTCKIFSQQYAFNLFSH 240
           TPLH+ AKV RMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTC IF QQYAFNLFSH
Sbjct: 180 TPLHKHAKVIRMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTCNIFKQQYAFNLFSH 239

Query: 241 NAPVLENGYNEEEMKMVKETRKIWNDKDVRVTATCIRVPVMRAHAESVNLQFEKPLDEDT 300
           NAP+L NGYNEEEMK+VKETRKIWND +V+VTATCIRVPVMRAHAESVNLQFEKP+DE T
Sbjct: 240 NAPILSNGYNEEEMKLVKETRKIWNDMNVKVTATCIRVPVMRAHAESVNLQFEKPIDEHT 299

Query: 301 ARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDGNHGLDIFVCGDQV 360
           A+DILK+APGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDG  GLDIFVCGDQ+
Sbjct: 300 AKDILKSAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDGYKGLDIFVCGDQI 359

Query: 361 RKGAALNAVQIAEMLL 376
           RKGAALNA+QIAEMLL
Sbjct: 360 RKGAALNAIQIAEMLL 375




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255584961|ref|XP_002533192.1| aspartate semialdehyde dehydrogenase, putative [Ricinus communis] gi|223526990|gb|EEF29184.1| aspartate semialdehyde dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224099567|ref|XP_002311534.1| predicted protein [Populus trichocarpa] gi|222851354|gb|EEE88901.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357521393|ref|XP_003630985.1| Aspartate-semialdehyde dehydrogenase [Medicago truncatula] gi|355525007|gb|AET05461.1| Aspartate-semialdehyde dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356524624|ref|XP_003530928.1| PREDICTED: aspartate-semialdehyde dehydrogenase-like [Glycine max] Back     alignment and taxonomy information
>gi|15223910|ref|NP_172934.1| semialdehyde dehydrogenase-like protein [Arabidopsis thaliana] gi|17979524|gb|AAL50097.1| At1g14810/F10B6_6 [Arabidopsis thaliana] gi|20856224|gb|AAM26654.1| At1g14810/F10B6_6 [Arabidopsis thaliana] gi|21536731|gb|AAM61063.1| aspartate-semialdehyde dehydrogenase, putative [Arabidopsis thaliana] gi|332191107|gb|AEE29228.1| semialdehyde dehydrogenase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|302353426|gb|ADL27919.1| aspartate-semialdehyde dehydrogenase 2 [Glycine max] Back     alignment and taxonomy information
>gi|356513034|ref|XP_003525219.1| PREDICTED: aspartate-semialdehyde dehydrogenase-like [Glycine max] Back     alignment and taxonomy information
>gi|359472657|ref|XP_003631183.1| PREDICTED: aspartate-semialdehyde dehydrogenase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224147077|ref|XP_002336402.1| predicted protein [Populus trichocarpa] gi|222834908|gb|EEE73357.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query376
TAIR|locus:2006867375 AT1G14810 [Arabidopsis thalian 0.992 0.994 0.796 9.2e-155
TIGR_CMR|DET_0972338 DET_0972 "aspartate-semialdehy 0.840 0.934 0.472 8.4e-74
TIGR_CMR|CHY_1154339 CHY_1154 "aspartate-semialdehy 0.835 0.926 0.479 1.1e-71
TIGR_CMR|ECH_0016336 ECH_0016 "aspartate-semialdehy 0.835 0.934 0.436 5.6e-68
TIGR_CMR|CPS_3805339 CPS_3805 "aspartate-semialdehy 0.827 0.917 0.456 3.1e-67
TIGR_CMR|SPO_3712340 SPO_3712 "aspartate-semialdehy 0.835 0.923 0.441 7.4e-66
UNIPROTKB|P23247337 asd2 "Aspartate-semialdehyde d 0.837 0.934 0.433 4.1e-65
TIGR_CMR|VC_2107337 VC_2107 "aspartate-semialdehyd 0.837 0.934 0.433 4.1e-65
TIGR_CMR|BA_3937348 BA_3937 "aspartate-semialdehyd 0.840 0.908 0.424 1.8e-64
TIGR_CMR|SO_3070338 SO_3070 "aspartate semialdehyd 0.840 0.934 0.403 6e-64
TAIR|locus:2006867 AT1G14810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1509 (536.3 bits), Expect = 9.2e-155, P = 9.2e-155
 Identities = 301/378 (79%), Positives = 323/378 (85%)

Query:     1 MATFSSHQT-QTHFISKLPAN-KPRTKPMFTRVRMSYQESAPSXXXXXXXXXXXQEFLSV 58
             MATF+ HQT QTHF+S+LP   KPR      RV+MS QESAPS           QEFLSV
Sbjct:     1 MATFT-HQTPQTHFLSRLPLRAKPRH--FSARVKMSLQESAPSLAVVGVTGAVGQEFLSV 57

Query:    59 LSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFG 118
             LSDRDFPY SIKMLASKRSAGK+++F    YTVEELT DSF+GVDIALFSAGGSISK+FG
Sbjct:    58 LSDRDFPYSSIKMLASKRSAGKRVAFDGHEYTVEELTADSFNGVDIALFSAGGSISKEFG 117

Query:   119 PIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLM 178
             P+A EKG+IVVDNSSAFRMV+ VPLVIPEVNPEAM GIKVGMGKGALIANPNCSTIICLM
Sbjct:   118 PLAAEKGTIVVDNSSAFRMVDGVPLVIPEVNPEAMKGIKVGMGKGALIANPNCSTIICLM 177

Query:   179 AATPLHRRAKVTRMVVSTYQXXXXXXXXXMEELELQTREVLEGKPPTCKIFSQQYAFNLF 238
             A TPLH  AKV RMVVSTYQ         MEEL  QTREVLEGKPPTC IF QQYAFNLF
Sbjct:   178 AVTPLHHHAKVKRMVVSTYQAASGAGAAAMEELVQQTREVLEGKPPTCNIFGQQYAFNLF 237

Query:   239 SHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVTATCIRVPVMRAHAESVNLQFEKPLDE 298
             SHNAP+L+NGYNEEEMK+VKETRKIWND +V+VTATCIRVPVMRAHAESVNLQFE PLDE
Sbjct:   238 SHNAPILDNGYNEEEMKLVKETRKIWNDTEVKVTATCIRVPVMRAHAESVNLQFENPLDE 297

Query:   299 DTARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDGNHGLDIFVCGD 358
             +TAR+ILK APGV +IDDRASN FPTPL+VSNKDDVAVGRIRRDVSQDGN GLDIFVCGD
Sbjct:   298 NTAREILKKAPGVYIIDDRASNTFPTPLDVSNKDDVAVGRIRRDVSQDGNFGLDIFVCGD 357

Query:   359 QVRKGAALNAVQIAEMLL 376
             Q+RKGAALNAVQIAEMLL
Sbjct:   358 QIRKGAALNAVQIAEMLL 375




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003942 "N-acetyl-gamma-glutamyl-phosphate reductase activity" evidence=IEA
GO:0004073 "aspartate-semialdehyde dehydrogenase activity" evidence=IEA;IDA
GO:0005737 "cytoplasm" evidence=IEA
GO:0006520 "cellular amino acid metabolic process" evidence=IEA;ISS
GO:0008652 "cellular amino acid biosynthetic process" evidence=IEA
GO:0009086 "methionine biosynthetic process" evidence=IEA
GO:0009088 "threonine biosynthetic process" evidence=IEA
GO:0009089 "lysine biosynthetic process via diaminopimelate" evidence=IEA
GO:0009097 "isoleucine biosynthetic process" evidence=IEA
GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=IEA;ISS
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0006164 "purine nucleotide biosynthetic process" evidence=RCA
GO:0009536 "plastid" evidence=IDA
TIGR_CMR|DET_0972 DET_0972 "aspartate-semialdehyde dehydrogenase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1154 CHY_1154 "aspartate-semialdehyde dehydrogenase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0016 ECH_0016 "aspartate-semialdehyde dehydrogenase" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3805 CPS_3805 "aspartate-semialdehyde dehydrogenase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3712 SPO_3712 "aspartate-semialdehyde dehydrogenase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|P23247 asd2 "Aspartate-semialdehyde dehydrogenase 2" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2107 VC_2107 "aspartate-semialdehyde dehydrogenase, putative" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3937 BA_3937 "aspartate-semialdehyde dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|SO_3070 SO_3070 "aspartate semialdehyde dehydrogenese" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O26890DHAS_METTH1, ., 2, ., 1, ., 1, 10.30070.80050.8674yesno
O31219DHAS_LEGPN1, ., 2, ., 1, ., 1, 10.46420.8750.9481yesno
O67716DHAS_AQUAE1, ., 2, ., 1, ., 1, 10.50740.8750.9676yesno
Q56734DHAS_SHEVD1, ., 2, ., 1, ., 1, 10.43650.86700.9644yesno
P41404DHAS_MYCSM1, ., 2, ., 1, ., 1, 10.40400.86700.9421yesno
P10539DHAS_STRMU1, ., 2, ., 1, ., 1, 10.41660.86430.9078yesno
O25801DHAS_HELPY1, ., 2, ., 1, ., 1, 10.43470.85630.9306yesno
Q1RIB3DHAS_RICBR1, ., 2, ., 1, ., 1, 10.41120.86960.9674yesno
P23247DHAS2_VIBCH1, ., 2, ., 1, ., 1, 10.45690.86960.9703yesno
Q4UM57DHAS_RICFE1, ., 2, ., 1, ., 1, 10.40170.8750.9733yesno
P49420DHAS_PROMA1, ., 2, ., 1, ., 1, 10.49420.89360.9795yesno
Q92IJ0DHAS_RICCN1, ., 2, ., 1, ., 1, 10.40770.8750.9733yesno
P0A542DHAS_MYCTU1, ., 2, ., 1, ., 1, 10.40800.86430.9420yesno
P0A543DHAS_MYCBO1, ., 2, ., 1, ., 1, 10.40800.86430.9420yesno
P0C1D8DHAS_CORGL1, ., 2, ., 1, ., 1, 10.38920.86430.9447yesno
Q68X56DHAS_RICTY1, ., 2, ., 1, ., 1, 10.40170.8750.9733yesno
Q9ZDL2DHAS_RICPR1, ., 2, ., 1, ., 1, 10.39280.8750.9733yesno
Q9ZK28DHAS_HELPJ1, ., 2, ., 1, ., 1, 10.43470.85630.9306yesno
Q59291DHAS_CAMJE1, ., 2, ., 1, ., 1, 10.46780.86430.9475yesno
Q04797DHAS_BACSU1, ., 2, ., 1, ., 1, 10.45340.86170.9364yesno
Q55512DHAS_SYNY31, ., 2, ., 1, ., 1, 10.52530.86960.9674N/Ano
P96199USG_AZOVINo assigned EC number0.31540.86430.9672yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.2.1.110.914
3rd Layer1.2.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query376
PLN02383344 PLN02383, PLN02383, aspartate semialdehyde dehydro 0.0
PRK14874334 PRK14874, PRK14874, aspartate-semialdehyde dehydro 1e-179
COG0136334 COG0136, Asd, Aspartate-semialdehyde dehydrogenase 1e-138
TIGR01296338 TIGR01296, asd_B, aspartate-semialdehyde dehydroge 1e-135
PRK06728347 PRK06728, PRK06728, aspartate-semialdehyde dehydro 2e-82
PRK05671336 PRK05671, PRK05671, aspartate-semialdehyde dehydro 1e-61
PRK08040336 PRK08040, PRK08040, putative semialdehyde dehydrog 8e-60
PRK08664349 PRK08664, PRK08664, aspartate-semialdehyde dehydro 1e-56
TIGR00978341 TIGR00978, asd_EA, aspartate-semialdehyde dehydrog 2e-44
pfam01118121 pfam01118, Semialdhyde_dh, Semialdehyde dehydrogen 6e-38
pfam02774167 pfam02774, Semialdhyde_dhC, Semialdehyde dehydroge 3e-35
smart00859123 smart00859, Semialdhyde_dh, Semialdehyde dehydroge 1e-32
TIGR01745366 TIGR01745, asd_gamma, aspartate-semialdehyde dehyd 2e-24
PRK06598369 PRK06598, PRK06598, aspartate-semialdehyde dehydro 3e-24
COG0002349 COG0002, ArgC, Acetylglutamate semialdehyde dehydr 1e-11
PRK00436343 PRK00436, argC, N-acetyl-gamma-glutamyl-phosphate 2e-09
TIGR01850346 TIGR01850, argC, N-acetyl-gamma-glutamyl-phosphate 7e-09
PRK06901322 PRK06901, PRK06901, aspartate-semialdehyde dehydro 2e-08
PLN02968381 PLN02968, PLN02968, Probable N-acetyl-gamma-glutam 2e-04
>gnl|CDD|178009 PLN02383, PLN02383, aspartate semialdehyde dehydrogenase Back     alignment and domain information
 Score =  689 bits (1779), Expect = 0.0
 Identities = 291/344 (84%), Positives = 319/344 (92%)

Query: 33  MSYQESAPSVAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVE 92
           M+  E+ PSVA+VGVTGAVGQEFLSVL+DRDFPY S+KMLAS RSAGK+++F+ + YTVE
Sbjct: 1   MALTENGPSVAIVGVTGAVGQEFLSVLTDRDFPYSSLKMLASARSAGKKVTFEGRDYTVE 60

Query: 93  ELTEDSFDGVDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEA 152
           ELTEDSFDGVDIALFSAGGSISKKFGPIAV+KG++VVDNSSAFRM E VPLVIPEVNPEA
Sbjct: 61  ELTEDSFDGVDIALFSAGGSISKKFGPIAVDKGAVVVDNSSAFRMEEGVPLVIPEVNPEA 120

Query: 153 MSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELE 212
           M  IK+G GKGALIANPNCSTIICLMA TPLHR AKV RMVVSTYQAASGAGAAAMEELE
Sbjct: 121 MKHIKLGKGKGALIANPNCSTIICLMAVTPLHRHAKVKRMVVSTYQAASGAGAAAMEELE 180

Query: 213 LQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVT 272
            QTREVLEGKPPTC IF+QQYAFNLFSHNAP+ ENGYNEEEMK+VKETRKIWND DV+VT
Sbjct: 181 QQTREVLEGKPPTCNIFAQQYAFNLFSHNAPMQENGYNEEEMKLVKETRKIWNDDDVKVT 240

Query: 273 ATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHFPTPLEVSNKD 332
           ATCIRVPVMRAHAES+NLQFEKPLDE TAR+IL +APGV +IDDRA+N FPTPL+ SNKD
Sbjct: 241 ATCIRVPVMRAHAESINLQFEKPLDEATAREILASAPGVKIIDDRANNRFPTPLDASNKD 300

Query: 333 DVAVGRIRRDVSQDGNHGLDIFVCGDQVRKGAALNAVQIAEMLL 376
           DVAVGRIR+D+SQDGN GLDIFVCGDQ+RKGAALNAVQIAE+LL
Sbjct: 301 DVAVGRIRQDISQDGNKGLDIFVCGDQIRKGAALNAVQIAELLL 344


Length = 344

>gnl|CDD|237845 PRK14874, PRK14874, aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223214 COG0136, Asd, Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233347 TIGR01296, asd_B, aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>gnl|CDD|136022 PRK06728, PRK06728, aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168165 PRK05671, PRK05671, aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|181205 PRK08040, PRK08040, putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236329 PRK08664, PRK08664, aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|233220 TIGR00978, asd_EA, aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>gnl|CDD|201603 pfam01118, Semialdhyde_dh, Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|217222 pfam02774, Semialdhyde_dhC, Semialdehyde dehydrogenase, dimerisation domain Back     alignment and domain information
>gnl|CDD|214863 smart00859, Semialdhyde_dh, Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|130806 TIGR01745, asd_gamma, aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>gnl|CDD|235839 PRK06598, PRK06598, aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|223081 COG0002, ArgC, Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234761 PRK00436, argC, N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>gnl|CDD|233597 TIGR01850, argC, N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>gnl|CDD|235883 PRK06901, PRK06901, aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215522 PLN02968, PLN02968, Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 376
PLN02383344 aspartate semialdehyde dehydrogenase 100.0
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 100.0
PRK08040336 putative semialdehyde dehydrogenase; Provisional 100.0
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 100.0
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 100.0
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 100.0
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 100.0
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 100.0
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 100.0
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 100.0
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 100.0
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 100.0
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 100.0
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 100.0
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 100.0
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
KOG4354340 consensus N-acetyl-gamma-glutamyl-phosphate reduct 100.0
KOG4777361 consensus Aspartate-semialdehyde dehydrogenase [Am 100.0
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 100.0
PRK08955334 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PRK15425331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 100.0
PLN03096395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 100.0
PLN02358338 glyceraldehyde-3-phosphate dehydrogenase 100.0
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 100.0
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
TIGR01534327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 100.0
PRK07403337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PLN02272421 glyceraldehyde-3-phosphate dehydrogenase 100.0
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PLN02237442 glyceraldehyde-3-phosphate dehydrogenase B 100.0
PF02774184 Semialdhyde_dhC: Semialdehyde dehydrogenase, dimer 100.0
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
PTZ00353342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 100.0
PRK08289477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PTZ00434361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 99.97
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 99.96
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 99.94
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 99.9
PRK08300302 acetaldehyde dehydrogenase; Validated 99.87
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 99.74
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 99.63
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 99.44
KOG0657285 consensus Glyceraldehyde 3-phosphate dehydrogenase 99.28
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 99.24
PF02800157 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, 99.13
COG4569310 MhpF Acetaldehyde dehydrogenase (acetylating) [Sec 98.88
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 98.4
PRK00048257 dihydrodipicolinate reductase; Provisional 98.24
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 98.23
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 98.1
PRK13302271 putative L-aspartate dehydrogenase; Provisional 98.06
PRK13303265 L-aspartate dehydrogenase; Provisional 97.97
TIGR00036266 dapB dihydrodipicolinate reductase. 97.97
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 97.95
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 97.86
PRK13301267 putative L-aspartate dehydrogenase; Provisional 97.77
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.72
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 97.7
COG2910211 Putative NADH-flavin reductase [General function p 97.62
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.6
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 97.59
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.49
CHL00194317 ycf39 Ycf39; Provisional 97.42
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 97.41
PRK11579346 putative oxidoreductase; Provisional 97.36
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 97.35
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 97.35
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 97.34
PRK08818370 prephenate dehydrogenase; Provisional 97.29
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.28
PRK06270341 homoserine dehydrogenase; Provisional 97.21
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 97.18
PRK06349426 homoserine dehydrogenase; Provisional 97.15
COG0673342 MviM Predicted dehydrogenases and related proteins 97.14
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 97.13
PLN02256304 arogenate dehydrogenase 97.12
COG2344211 AT-rich DNA-binding protein [General function pred 97.11
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 97.11
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.11
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.1
PLN02775286 Probable dihydrodipicolinate reductase 97.05
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 97.05
PRK06444197 prephenate dehydrogenase; Provisional 97.05
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 97.05
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 97.04
PRK07417279 arogenate dehydrogenase; Reviewed 97.03
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 97.02
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 97.01
PLN02206442 UDP-glucuronate decarboxylase 96.91
PRK07502307 cyclohexadienyl dehydrogenase; Validated 96.88
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 96.84
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 96.78
PRK08655 437 prephenate dehydrogenase; Provisional 96.77
PRK08507275 prephenate dehydrogenase; Validated 96.74
PRK07680273 late competence protein ComER; Validated 96.74
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 96.71
PRK14982340 acyl-ACP reductase; Provisional 96.69
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.67
PRK10206344 putative oxidoreductase; Provisional 96.67
PRK06719157 precorrin-2 dehydrogenase; Validated 96.63
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 96.59
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 96.53
PLN02166436 dTDP-glucose 4,6-dehydratase 96.51
PLN02427386 UDP-apiose/xylose synthase 96.5
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 96.47
PRK08374336 homoserine dehydrogenase; Provisional 96.47
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 96.46
PRK08229341 2-dehydropantoate 2-reductase; Provisional 96.45
PLN02688266 pyrroline-5-carboxylate reductase 96.45
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 96.41
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 96.41
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.41
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 96.37
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.36
PLN02695370 GDP-D-mannose-3',5'-epimerase 96.34
PRK06392326 homoserine dehydrogenase; Provisional 96.34
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 96.28
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.23
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.22
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.21
PLN02712 667 arogenate dehydrogenase 96.21
PLN02712667 arogenate dehydrogenase 96.19
PRK06249313 2-dehydropantoate 2-reductase; Provisional 96.14
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.09
PTZ00431260 pyrroline carboxylate reductase; Provisional 96.07
PLN00016378 RNA-binding protein; Provisional 96.07
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 96.0
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transpor 95.98
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 95.98
KOG4777361 consensus Aspartate-semialdehyde dehydrogenase [Am 95.96
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 95.94
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 95.93
PRK05447385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 95.93
COG5322351 Predicted dehydrogenase [General function predicti 95.93
PRK06545359 prephenate dehydrogenase; Validated 95.92
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 95.89
PRK11908347 NAD-dependent epimerase/dehydratase family protein 95.88
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 95.87
PRK08306296 dipicolinate synthase subunit A; Reviewed 95.86
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 95.84
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 95.83
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.83
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 95.77
PRK06813346 homoserine dehydrogenase; Validated 95.75
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 95.72
PRK12320 699 hypothetical protein; Provisional 95.7
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.69
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 95.65
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 95.63
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.58
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 95.54
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 95.5
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 95.47
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 95.46
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 95.42
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 95.38
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.32
cd01483143 E1_enzyme_family Superfamily of activating enzymes 95.29
PRK05086312 malate dehydrogenase; Provisional 95.25
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 95.18
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.14
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 95.14
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.09
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 95.06
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 95.06
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.05
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 95.03
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.94
PRK15059292 tartronate semialdehyde reductase; Provisional 94.86
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 94.81
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 94.79
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 94.72
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.7
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.64
PLN02214342 cinnamoyl-CoA reductase 94.64
PRK12921305 2-dehydropantoate 2-reductase; Provisional 94.62
COG4091438 Predicted homoserine dehydrogenase [Amino acid tra 94.61
PRK05442326 malate dehydrogenase; Provisional 94.6
PRK06223307 malate dehydrogenase; Reviewed 94.57
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 94.57
PLN02602350 lactate dehydrogenase 94.49
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 94.48
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 94.44
KOG2741351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 94.43
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.43
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 94.36
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 94.33
PRK05479330 ketol-acid reductoisomerase; Provisional 94.28
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 94.2
COG3804350 Uncharacterized conserved protein related to dihyd 94.17
COG3268382 Uncharacterized conserved protein [Function unknow 94.14
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 94.13
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 94.13
PRK08605332 D-lactate dehydrogenase; Validated 94.11
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 94.08
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 94.08
PLN03209 576 translocon at the inner envelope of chloroplast su 94.07
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 94.05
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 94.05
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 93.96
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 93.94
PLN02700377 homoserine dehydrogenase family protein 93.92
PLN02696454 1-deoxy-D-xylulose-5-phosphate reductoisomerase 93.87
PTZ00325321 malate dehydrogenase; Provisional 93.87
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 93.85
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.83
PLN00106323 malate dehydrogenase 93.76
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 93.76
PLN00203519 glutamyl-tRNA reductase 93.76
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 93.73
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 93.71
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 93.7
PRK08219227 short chain dehydrogenase; Provisional 93.68
PRK13940414 glutamyl-tRNA reductase; Provisional 93.67
PRK08618325 ornithine cyclodeaminase; Validated 93.62
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.58
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 93.52
PRK05562223 precorrin-2 dehydrogenase; Provisional 93.51
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 93.5
PLN02778298 3,5-epimerase/4-reductase 93.5
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 93.48
PRK05865 854 hypothetical protein; Provisional 93.48
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 93.45
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 93.4
PLN00112444 malate dehydrogenase (NADP); Provisional 93.39
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 93.39
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 93.37
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.32
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 93.31
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 93.28
PTZ00187317 succinyl-CoA synthetase alpha subunit; Provisional 93.26
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 93.26
PRK12480330 D-lactate dehydrogenase; Provisional 93.24
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 93.24
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 93.21
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 93.21
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.2
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 93.15
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 93.1
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 93.04
PRK06153393 hypothetical protein; Provisional 92.96
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 92.92
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 92.87
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.83
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 92.72
PRK06141314 ornithine cyclodeaminase; Validated 92.72
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 92.7
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 92.66
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 92.66
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 92.65
PRK07574385 formate dehydrogenase; Provisional 92.59
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 92.59
PRK09436819 thrA bifunctional aspartokinase I/homoserine dehyd 92.53
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.45
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 92.44
PRK06046326 alanine dehydrogenase; Validated 92.42
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 92.41
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 92.41
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 92.37
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.35
PRK07201 657 short chain dehydrogenase; Provisional 92.34
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 92.33
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 92.31
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.22
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.14
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 92.12
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.1
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 92.05
PTZ00082321 L-lactate dehydrogenase; Provisional 92.04
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 92.02
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 91.96
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.95
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 91.86
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 91.83
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.81
PRK13243333 glyoxylate reductase; Reviewed 91.76
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 91.69
PTZ00117319 malate dehydrogenase; Provisional 91.66
COG0569225 TrkA K+ transport systems, NAD-binding component [ 91.62
PLN02896353 cinnamyl-alcohol dehydrogenase 91.5
PLN02572442 UDP-sulfoquinovose synthase 91.34
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 91.33
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 91.28
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 91.24
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.16
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 91.14
PLN03139386 formate dehydrogenase; Provisional 91.12
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 91.11
PLN00125300 Succinyl-CoA ligase [GDP-forming] subunit alpha 91.08
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 91.05
PRK05866293 short chain dehydrogenase; Provisional 90.98
PRK05708305 2-dehydropantoate 2-reductase; Provisional 90.97
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 90.9
PLN02353 473 probable UDP-glucose 6-dehydrogenase 90.82
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.82
PRK12829264 short chain dehydrogenase; Provisional 90.8
PRK06436303 glycerate dehydrogenase; Provisional 90.76
PRK06196315 oxidoreductase; Provisional 90.71
PLN00198338 anthocyanidin reductase; Provisional 90.7
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.69
PRK08328231 hypothetical protein; Provisional 90.69
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 90.58
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 90.56
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 90.55
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 90.44
PLN02240352 UDP-glucose 4-epimerase 90.44
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 90.42
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 90.37
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 90.33
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 90.32
PRK09414445 glutamate dehydrogenase; Provisional 90.28
PRK08264238 short chain dehydrogenase; Validated 90.26
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.21
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 90.19
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.18
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 90.17
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 90.03
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 89.95
PRK14031444 glutamate dehydrogenase; Provisional 89.93
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.92
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.89
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 89.83
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.81
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.8
TIGR00243389 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 89.77
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 89.74
PRK06932314 glycerate dehydrogenase; Provisional 89.73
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.45
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 89.44
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 89.42
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 89.42
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.21
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 89.2
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 89.12
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 89.12
PRK07877 722 hypothetical protein; Provisional 89.07
PRK12549284 shikimate 5-dehydrogenase; Reviewed 88.97
PRK06182273 short chain dehydrogenase; Validated 88.96
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.95
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.92
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 88.86
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 88.72
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 88.7
PRK00676338 hemA glutamyl-tRNA reductase; Validated 88.63
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 88.63
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 88.61
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 88.56
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 88.54
PRK05600370 thiamine biosynthesis protein ThiF; Validated 88.53
PRK09291257 short chain dehydrogenase; Provisional 88.44
PLN02650351 dihydroflavonol-4-reductase 88.44
PRK09466810 metL bifunctional aspartate kinase II/homoserine d 88.42
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 88.3
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 88.27
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.25
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.21
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.15
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.0
PRK08291330 ectoine utilization protein EutC; Validated 87.98
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 87.95
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 87.85
PLN02928347 oxidoreductase family protein 87.8
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 87.7
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 87.65
PRK08223287 hypothetical protein; Validated 87.59
PRK08267260 short chain dehydrogenase; Provisional 87.53
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.51
PRK09009235 C factor cell-cell signaling protein; Provisional 87.49
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 87.43
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.4
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 87.38
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.3
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 87.27
PRK12939250 short chain dehydrogenase; Provisional 86.89
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 86.71
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 86.67
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.64
PRK10675338 UDP-galactose-4-epimerase; Provisional 86.48
PRK06823315 ornithine cyclodeaminase; Validated 86.45
PRK07774250 short chain dehydrogenase; Provisional 86.39
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.37
KOG1203411 consensus Predicted dehydrogenase [Carbohydrate tr 86.33
PLN02583297 cinnamoyl-CoA reductase 86.13
PRK10637 457 cysG siroheme synthase; Provisional 86.13
PLN02260 668 probable rhamnose biosynthetic enzyme 86.11
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 86.09
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 85.81
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 85.79
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 85.67
PRK06407301 ornithine cyclodeaminase; Provisional 85.53
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.52
PRK15116268 sulfur acceptor protein CsdL; Provisional 85.49
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 85.39
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 85.39
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.3
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 85.3
PRK13403335 ketol-acid reductoisomerase; Provisional 85.28
PRK07340304 ornithine cyclodeaminase; Validated 85.28
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.27
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.24
PLN02858 1378 fructose-bisphosphate aldolase 85.15
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 85.09
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 85.07
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 85.07
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 85.05
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 84.86
PRK07411390 hypothetical protein; Validated 84.85
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 84.76
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.73
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.62
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 84.53
KOG1494345 consensus NAD-dependent malate dehydrogenase [Ener 84.52
PRK14851 679 hypothetical protein; Provisional 84.52
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 84.45
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 84.39
PRK07326237 short chain dehydrogenase; Provisional 84.36
PRK12828239 short chain dehydrogenase; Provisional 84.28
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 84.25
PRK06487317 glycerate dehydrogenase; Provisional 84.15
PLN02858 1378 fructose-bisphosphate aldolase 84.15
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 84.01
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 84.0
PTZ00075476 Adenosylhomocysteinase; Provisional 84.0
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 84.0
PLN02260668 probable rhamnose biosynthetic enzyme 83.97
PLN02653340 GDP-mannose 4,6-dehydratase 83.94
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 83.89
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 83.77
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 83.74
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 83.67
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 83.54
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 83.46
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 83.21
PTZ00188 506 adrenodoxin reductase; Provisional 83.1
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 83.06
PRK01368 454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.02
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 82.82
PRK08628258 short chain dehydrogenase; Provisional 82.75
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like 82.69
PRK06199379 ornithine cyclodeaminase; Validated 82.61
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 82.58
PRK12464383 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 82.47
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 82.47
PRK14852 989 hypothetical protein; Provisional 82.41
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 82.37
PRK07060245 short chain dehydrogenase; Provisional 82.31
PRK07589346 ornithine cyclodeaminase; Validated 82.26
COG0743385 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 82.21
TIGR01746367 Thioester-redct thioester reductase domain. It has 82.16
PLN02686367 cinnamoyl-CoA reductase 81.94
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 81.83
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 81.58
PRK11730715 fadB multifunctional fatty acid oxidation complex 81.45
PRK09880343 L-idonate 5-dehydrogenase; Provisional 81.4
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 81.39
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 81.36
PRK05875276 short chain dehydrogenase; Provisional 81.35
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 81.24
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 81.19
KOG2733423 consensus Uncharacterized membrane protein [Functi 81.14
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 81.12
PRK07023243 short chain dehydrogenase; Provisional 81.09
PRK09496 453 trkA potassium transporter peripheral membrane com 81.06
PRK09135249 pteridine reductase; Provisional 81.0
PRK10538248 malonic semialdehyde reductase; Provisional 80.99
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 80.97
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.92
PRK06181263 short chain dehydrogenase; Provisional 80.83
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 80.46
PRK12746254 short chain dehydrogenase; Provisional 80.33
PRK14030445 glutamate dehydrogenase; Provisional 80.18
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 80.18
PRK06124256 gluconate 5-dehydrogenase; Provisional 80.17
PRK11154708 fadJ multifunctional fatty acid oxidation complex 80.12
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
Probab=100.00  E-value=4.4e-84  Score=635.27  Aligned_cols=344  Identities=85%  Similarity=1.270  Sum_probs=314.1

Q ss_pred             cCCCCCCCEEEEECcccHHHHHHHHHHhcCCCCCeEEEEEecCCCCCceeeecCcceEEeecCccCCCCCcEEEEcCCCc
Q 017153           33 MSYQESAPSVAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGS  112 (376)
Q Consensus        33 ~~~~~~~irVaIvGaTG~vG~eLlr~L~~~~~p~~~l~~v~s~~~~g~~~~~~~~~~~v~~~~~~~~~~~DvVf~a~~~~  112 (376)
                      |.++.+++||+|+|||||+|++|+|+|.+++||.+++..++|.+++|+.+.+.+.++.+.+++++.+.++|+||+|+|++
T Consensus         1 ~~~~~~~~kVaVvGAtG~vG~eLlrlL~~~~hP~~~l~~las~rsaGk~~~~~~~~~~v~~~~~~~~~~~D~vf~a~p~~   80 (344)
T PLN02383          1 MALTENGPSVAIVGVTGAVGQEFLSVLTDRDFPYSSLKMLASARSAGKKVTFEGRDYTVEELTEDSFDGVDIALFSAGGS   80 (344)
T ss_pred             CCccCCCCeEEEEcCCChHHHHHHHHHHhCCCCcceEEEEEccCCCCCeeeecCceeEEEeCCHHHHcCCCEEEECCCcH
Confidence            34455679999999999999999999999888999999999999999999887667777777766778999999999999


Q ss_pred             hhhhhHHHHHhCCCeEEEcCCCCCCCCCCcEEeeccCHHhhcCcccCCCCCcEEEcCCchHHHHHHHHhHHHHhCCCcEE
Q 017153          113 ISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRM  192 (376)
Q Consensus       113 ~s~~~~~~~~~~G~~VIDlS~~~R~~~~~~~~lpevN~~~i~~~~~~~~~~~iVa~PgC~~ta~~l~L~pL~~~~~i~~v  192 (376)
                      .++++++++.++|++|||+|++||+++++||++||||++.++..+.+..+.++|||||||+|+++++|+||+++++|++|
T Consensus        81 ~s~~~~~~~~~~g~~VIDlS~~fR~~~~~p~~vPEvn~~~i~~~~~~~~~~~iIanPgC~~t~~~laL~PL~~~~~i~~v  160 (344)
T PLN02383         81 ISKKFGPIAVDKGAVVVDNSSAFRMEEGVPLVIPEVNPEAMKHIKLGKGKGALIANPNCSTIICLMAVTPLHRHAKVKRM  160 (344)
T ss_pred             HHHHHHHHHHhCCCEEEECCchhhcCCCCceECCCcCHHHHHhhhhcccCCcEEECCCcHHHHHHHHHHHHHHcCCeeEE
Confidence            99999999999999999999999999999999999999999853211112459999999999999999999999999999


Q ss_pred             EEEEEccccccChHhHHHHHHHhhhhhcCCCCCcccccccccccccccCCCCcCCCchHHHHHHHHHHHHHhCCCCCcEE
Q 017153          193 VVSTYQAASGAGAAAMEELELQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVT  272 (376)
Q Consensus       193 ~v~t~~gvSGaGr~~~~~l~~q~~~~~~~~~~~~~~~~~~~a~niiph~~~~~e~g~~~ee~k~~~e~~~il~~~~~~v~  272 (376)
                      +|++|||+||||+++++++++|+..++++++..+++++++++||++||+|.+.++|++++|.++++|++|+++...++|+
T Consensus       161 vv~t~~~vSGAG~~~~~~l~~q~~~~l~~~~~~~~~~~~~~ayn~~ph~~~~~~~g~~~~E~~~~~e~~kil~~~~~~v~  240 (344)
T PLN02383        161 VVSTYQAASGAGAAAMEELEQQTREVLEGKPPTCNIFAQQYAFNLFSHNAPMQENGYNEEEMKLVKETRKIWNDDDVKVT  240 (344)
T ss_pred             EEEeeecccccCHHHHHHHHHHHHHHhcCCCCchhccCCccccccccccCccccCCCChHHHHHHHHHHHHhCCCCCeEE
Confidence            99999999999999999999999999999988899999999999999999999999999999999999999977778899


Q ss_pred             EEEEEecccceeEeeEEEEeCCCCCHHHHHHHHHhCCCcEEeeCCCCCCCCccccccCCCceEEEEEEeccCCCCCCeEE
Q 017153          273 ATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDGNHGLD  352 (376)
Q Consensus       273 ~t~~~VPv~rG~~~ti~v~l~~~~s~~ei~~~~~~~~~v~v~~~~~~~~~p~~~~v~g~~~v~vg~~~~~~~~~~~~~~~  352 (376)
                      ||||||||+|||+.++|++++++++.++++++|+++|||++++...++.+|+|+++.|+|+|+|||+|+|...++.++++
T Consensus       241 ~t~~~vPv~rG~~~sv~v~~~~~v~~~~~~~~l~~~p~v~v~~~~~~~~~p~p~~v~g~~~v~Vgr~r~~~~~~~~~~l~  320 (344)
T PLN02383        241 ATCIRVPVMRAHAESINLQFEKPLDEATAREILASAPGVKIIDDRANNRFPTPLDASNKDDVAVGRIRQDISQDGNKGLD  320 (344)
T ss_pred             EEeEecCccccEEEEEEEEECCCCCHHHHHHHHhcCCCCEEEeCCCcCCCCccceeCCCceEEEEEEEccCCCCCCCeEE
Confidence            99999999999999999999999999999999999999999976444468999999999999999999875323226899


Q ss_pred             EEEEechHHhhHHHHHHHHHHhcC
Q 017153          353 IFVCGDQVRKGAALNAVQIAEMLL  376 (376)
Q Consensus       353 ~~~~~DNL~kGAAgqAvq~~nl~~  376 (376)
                      +|+++|||+||||||||||||+|+
T Consensus       321 ~~~~~DNL~kGAAg~AVq~an~~~  344 (344)
T PLN02383        321 IFVCGDQIRKGAALNAVQIAELLL  344 (344)
T ss_pred             EEEEEhHHHHHHHHHHHHHHHhhC
Confidence            999999999999999999999985



>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>KOG4354 consensus N-acetyl-gamma-glutamyl-phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>PF02774 Semialdhyde_dhC: Semialdehyde dehydrogenase, dimerisation domain; InterPro: IPR012280 This domain contains N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>KOG0657 consensus Glyceraldehyde 3-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PF02800 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; InterPro: IPR020829 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PTZ00187 succinyl-CoA synthetase alpha subunit; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PLN00125 Succinyl-CoA ligase [GDP-forming] subunit alpha Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK12464 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism] Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query376
2yv3_A331 Crystal Structure Of Aspartate Semialdehyde Dehydro 1e-77
2qz9_A336 Crystal Structure Of Aspartate Semialdehyde Dehydro 3e-71
2r00_C336 Crystal Structure Of Aspartate Semialdehyde Dehydro 7e-70
2gyy_A366 Structure Of Aspartate Semialdehyde Dehydrogenase ( 4e-63
3vos_A362 Crystal Structure Of Aspartate Semialdehyde Dehydro 3e-57
3tz6_A344 Crystal Structure Of Aspartate Semialdehyde Dehydro 4e-57
2hjs_A340 The Structure Of A Probable Aspartate-Semialdehyde 2e-26
1ys4_A354 Structure Of Aspartate-Semialdehyde Dehydrogenase F 5e-17
3uw3_A377 Crystal Structure Of An Aspartate-Semialdehyde Dehy 5e-14
1mc4_A370 Crystal Structure Of Aspartate-Semialdehyde Dehydro 5e-14
1nwc_A371 Crystal Structure Of Aspartate-Semialdehyde Dehydro 1e-13
1pr3_A371 Crystal Structure Of The R103k Mutant Of Aspartate 4e-13
1ps8_A371 Crystal Structure Of The R270k Mutant Of Aspartate 4e-13
1brm_A367 Aspartate Beta-Semialdehyde Dehydrogenase From Esch 6e-13
1t4b_A367 1.6 Angstrom Structure Of Esherichia Coli Aspartate 6e-13
1oza_A371 Crystal Structure Of The R103l Mutant Of Aspartate 1e-12
1pqu_A371 Crystal Structure Of The H277n Mutant Of Aspartate 1e-12
2ep5_A350 Structural Study Of Project Id St1242 From Sulfolob 2e-12
1pqp_A371 Crystal Structure Of The C136s Mutant Of Aspartate 3e-12
1nwh_A371 Crystal Structure Of Aspartate Semialdehyde Dehydro 3e-12
1pu2_A371 Crystal Structure Of The K246r Mutant Of Aspartate 6e-12
1q2x_A371 Crystal Structure Of The E243d Mutant Of Aspartate 8e-12
3hsk_A381 Crystal Structure Of Aspartate Semialdehyde Dehydro 6e-09
4dpk_A359 Structure Of Malonyl-coenzyme A Reductase From Cren 1e-05
>pdb|2YV3|A Chain A, Crystal Structure Of Aspartate Semialdehyde Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 Back     alignment and structure

Iteration: 1

Score = 286 bits (732), Expect = 1e-77, Method: Compositional matrix adjust. Identities = 151/324 (46%), Positives = 206/324 (63%), Gaps = 9/324 (2%) Query: 53 QEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGS 112 +E L VL R+FP +++ AS RSAG +L+F+ + VE L E VD+ L SAGG Sbjct: 14 REILKVLEARNFPLSELRLYASPRSAGVRLAFRGEEIPVEPLPEGPLP-VDLVLASAGGG 72 Query: 113 ISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCS 172 IS+ + E G++VVDNSSA+R VPLV+PEVN E K+ +G +IANPNC+ Sbjct: 73 ISRAKALVWAEGGALVVDNSSAWRYEPWVPLVVPEVNRE-----KIFQHRG-IIANPNCT 126 Query: 173 TIICLMAATPLHRRAKVTRMVVSTYQXXXXXXXXXMEELELQTREVLEGKPPTCKIFSQQ 232 T I MA PLHR + R++V+TYQ MEEL +T L G+ P + F+ Sbjct: 127 TAILAMALWPLHRAFQAKRVIVATYQAASGAGAKAMEELLTETHRFLHGEAPKAEAFAHP 186 Query: 233 YAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVTATCIRVPVMRAHAESVNLQF 292 FN+ H ENGY EEMK+V ET KI+ D +R++AT +RVP +RAHAE+V+++F Sbjct: 187 LPFNVIPHIDAFQENGYTREEMKVVWETHKIFGDDTIRISATAVRVPTLRAHAEAVSVEF 246 Query: 293 EKPLDEDTARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDGNHGLD 352 +P+ + AR++LK APGV V+D+ + +P PL S K DV VGRIR+ ++ + +GLD Sbjct: 247 ARPVTPEAAREVLKEAPGVEVVDEPEAKRYPMPLTASGKWDVEVGRIRKSLAFE--NGLD 304 Query: 353 IFVCGDQVRKGAALNAVQIAEMLL 376 FV GDQ+ KGAALNAVQIAE L Sbjct: 305 FFVVGDQLLKGAALNAVQIAEEWL 328
>pdb|2QZ9|A Chain A, Crystal Structure Of Aspartate Semialdehyde Dehydrogenase Ii From Vibrio Cholerae Length = 336 Back     alignment and structure
>pdb|2R00|C Chain C, Crystal Structure Of Aspartate Semialdehyde Dehydrogenase Ii Complexed With Asa From Vibrio Cholerae Length = 336 Back     alignment and structure
>pdb|2GYY|A Chain A, Structure Of Aspartate Semialdehyde Dehydrogenase (Asadh) From Streptococcus Pneumoniae Length = 366 Back     alignment and structure
>pdb|3VOS|A Chain A, Crystal Structure Of Aspartate Semialdehyde Dehydrogenase Complexed With Glycerol And Sulfate From Mycobacterium Tuberculosis H37rv Length = 362 Back     alignment and structure
>pdb|3TZ6|A Chain A, Crystal Structure Of Aspartate Semialdehyde Dehydrogenase Complexed With Inhibitor Smcs (Cys) And Phosphate From Mycobacterium Tuberculosis H37rv Length = 344 Back     alignment and structure
>pdb|2HJS|A Chain A, The Structure Of A Probable Aspartate-Semialdehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 340 Back     alignment and structure
>pdb|1YS4|A Chain A, Structure Of Aspartate-Semialdehyde Dehydrogenase From Methanococcus Jannaschii Length = 354 Back     alignment and structure
>pdb|3UW3|A Chain A, Crystal Structure Of An Aspartate-Semialdehyde Dehydrogenase From Burkholderia Thailandensis Length = 377 Back     alignment and structure
>pdb|1MC4|A Chain A, Crystal Structure Of Aspartate-Semialdehyde Dehydrogenase From Vibrio Cholerae El Tor Length = 370 Back     alignment and structure
>pdb|1NWC|A Chain A, Crystal Structure Of Aspartate-Semialdehyde Dehydrogenase From Haemophilus Influenzae Length = 371 Back     alignment and structure
>pdb|1PR3|A Chain A, Crystal Structure Of The R103k Mutant Of Aspartate Semialdehyde Dehydrogenase From Haemophilus Influenzae Length = 371 Back     alignment and structure
>pdb|1PS8|A Chain A, Crystal Structure Of The R270k Mutant Of Aspartate Semialdehyde Dehydrogenase From Haemophilus Influenzae Length = 371 Back     alignment and structure
>pdb|1BRM|A Chain A, Aspartate Beta-Semialdehyde Dehydrogenase From Escherichia Coli Length = 367 Back     alignment and structure
>pdb|1T4B|A Chain A, 1.6 Angstrom Structure Of Esherichia Coli Aspartate- Semialdehyde Dehydrogenase. Length = 367 Back     alignment and structure
>pdb|1OZA|A Chain A, Crystal Structure Of The R103l Mutant Of Aspartate Semialdehyde Dehydrogenase From Haemophilus Influenzae Length = 371 Back     alignment and structure
>pdb|1PQU|A Chain A, Crystal Structure Of The H277n Mutant Of Aspartate Semialdehyde Dehydrogenase From Haemophilus Influenzae Bound With Nadp, S-Methyl Cysteine Sulfoxide And Cacodylate Length = 371 Back     alignment and structure
>pdb|2EP5|A Chain A, Structural Study Of Project Id St1242 From Sulfolobus Tokodaii Strain7 Length = 350 Back     alignment and structure
>pdb|1PQP|A Chain A, Crystal Structure Of The C136s Mutant Of Aspartate Semialdehyde Dehydrogenase From Haemophilus Influenzae Bound With Aspartate Semialdehyde And Phosphate Length = 371 Back     alignment and structure
>pdb|1NWH|A Chain A, Crystal Structure Of Aspartate Semialdehyde Dehydrogenase From Haemophilus Influenzae As A Tetrahedral Hemithioacetal Reaction Intermediate At 2.0 A Length = 371 Back     alignment and structure
>pdb|1PU2|A Chain A, Crystal Structure Of The K246r Mutant Of Aspartate Semialdehyde Dehydrogenase From Haemophilus Influenzae Length = 371 Back     alignment and structure
>pdb|1Q2X|A Chain A, Crystal Structure Of The E243d Mutant Of Aspartate Semialdehyde Dehydrogenase From Haemophilus Influenzae Bound With Substrate Aspartate Semialdehyde Length = 371 Back     alignment and structure
>pdb|3HSK|A Chain A, Crystal Structure Of Aspartate Semialdehyde Dehydrogenase With Nadp From Candida Albicans Length = 381 Back     alignment and structure
>pdb|4DPK|A Chain A, Structure Of Malonyl-coenzyme A Reductase From Crenarchaeota Length = 359 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query376
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 0.0
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 0.0
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 0.0
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 0.0
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 0.0
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 1e-176
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 1e-173
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 1e-172
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 1e-137
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 1e-132
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 1e-125
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 9e-13
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 1e-09
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 1e-07
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 2e-05
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 2e-05
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Length = 331 Back     alignment and structure
 Score =  579 bits (1495), Expect = 0.0
 Identities = 167/335 (49%), Positives = 222/335 (66%), Gaps = 9/335 (2%)

Query: 42  VAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDG 101
           VAVVG TGAVG+E L VL  R+FP   +++ AS RSAG +L+F+ +   VE L E     
Sbjct: 3   VAVVGATGAVGREILKVLEARNFPLSELRLYASPRSAGVRLAFRGEEIPVEPLPEGPL-P 61

Query: 102 VDIALFSAGGSISKKFGPIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMG 161
           VD+ L SAGG IS+    +  E G++VVDNSSA+R    VPLV+PEVN E +   +    
Sbjct: 62  VDLVLASAGGGISRAKALVWAEGGALVVDNSSAWRYEPWVPLVVPEVNREKIFQHR---- 117

Query: 162 KGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEG 221
              +IANPNC+T I  MA  PLHR  +  R++V+TYQAASGAGA AMEEL  +T   L G
Sbjct: 118 --GIIANPNCTTAILAMALWPLHRAFQAKRVIVATYQAASGAGAKAMEELLTETHRFLHG 175

Query: 222 KPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDKDVRVTATCIRVPVM 281
           + P  + F+    FN+  H     ENGY  EEMK+V ET KI+ D  +R++AT +RVP +
Sbjct: 176 EAPKAEAFAHPLPFNVIPHIDAFQENGYTREEMKVVWETHKIFGDDTIRISATAVRVPTL 235

Query: 282 RAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRR 341
           RAHAE+V+++F +P+  + AR++LK APGV V+D+  +  +P PL  S K DV VGRIR+
Sbjct: 236 RAHAEAVSVEFARPVTPEAAREVLKEAPGVEVVDEPEAKRYPMPLTASGKWDVEVGRIRK 295

Query: 342 DVSQDGNHGLDIFVCGDQVRKGAALNAVQIAEMLL 376
            ++ +  +GLD FV GDQ+ KGAALNAVQIAE  L
Sbjct: 296 SLAFE--NGLDFFVVGDQLLKGAALNAVQIAEEWL 328


>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Length = 366 Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Length = 340 Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Length = 336 Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Length = 344 Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Length = 377 Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Length = 370 Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Length = 367 Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Length = 350 Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Length = 354 Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Length = 381 Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Length = 312 Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Length = 345 Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Length = 359 Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Length = 337 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Length = 352 Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 351 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query376
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 100.0
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 100.0
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 100.0
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 100.0
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 100.0
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 100.0
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 100.0
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 100.0
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 100.0
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 100.0
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 100.0
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 100.0
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 100.0
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 100.0
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 100.0
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 100.0
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 100.0
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 100.0
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 100.0
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 100.0
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 100.0
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 100.0
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 100.0
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 100.0
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 100.0
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 100.0
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 100.0
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 100.0
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 100.0
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 100.0
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 100.0
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 100.0
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 100.0
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 100.0
3v1y_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 100.0
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 100.0
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 100.0
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 100.0
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 100.0
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 100.0
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 100.0
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 99.96
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 99.71
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 98.54
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.44
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 98.38
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.32
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 98.3
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 98.24
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 98.16
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 98.12
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 98.1
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.08
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 98.07
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 98.04
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 98.03
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 98.02
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 97.99
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 97.95
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 97.93
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 97.93
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 97.91
4had_A350 Probable oxidoreductase protein; structural genomi 97.9
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 97.9
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 97.9
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 97.88
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.88
3euw_A344 MYO-inositol dehydrogenase; protein structure init 97.84
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.84
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.83
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 97.82
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 97.81
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 97.81
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 97.77
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 97.76
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 97.75
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 97.75
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 97.75
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 97.74
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 97.74
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 97.72
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 97.7
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 97.69
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 97.69
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.68
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 97.67
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 97.67
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 97.66
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 97.64
4h3v_A390 Oxidoreductase domain protein; structural genomics 97.64
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.63
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 97.62
1ydw_A362 AX110P-like protein; structural genomics, protein 97.61
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.61
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.56
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 97.55
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 97.52
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.51
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.51
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 97.49
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 97.48
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.47
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 97.42
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 97.41
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 97.41
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 97.41
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 97.39
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 97.37
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 97.37
3oqb_A383 Oxidoreductase; structural genomics, protein struc 97.36
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 97.36
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.35
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.35
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 97.31
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 97.27
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.26
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.23
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.22
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 97.21
4ezb_A317 Uncharacterized conserved protein; structural geno 97.21
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.21
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 97.19
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 97.18
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 97.18
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 97.15
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 97.13
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 97.13
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 97.11
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.1
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 97.1
3slg_A372 PBGP3 protein; structural genomics, seattle struct 97.09
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 97.08
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.08
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 97.07
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 97.07
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 97.05
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 97.05
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 97.04
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 97.04
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 97.04
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 97.03
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 97.03
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 97.02
2duw_A145 Putative COA-binding protein; ligand binding prote 97.02
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 97.02
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 97.01
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 97.0
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 96.98
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 96.98
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 96.97
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 96.96
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 96.96
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 96.95
1r0k_A388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 96.93
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.91
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 96.88
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 96.88
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 96.87
2wm3_A299 NMRA-like family domain containing protein 1; unkn 96.85
1iuk_A140 Hypothetical protein TT1466; structural genomics, 96.84
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 96.84
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 96.83
2d59_A144 Hypothetical protein PH1109; COA binding, structur 96.83
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 96.81
3qha_A296 Putative oxidoreductase; seattle structural genomi 96.81
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 96.8
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 96.79
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 96.79
1vpd_A299 Tartronate semialdehyde reductase; structural geno 96.79
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 96.78
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.77
3btv_A438 Galactose/lactose metabolism regulatory protein GA 96.77
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 96.74
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 96.74
1yb4_A295 Tartronic semialdehyde reductase; structural genom 96.74
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 96.74
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 96.72
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 96.7
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 96.7
3l6d_A306 Putative oxidoreductase; structural genomics, prot 96.68
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 96.67
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 96.66
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 96.63
3ius_A286 Uncharacterized conserved protein; APC63810, silic 96.63
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 96.63
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.6
3a06_A376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 96.6
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 96.59
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 96.58
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 96.58
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 96.57
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 96.55
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 96.53
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 96.52
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 96.52
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 96.5
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 96.49
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 96.46
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 96.45
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 96.44
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 96.43
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 96.43
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 96.43
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 96.4
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.4
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 96.38
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.37
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 96.35
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 96.34
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 96.33
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 96.32
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 96.32
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 96.31
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 96.3
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 96.3
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 96.28
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 96.26
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 96.26
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 96.25
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 96.24
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 96.21
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 96.2
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 96.19
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 96.17
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 96.16
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 96.16
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 96.15
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 96.12
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 96.11
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 96.11
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 96.08
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 96.05
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 95.97
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 95.97
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 95.95
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 95.89
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 95.84
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 95.83
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 95.82
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 95.75
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 95.74
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 95.74
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 95.74
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 95.74
1xq6_A253 Unknown protein; structural genomics, protein stru 95.73
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 95.72
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 95.71
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 95.69
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 95.68
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 95.66
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 95.65
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 95.64
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 95.63
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 95.62
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 95.58
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 95.57
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 95.55
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 95.52
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 95.47
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 95.46
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 95.44
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 95.37
4f6c_A427 AUSA reductase domain protein; thioester reductase 95.31
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 94.26
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 95.25
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 95.25
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 95.24
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 95.23
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 95.23
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 95.21
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 95.19
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 95.18
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 95.17
3mwd_B334 ATP-citrate synthase; ATP-grAsp, phosphohistidine, 95.15
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 95.15
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 95.12
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.1
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 95.09
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 95.08
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 95.08
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 95.06
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 95.05
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 95.03
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 94.99
2rir_A300 Dipicolinate synthase, A chain; structural genomic 94.97
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 94.95
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 94.95
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 94.92
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 94.91
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 94.9
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 94.89
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 94.88
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 94.85
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 94.83
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 94.82
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 94.79
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 94.76
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 94.7
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 94.69
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 94.67
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 94.66
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.66
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 94.65
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 94.64
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 94.63
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 94.61
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 94.58
3p2o_A285 Bifunctional protein fold; structural genomics, ce 94.56
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 94.52
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 94.5
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 94.47
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 94.43
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 94.43
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 94.43
4f6l_B508 AUSA reductase domain protein; thioester reductase 94.41
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 94.39
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 94.38
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 94.36
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 94.32
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 94.26
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 94.21
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 94.21
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 94.17
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 94.15
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 94.15
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 94.11
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.03
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 94.02
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 94.0
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 93.97
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 93.97
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 93.96
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 93.95
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 93.95
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 93.94
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 93.9
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 93.88
3l07_A285 Bifunctional protein fold; structural genomics, ID 93.87
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 93.86
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 93.85
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 93.8
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 93.78
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.73
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 93.73
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 93.7
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 93.69
1id1_A153 Putative potassium channel protein; RCK domain, E. 93.62
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 93.57
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 93.54
2csu_A 457 457AA long hypothetical protein; structural genomi 93.53
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 93.49
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 93.44
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 93.42
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 93.36
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 93.36
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 93.34
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 93.31
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 93.3
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 93.28
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 93.28
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 93.25
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 93.22
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 93.2
3c85_A183 Putative glutathione-regulated potassium-efflux S 93.19
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 93.03
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 92.97
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 92.95
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 92.94
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 92.92
3tl2_A315 Malate dehydrogenase; center for structural genomi 92.87
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 92.73
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 92.72
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 92.71
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 92.69
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 92.66
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 92.65
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 92.6
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 92.59
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 92.59
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 92.52
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 92.42
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 92.41
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 92.3
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 92.29
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 92.25
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 92.25
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 92.24
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 92.24
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 92.16
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 92.1
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 91.96
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 91.96
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 91.95
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 91.55
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 91.54
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 91.49
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 91.48
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 91.46
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 91.44
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 91.44
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 91.41
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 91.36
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 91.29
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 91.15
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 91.11
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 91.09
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 91.06
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 91.01
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 90.88
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 90.81
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 90.8
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 90.79
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 90.79
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 90.68
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 90.62
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 90.61
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 90.46
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 90.46
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 90.44
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 90.32
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 90.21
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 90.17
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 90.02
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 89.86
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 89.82
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 89.79
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 89.78
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 89.75
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 89.72
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 89.71
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 89.63
4g65_A 461 TRK system potassium uptake protein TRKA; structur 89.62
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 89.61
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 89.51
1q0q_A406 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 89.47
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 89.41
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 89.37
2y1e_A398 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 89.29
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 89.25
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 89.14
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 89.13
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 89.11
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 89.0
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 88.81
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 88.72
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 88.7
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 88.65
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 88.59
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 88.54
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 88.48
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 88.39
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 88.38
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 88.33
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 88.13
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 88.11
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 88.04
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 87.87
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 87.84
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 87.8
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 87.74
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 87.52
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 87.22
3pff_A829 ATP-citrate synthase; phosphohistidine, organic ac 87.21
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 87.19
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 87.14
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 86.97
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 86.84
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 86.65
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 86.59
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 86.56
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 86.55
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 86.5
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 86.46
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 86.43
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 86.33
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 86.29
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 86.27
3au8_A488 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 86.19
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 86.16
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 85.84
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 85.8
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 85.62
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 85.51
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 85.4
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 85.37
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 85.37
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 85.35
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 85.3
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 85.28
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 85.11
3gms_A340 Putative NADPH:quinone reductase; structural genom 85.06
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 84.98
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 84.85
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 84.8
1spx_A278 Short-chain reductase family member (5L265); paral 84.75
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 84.75
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 84.74
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 84.7
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
Probab=100.00  E-value=3.1e-82  Score=625.48  Aligned_cols=330  Identities=45%  Similarity=0.699  Sum_probs=304.2

Q ss_pred             CCEEEEECcccHHHHHHHHHHhcCCCCCeEEEEEecCCCCCceeeecCcceEEeecCccCCCCCcEEEEcCCCchhhhhH
Q 017153           39 APSVAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLSFQDKAYTVEELTEDSFDGVDIALFSAGGSISKKFG  118 (376)
Q Consensus        39 ~irVaIvGaTG~vG~eLlr~L~~~~~p~~~l~~v~s~~~~g~~~~~~~~~~~v~~~~~~~~~~~DvVf~a~~~~~s~~~~  118 (376)
                      ++||||+|||||+|++|+|+|.+|+||.+++..++|++++|+.+.+.+.++.+.+.+++.+.++|+||+|+|++.+++++
T Consensus         2 ~~kVaIvGATG~vG~eLlrlL~~~~~p~~el~~~as~~saG~~~~~~~~~~~~~~~~~~~~~~~Dvvf~a~~~~~s~~~a   81 (366)
T 3pwk_A            2 GYTVAVVGATGAVGAQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDITIEETTETAFEGVDIALFSAGSSTSAKYA   81 (366)
T ss_dssp             CEEEEEETTTSHHHHHHHHHHHTCCCCEEEEEEEECTTTTTCEEEETTEEEEEEECCTTTTTTCSEEEECSCHHHHHHHH
T ss_pred             CcEEEEECCCChHHHHHHHHHhcCCCCcEEEEEEEccccCCCcceecCCCceEeeCCHHHhcCCCEEEECCChHhHHHHH
Confidence            58999999999999999999999989999999999999999999987777888877777788999999999999999999


Q ss_pred             HHHHhCCCeEEEcCCCCCCCCCCcEEeeccCHHhhcCcccCCCCCcEEEcCCchHHHHHHHHhHHHHhCCCcEEEEEEEc
Q 017153          119 PIAVEKGSIVVDNSSAFRMVENVPLVIPEVNPEAMSGIKVGMGKGALIANPNCSTIICLMAATPLHRRAKVTRMVVSTYQ  198 (376)
Q Consensus       119 ~~~~~~G~~VIDlS~~~R~~~~~~~~lpevN~~~i~~~~~~~~~~~iVa~PgC~~ta~~l~L~pL~~~~~i~~v~v~t~~  198 (376)
                      ++++++|++|||+|++||+++++||+|||+|++.++.      ..++|||||||||+++++|+||++.++|++++++|+|
T Consensus        82 ~~~~~~G~~vIDlSa~~R~~~~~p~~vpevN~~~i~~------~~~iIanpgC~tt~~~l~l~pL~~~~~i~~i~v~t~~  155 (366)
T 3pwk_A           82 PYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDA------HNGIIACPNCSTIQMMVALEPVRQKWGLDRIIVSTYQ  155 (366)
T ss_dssp             HHHHHTTCEEEECSSTTTTCTTSCBCCHHHHGGGGTT------CCSEEECCCHHHHHHHHHHHHHHHHHCCSEEEEEEEB
T ss_pred             HHHHHCCCEEEEcCCccccCCCceEEEccCCHHHHcC------CCCeEECCCcHHHHHHHHHHHHHHhCCCcEEEEEEEE
Confidence            9999999999999999999999999999999999973      3789999999999999999999999999999999999


Q ss_pred             cccccChHhHHHHHHHhhhhhcC----CCCCccccc-------ccccccccccCCCCcCCCchHHHHHHHHHHHHHhCCC
Q 017153          199 AASGAGAAAMEELELQTREVLEG----KPPTCKIFS-------QQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIWNDK  267 (376)
Q Consensus       199 gvSGaGr~~~~~l~~q~~~~~~~----~~~~~~~~~-------~~~a~niiph~~~~~e~g~~~ee~k~~~e~~~il~~~  267 (376)
                      |+|||||++++++..|+..++++    ++.+...++       .+++||++||+..+.++|++.||+|+++|++|+++..
T Consensus       156 ~vSGAG~~~~~~l~~~~~~~~~~~~~~~~~~~~~y~~~~~HrH~~ia~NviP~I~~~~~~g~t~EE~k~~~E~~kil~~~  235 (366)
T 3pwk_A          156 AVSGAGMGAILETQRELREVLNDGVKPCDLHAEILPSGGDKKHYPIAFNALPQIDVFTDNDYTYEEMKMTKETKKIMEDD  235 (366)
T ss_dssp             CGGGGCHHHHHHHHHHHHHHHHHCCCGGGCCCSSSSCTTSSCCCCCTTCCBCCSSCBCTTSSBHHHHHHHHHHHHHTTCT
T ss_pred             eccccCcchhhHHHHHHHHHhcccccccccCcccCCcccccccchhhccccceecccccCCCcHHHHHHHHHHHHHhcCC
Confidence            99999999999999888776654    222334555       7899999999999899999999999999999999988


Q ss_pred             CCcEEEEEEEecccceeEeeEEEEeCCCCCHHHHHHHHHhCCCcEEeeCCCCCCCCccccccCCCceEEEEEEeccCCCC
Q 017153          268 DVRVTATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQDG  347 (376)
Q Consensus       268 ~~~v~~t~~~VPv~rG~~~ti~v~l~~~~s~~ei~~~~~~~~~v~v~~~~~~~~~p~~~~v~g~~~v~vg~~~~~~~~~~  347 (376)
                      .++|+||||||||+|||++++|++++++++.+|++++|+++|||+|++++..+.+|+|+++.|+|+|+|||+|.|..  .
T Consensus       236 ~~~v~ftp~rVPv~rG~~~tv~v~l~~~~s~eei~~~l~~~~~V~v~~~~~~~~~P~~~~v~gtn~~~Vgr~r~d~~--~  313 (366)
T 3pwk_A          236 SIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIYPQAINAVGSRDTFVGRIRKDLD--A  313 (366)
T ss_dssp             TSEEEEECCBCSCSSCEEEEEEEECSSCCCHHHHHHHHHHSTTEEECCBGGGTBCCCHHHHTTCSSEEEEEEEECSS--C
T ss_pred             CCCeEEEEEEechhccEEEEEEEEECCCCCHHHHHHHHHhCCCcEEecCcccCCCCchhHcCCCCEEEEEEEEecCC--C
Confidence            89999999999999999999999999999999999999999999999876556689999999999999999997643  3


Q ss_pred             CCeEEEEEEechHHhhHHHHHHHHHHhcC
Q 017153          348 NHGLDIFVCGDQVRKGAALNAVQIAEMLL  376 (376)
Q Consensus       348 ~~~~~~~~~~DNL~kGAAgqAvq~~nl~~  376 (376)
                      ++++++|+++|||+||||||||||||+|+
T Consensus       314 ~~~l~~~~~~DNL~KGAAg~AVQn~nlm~  342 (366)
T 3pwk_A          314 EKGIHMWVVSDNLLKGAAWNSVQIAETLH  342 (366)
T ss_dssp             TTEEEEEEEECTTTTTTHHHHHHHHHHHH
T ss_pred             CCEEEEEEEEccHHHhHHHHHHHHHHHHH
Confidence            47899999999999999999999999984



>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3mwd_B ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_B* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1q0q_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase; HET: DXP NDP; 1.90A {Escherichia coli} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1q0l_A* 1q0h_A* 3r0i_A* 1k5h_A 1onn_A 1ono_A 1onp_A* 1jvs_A* 1t1r_A* 1t1s_A* 2egh_A* 3anm_A* 3anl_A* 3ann_A* 3iie_A Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2y1e_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase, DOXP/MEP pathway; 1.65A {Mycobacterium tuberculosis} PDB: 2jcv_A* 2jcz_A* 2jd2_A 2jd1_A 2y1d_A* 2y1c_A 2y1f_A* 2y1g_A* 3ras_A* 4a03_A* 4aic_A* 2jcx_A* 2jcy_A 2jd0_A* 2c82_A Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3pff_A ATP-citrate synthase; phosphohistidine, organic acid, ATP-grAsp, lyase, transferas; HET: TLA ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3au8_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH binding; HET: NDP; 1.86A {Plasmodium falciparum} PDB: 3au9_A* 3aua_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 376
d1t4ba2221 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde d 4e-64
d1mb4a2222 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde d 3e-62
d2gz1a2202 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde d 8e-60
d2hjsa2190 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 2e-57
d2gz1a1154 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semiald 1e-34
d1mb4a1147 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semiald 2e-33
d2czca1162 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate de 1e-31
d2hjsa1144 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog 4e-31
d1cf2o2165 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate de 1e-29
d1b7go2162 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate de 1e-28
d1t4ba1146 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semiald 4e-28
d2cvoa1183 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde 2e-18
d1nvmb1157 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydroge 2e-17
d1vkna1176 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamy 3e-17
d2g17a1179 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamy 3e-13
>d1t4ba2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Length = 221 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: GAPDH-like
domain: Aspartate beta-semialdehyde dehydrogenase
species: Escherichia coli [TaxId: 562]
 Score =  201 bits (513), Expect = 4e-64
 Identities = 58/223 (26%), Positives = 84/223 (37%), Gaps = 31/223 (13%)

Query: 170 NCSTIICLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVL---------- 219
           NC+  + LM+   L     V  + V+TYQAASG GA  M EL  Q   +           
Sbjct: 1   NCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYGHVADELATP 60

Query: 220 ---------------EGKPPTCKIFSQQYAFNLFSHNAPVLENGYNEEEMKMVKETRKIW 264
                                   F    A +L       L+NG + EE K   ET KI 
Sbjct: 61  SSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSREEWKGQAETNKIL 120

Query: 265 -NDKDVRVTATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNA---PGVVVIDDRASN 320
                + V   C+RV  +R H+++  ++ +K +   T  ++L        VV  D   + 
Sbjct: 121 NTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWAKVVPNDREITM 180

Query: 321 HFPTPLEVSNKDDVAVGRIRRDVSQDGNHGLDIFVCGDQVRKG 363
              TP  V+      VGR+R+         L  F  GDQ+  G
Sbjct: 181 RELTPAAVTGTLTTPVGRLRKLNMGP--EFLSAFTVGDQLLWG 221


>d1mb4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Length = 222 Back     information, alignment and structure
>d2gz1a2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Length = 202 Back     information, alignment and structure
>d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Length = 190 Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Length = 154 Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Length = 147 Back     information, alignment and structure
>d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 162 Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Length = 144 Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 165 Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 162 Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Length = 146 Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Length = 183 Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Length = 157 Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Length = 176 Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Length = 179 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query376
d2hjsa2190 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 100.0
d1t4ba2221 Aspartate beta-semialdehyde dehydrogenase {Escheri 100.0
d1mb4a2222 Aspartate beta-semialdehyde dehydrogenase {Vibrio 100.0
d2gz1a2202 Aspartate beta-semialdehyde dehydrogenase {Strepto 100.0
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 100.0
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 100.0
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 100.0
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 100.0
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 99.98
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 99.97
d2cvoa2165 Putative semialdehyde dehydrogenase {Rice (Oryza s 99.97
d1vkna2163 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.96
d2g17a2155 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.96
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 99.94
d1cf2o2165 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.88
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 99.86
d1b7go2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.79
d2czca1162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.75
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.74
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.73
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.71
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.69
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.68
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.67
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.67
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.67
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.66
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.64
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.6
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.59
d1u8fo2164 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.59
d2g82a2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.57
d1k3ta2169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.57
d1obfo2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.57
d1rm4a2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.57
d3cmco2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.54
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.46
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 98.76
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 98.49
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 98.12
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 98.03
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.98
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.97
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.96
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 97.91
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 97.86
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 97.8
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.8
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 97.72
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 97.64
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 97.64
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.59
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.55
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 97.52
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 97.41
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.41
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.17
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.14
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.04
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 97.01
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 96.97
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.95
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.95
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.9
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 96.85
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.8
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 96.68
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 96.67
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 96.66
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 96.65
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.65
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 96.58
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 96.49
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.48
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.46
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 96.46
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 96.45
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 96.36
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 96.32
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.3
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 96.29
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 96.17
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 96.11
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 96.1
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.08
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 96.07
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 95.83
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.76
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 95.63
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 95.61
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.61
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 95.54
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 95.53
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 95.51
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 95.42
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 95.34
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 95.21
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 95.17
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 95.07
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 94.96
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 94.92
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 94.88
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 94.71
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 94.63
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 94.58
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.58
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.48
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.32
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.22
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 94.13
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.95
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 93.85
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.62
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 93.53
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.52
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 93.44
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.27
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 93.12
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.08
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 93.03
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 93.01
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 92.9
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 92.87
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 92.71
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 92.68
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 92.56
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.51
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 92.5
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 92.42
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 92.42
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 92.39
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 92.37
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 92.24
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 91.99
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 91.65
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 91.41
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 91.27
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 91.07
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 90.88
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 90.71
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 90.64
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 90.42
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 90.39
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 90.35
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 89.98
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 89.92
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 89.65
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 89.43
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 89.3
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 89.23
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 89.23
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 89.22
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 88.95
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 88.93
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 88.92
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 88.9
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 88.68
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 88.59
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 88.47
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 88.43
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 88.25
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 88.25
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 88.24
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 88.0
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 87.82
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 87.71
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 87.64
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 87.63
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 87.49
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 87.28
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 86.97
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 86.63
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 86.61
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 86.22
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 86.12
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 86.0
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 85.82
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 85.76
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 85.51
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 85.24
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 85.22
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 85.2
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 84.99
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 84.79
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 84.72
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 84.63
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 84.28
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 84.02
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 83.81
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 83.81
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 83.81
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 83.51
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 83.51
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 83.5
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 83.48
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 83.13
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 83.05
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 82.87
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 82.77
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 82.64
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 82.53
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 82.43
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 82.4
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 82.04
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 81.75
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 81.28
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 81.21
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 80.95
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 80.85
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 80.68
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 80.3
>d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: GAPDH-like
domain: Usg-1 protein homolog PA3116
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=100.00  E-value=8.8e-47  Score=337.38  Aligned_cols=188  Identities=25%  Similarity=0.457  Sum_probs=178.2

Q ss_pred             chHHH-HHHHHhHHHHhCCCcEEEEEEEccccccChHhHHHHHHHhhhhhcCCCCCcccccccccccccccCCCCcCCCc
Q 017153          171 CSTII-CLMAATPLHRRAKVTRMVVSTYQAASGAGAAAMEELELQTREVLEGKPPTCKIFSQQYAFNLFSHNAPVLENGY  249 (376)
Q Consensus       171 C~~ta-~~l~L~pL~~~~~i~~v~v~t~~gvSGaGr~~~~~l~~q~~~~~~~~~~~~~~~~~~~a~niiph~~~~~e~g~  249 (376)
                      |++++ ++++|+||++.++|++++++|||++||+|++++++|++|++.+++|++.++..|+++++||+|||++.+.|+|+
T Consensus         1 Cs~~~qL~~aL~PL~~~~~i~rv~vsTyQavSGaG~~gv~eL~~Qt~~ll~~~~~~~~~fp~~iafNviP~ig~~~~~g~   80 (190)
T d2hjsa2           1 CAVAAELCEVLAPLLATLDCRQLNLTACLSVSSLGREGVKELARQTAELLNARPLEPRLFDRQIAFNLLAQVGAVDAEGH   80 (190)
T ss_dssp             CHHHHHHHHHHHHHTTTCCEEEEEEEEEECGGGGCHHHHHHHHHHHHHHHTTCCCCCSSSSSCCTTCCBSSSSCBCTTSC
T ss_pred             ChhHHHHHHHHHHHHHhhCceEEEEEEEechhhcCHHHHHHHHHHHHHHhccccccccccchhhcccccccccccccccc
Confidence            88764 89999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHHhCCCCCcEEEEEEEecccceeEeeEEEEeCCCCCHHHHHHHHHhCCCcEEeeCCCCCCCCccc-cc
Q 017153          250 NEEEMKMVKETRKIWNDKDVRVTATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDDRASNHFPTPL-EV  328 (376)
Q Consensus       250 ~~ee~k~~~e~~~il~~~~~~v~~t~~~VPv~rG~~~ti~v~l~~~~s~~ei~~~~~~~~~v~v~~~~~~~~~p~~~-~v  328 (376)
                      ++||+|+..|++|||+...+.|+.||+||||++||+.+++++|+++++.++++++|+++|++.++++.   .+|+|. ++
T Consensus        81 t~EE~K~~~Et~KIL~~~~l~vs~TcvRVPV~~gHs~sv~ve~~~~i~~~e~~~~l~~~~gv~~~d~~---~~ptp~~~~  157 (190)
T d2hjsa2          81 SAIERRIFAEVQALLGERIGPLNVTCIQAPVFFGDSLSVTLQCAEPVDLAAVTRVLDATKGIEWVGEG---DYPTVVGDA  157 (190)
T ss_dssp             BHHHHHHHHHHHHHTGGGBCCEEEEEEECSCSSCEEEEEEEEESSCCCHHHHHHHHHHSTTEEECCTT---CCCCCCCCC
T ss_pred             chhhhhhhhhhhhhccCccccceeeeEEeehhhcchhheeeeeecCccHHHHHHHHHhCCCCeeeccc---cCCCCcccc
Confidence            99999999999999998888999999999999999999999999999999999999999999998754   478886 78


Q ss_pred             cCCCceEEEEEEeccCCCCCCeEEEEEEechHHhh
Q 017153          329 SNKDDVAVGRIRRDVSQDGNHGLDIFVCGDQVRKG  363 (376)
Q Consensus       329 ~g~~~v~vg~~~~~~~~~~~~~~~~~~~~DNL~kG  363 (376)
                      .|++.|+|||+|+|..  .++++++|++.||||||
T Consensus       158 ~g~d~v~VGRiR~d~~--~~~~l~~w~v~DnlrkG  190 (190)
T d2hjsa2         158 LGQDETYVGRVRAGQA--DPCQVNLWIVSDNVRKG  190 (190)
T ss_dssp             TTSSCEEEEEEEECSS--CTTEEEEEEEECCCCCC
T ss_pred             cCCcCEEEEeeEcCCC--CCCEEEEEEEeCCcccC
Confidence            9999999999999865  34899999999999998



>d1t4ba2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mb4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2gz1a2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2cvoa2 d.81.1.1 (A:219-383) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vkna2 d.81.1.1 (A:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g17a2 d.81.1.1 (A:154-308) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure