Citrus Sinensis ID: 017154

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370------

MGENMEKTVNKKHKGKHDKPKPWDEDPNIDHWKVEKFDPFWNEGGMLEVSSFSTLFPQYREKYLQEAWPMVKGALKEYGVSCELNLVEGSMTVSTTRKTRDPYIIVKARDLIRLLSRSVPAPQAIKILDDEMQCDIIKIGNLVRNKERFVKRRQHLVGPNSSTLKALEILTGCYILVQGNTVAAMGSFKGLKQVRRIVEDCMQNKMHPVYHIKILMVKKELEKDPALANENWDRFLPKFKKKNVKQKKVKSKEKKPYTPFPPPPQPSKIDKLLESGEYFLSERKKESKKWQEKQEKQAEKTAENKRKRDAAFIPPEEPSRQNSCEAEDKTNDVAAMAKSLKEKAKKLRKQKFAENINPEEYIAASGEKPSKKKKSK

cccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHccEEEEEccccCEEEEcccccccHHHHHHHHHHHHHHHccccHHHHHHHHccccEEEEEEcccccccHHHHHHHHHcccccccHHHHHHHHHHccEEEEEccEEEEEEccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccHHHHcHHHHHHcccccccccccccccccccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccc

****************************IDHWKVEKFDPFWNEGGMLEVSSFSTLFPQYREKYLQEAWPMVKGALKEYGVSCELNLVEGSMTVSTTRKTRDPYIIVKARDLIRLLSRSVPAPQAIKILDDEMQCDIIKIGNLVRNKERFVKRRQHLVGPNSSTLKALEILTGCYILVQGNTVAAMGSFKGLKQVRRIVEDCMQNKMHPVYHIKILMVKKELEKDPALANENWDRFL********************************************************************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
KRR1 small subunit processome component homolog	Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.	probable	O74777
KRR1 small subunit processome component homolog	Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.	probable	Q8BGA5
KRR1 small subunit processome component homolog	Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.	probable	Q13601

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E3U, chain A
Confidence level:very confident
Coverage over the Query: 51-216
View the alignment between query and template
View the model in PyMOL

Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 240-255,270-313
View the alignment between query and template
View the model in PyMOL