Citrus Sinensis ID: 017167

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370------

MADTAGSVSTRRMCSVPEKLQLHLAMVALQFGYAGFHVVSRAALNMGISKLVFPVYRNIIAFLLLLPFAYFLEKKERPAMTLNFALQFILLALVGITANQGFYLLGLENTSPTFASAIQNSVPAITFLMAAIFRIEKVRLDRKDGIAKVVGTLFCVAGATVITLYKGPTIYSPAPPLNQIQPDSLTSTIFLSLGDAKGKNWTLGCVYLIGHCLSWSGWLVMQAPVLKKYPARLSVTAYTCFFGLIQFMIIAAIFERNLDAWIFHNGGEVFSILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIMASFALGEEFYLGGYVPATSPARSILLPNRWMSTCMLSFWIQMFVCLTAICSGPQFTYILPKYV

cccccccHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcHHHHHHHHHHHHHHHHcEEccccccccEEHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHCECccccccccHHHHHHHHHHHccEEEccccEEEEccccc

*************CSVPEKLQLHLAMVALQFGYAGFHVVSRAALNMGISKLVFPVYRNIIAFLLLLPFAYFLEKKERPAMTLNFALQFILLALVGITANQGFYLLGLENTSPTFASAIQNSVPAITFLMAAIFRIEKVRLDRKDGIAKVVGTLFCVAGATVITLYKGPTIYSPAPP*******************AKGKNWTLGCVYLIGHCLSWSGWLVMQAPVLKKYPARLSVTAYTCFFGLIQFMIIAAIFERNLDAWIFHNGGEVFSILYAGVVASGIAFAVQIWCIDRGGPVFVAVYQPVQTLVVAIMASFALGEEFYLGGYVPATSPARSILLPNRWMSTCMLSFWIQMFVCLTAICSGPQFTYILPKYV

xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein WALLS ARE THIN 1	Required for secondary wall formation in fibers, especially in short days conditions. Promotes indole metabolism and transport (e.g. tryptophan, neoglucobrassicin and auxin (indole-3-acetic acid)). May prevent salicylic-acid (SA) accumulation.	confident	Q94AP3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B5D, chain A
Confidence level:probable
Coverage over the Query: 274-344
View the alignment between query and template
View the model in PyMOL

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 90-135,148-164
View the alignment between query and template
View the model in PyMOL