Citrus Sinensis ID: 017200


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-----
MRSRFTLALARTLTSRTRPFSSSAQTPPTEPPTKFPQTLAGLRARLASESPALSDFIDLQSNSSYSVEVGTKKKPLPKPKWMKESIPGGDKYVQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRAPPPPDPDEPTNVAEAIASWGLDYVVITSVDRDDLADQGSGHFAQTVRKLKELKPNMLIEALVPDFRGNNGCVREVAKSGLNVFAHNIETVEELQSAVRDHRANFKQSLDVLMMAKDYVPAGTLTKTSIMLGCGETPDQVVSTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFERYRALGMEMGFRYVASGPMVRSSYKVVGWCYYLIFNYRSTNAV
cccccHHHHHHHccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccCECcccccccHHHHHHHHHHccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccEEEcccccccccccccccccccHHHHHHHHHHHHHccccEECccccccccccHHHHHHHHHHHHHccccc
********************************************************************************WMKESIPGGDKYVQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRAPPPPDPDEPTNVAEAIASWGLDYVVITSVDRDDLADQGSGHFAQTVRKLKELKPNMLIEALVPDFRGNNGCVREVAKSGLNVFAHNIETVEELQSAVRDHRANFKQSLDVLMMAKDYVPAGTLTKTSIMLGCGETPDQVVSTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFERYRALGMEMGFRYVASGPMVRSSYKVVGWCYYLIFNYR*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSRFTLALARTLTSRTRPFSSSAQTPPTEPPTKFPQTLAGLRARLASESPALSDFIDLQSNSSYSVEVGTKKKPLPKPKWMKESIPGGDKYVQIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRAPPPPDPDEPTNVAEAIASWGLDYVVITSVDRDDLADQGSGHFAQTVRKLKELKPNMLIEALVPDFRGNNGCVREVAKSGLNVFAHNIETVEELQSAVRDHRANFKQSLDVLMMAKDYVPAGTLTKTSIMLGCGETPDQVVSTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFERYRALGMEMGFRYVASGPMVRSSYKVVGWCYYLIFNYRSTNAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lipoyl synthase, mitochondrial Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.confidentA5CB81
Lipoyl synthase, mitochondrial Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.confidentB9H5L9
Lipoyl synthase, mitochondrial Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.confidentQ9ZWT1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.8.-.-Transferring sulfur-containing groups.probable
2.8.1.-12-beta-hydroxysteroid dehydrogenase.probable
2.8.1.8Lipoyl synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1R30, chain A
Confidence level:confident
Coverage over the Query: 94-340
View the alignment between query and template
View the model in PyMOL
Template: 1OLT, chain A
Confidence level:confident
Coverage over the Query: 129-356
View the alignment between query and template
View the model in PyMOL