Citrus Sinensis ID: 017211


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-----
MFVQQISGAFHLFLITIFAIAFSINCQPTYNTHICLGPENDTAPAEYIASLNSLFDSLSSKASSESFYNGSSNGIYSLYLCRGDVSTSTCRICVNNATQQLRQRCPSDKRAIIWYDECMLRYSNMNFFGREQTLPRLLMWNSQNNTSPEQQNYGALGLIFSLVDSVPRTDLMFDTKDGIVDNVQRGYALLQCTRDINSSSCRSCLATLTNESQNCCQIRRGWRILSPSCSLRYEEYGFYEQPSAPAPQSTPDGGGKNTKTIVIATVSSVAAVVAALLGLWYYLFRCRRKSRRGEGITEEILLRNFKGSNRPELMEGGILVTEGEDSGEMHYIGLTTILAATNNFSNENKLGEGGFGPVYKGKLPNGKEVAVKSFH
cccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccEEEEcccEEEEEEcccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccEEEEEEcccccccHHHHHHHHHHHHHHHcccccccEEEEEcccEEEEEEcccccccccccccccccccccccccEEEEEEEEEEEHHHHHHHHHHEEEEEEEEEccccccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccEEEEEcccccEEEEEccc
ccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEEEEccEEEEEccccHcccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHcccccHccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHcHHHcccccccEEEcccEEEEEEEEccccccccccccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHccccEEEEEHEEEEEccccccccccccccccccccccccHEEcHHHHHHHHccccHHccccccccccEEccccccccEEEEEEcc
MFVQQISGAFHLFLITIFAIAFSincqptynthiclgpendtapAEYIASLNSLFDSlsskassesfyngssngiYSLYLcrgdvststcrICVNNATQqlrqrcpsdkraiIWYDECMLRysnmnffgreqtlprllmwnsqnntspeqqnygaLGLIFSLvdsvprtdlmfdtkdgivdNVQRGYALLQCtrdinssscRSCLATLTnesqnccqirrgwrilspscslryeeygfyeqpsapapqstpdgggkntkTIVIATVSSVAAVVAALLGLWYYLFRCrrksrrgegitEEILLRnfkgsnrpelmeggilvtegedsgemHYIGLTTILAAtnnfsnenklgeggfgpvykgklpngkeVAVKSFH
MFVQQISGAFHLFLITIFAIAFSINCQPTYNTHICLGPENDTAPAEYIASLNSLFDSLSSKASSESFYNGSSNGIYSLYLCRGDVSTSTCRICVNnatqqlrqrcpsdkRAIIWYDECMLRYSNMNFFGREQTLPRLLMWNSQNNTSPEQQNYGALGLIFSLVDSVPRTDLMFDTKDGIVDNVQRGYALLQCTRDINSSSCRSCLATLtnesqnccqirrgwrilSPSCSLRYEEYGFYEQPSAPAPQSTPDGGGKNTKTIVIATVSSVAAVVAALLGLWYYLFrcrrksrrgegiteeillrnfkgsnrpelmEGGILVTEGEDSGEMHYIGLTTILAATNNFSNENKLGEGgfgpvykgklpngkevavksfh
MFVQQISGAFHLFLITIFAIAFSINCQPTYNTHICLGPENDTAPAEYIASLNslfdslsskassesfYNGSSNGIYSLYLCRGDVSTSTCRICVNNATQQLRQRCPSDKRAIIWYDECMLRYSNMNFFGREQTLPRLLMWNSQNNTSPEQQNYGALGLIFSLVDSVPRTDLMFDTKDGIVDNVQRGYALLQCTRDINSSSCRSCLATLTNESQNCCQIRRGWRILSPSCSLRYEEYGFYEQPSAPAPQSTPDGGGKNTKtiviatvssvaavvaaLLGLWYYLFRCRRKSRRGEGITEEILLRNFKGSNRPELMEGGILVTEGEDSGEMHYIGLTTILAATNNFSNENKLGEGGFGPVYKGKLPNGKEVAVKSFH
***QQISGAFHLFLITIFAIAFSINCQPTYNTHICLGPENDTAPAEYIASLNSLF***********FYNGSSNGIYSLYLCRGDVSTSTCRICVNNATQQLRQRCPSDKRAIIWYDECMLRYSNMNFFGREQTLPRLLMWNS*********NYGALGLIFSLVDSVPRTDLMFDTKDGIVDNVQRGYALLQCTRDINSSSCRSCLATLTNESQNCCQIRRGWRILSPSCSLRYEEYGFY*******************KTIVIATVSSVAAVVAALLGLWYYLFRCRRKSRRGEGITEEILLRNFKG****ELMEGGILVTEGEDSGEMHYIGLTTILAATNNFSNENKLGEGGFGPVY****************
******S***HLFLITIFAIAFSINCQPTYNTHICLGPENDTAPAEYIASLNSLFDSLSSKASSESFYNGSSNGIYSLYLCRGDVSTSTCRICVNNATQQLRQRCPSDKRAIIWYDECMLRYSNMNFFGREQTLPRLLMWNSQNNTSPEQQNYGALGLIFSLVDSVPRTDLMFDTKDGIVDNVQRGYALLQCTRDINSSSCRSCLATLTNESQNCCQIRRGWRILSPSCSLRYEEYGFYE***********************ATVSSVAAVVAALLGLWYYLFRCRRKSRRGEGITEEILLRNFKGSNRP*LM*****V*EGEDSGEMHYIGLTTILAATNNFSNENKLGEGGFGPVYKGKLPNGKEVAVKSFH
MFVQQISGAFHLFLITIFAIAFSINCQPTYNTHICLGPENDTAPAEYIASLNSLFDSL*********YNGSSNGIYSLYLCRGDVSTSTCRICVNNATQQLRQRCPSDKRAIIWYDECMLRYSNMNFFGREQTLPRLLMWNSQNNTSPEQQNYGALGLIFSLVDSVPRTDLMFDTKDGIVDNVQRGYALLQCTRDINSSSCRSCLATLTNESQNCCQIRRGWRILSPSCSLRYEEYGFYEQ*************GKNTKTIVIATVSSVAAVVAALLGLWYYLFRCRRKSRRGEGITEEILLRNFKGSNRPELMEGGILVTEGEDSGEMHYIGLTTILAATNNFSNENKLGEGGFGPVYKGKLPNGKEVAVKSFH
**VQQISGAFHLFLITIFAIAFSINCQPTYNTHICLGPENDTAPAEYIASLNSLFDSLSSKASSESFYNGSSNGIYSLYLCRGDVSTSTCRICVNNATQQLRQRCPSDKRAIIWYDECMLRYSNMNFFGREQTLPRLLMWNSQNNTSPEQQNYGALGLIFSLVDSVPRTDLMFDTKDGIVDNVQRGYALLQCTRDINSSSCRSCLATLTNESQNCCQIRRGWRILSPSCSLRYEEYGFYEQPSA***************TIVIATVSSVAAVVAALLGLWYYLFRCRRKSRRGEGITEEILLRNFKGS***************EDSGEMHYIGLTTILAATNNFSNENKLGEGGFGPVYKGKLPNGKEVAVKSFH
iiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVQQISGAFHLFLITIFAIAFSINCQPTYNTHICLGPENDTAPAEYIASLNSLFDSLSSKASSESFYNGSSNGIYSLYLCRGDVSTSTCRICVNNATQQLRQRCPSDKRAIIWYDECMLRYSNMNFFGREQTLPRLLMWNSQNNTSPEQQNYGALGLIFSLVDSVPRTDLMFDTKDGIVDNVQRGYALLQCTRDINSSSCRSCLATLTNESQNCCQIRRGWRILSPSCSLRYEEYGFYEQPSAPAPQSTPDGGGKNTKTIVIATVSSVAAVVAALLGLWYYLFRCRRKSRRGEGITEEILLRNFKGSNRPELMEGGILVTEGEDSGEMHYIGLTTILAATNNFSNENKLGEGGFGPVYKGKLPNGKEVAVKSFH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query375 2.2.26 [Sep-21-2011]
Q9M0X5 675 Cysteine-rich receptor-li yes no 0.901 0.500 0.350 5e-52
O65482 830 Putative cysteine-rich re no no 0.890 0.402 0.308 3e-37
Q8GYA4 669 Cysteine-rich receptor-li no no 0.842 0.472 0.341 7e-37
Q8S9L6 679 Cysteine-rich receptor-li no no 0.904 0.499 0.313 2e-36
Q9C5S8 659 Cysteine-rich receptor-li no no 0.842 0.479 0.333 6e-35
O49564 642 Cysteine-rich receptor-li no no 0.808 0.471 0.323 2e-34
O65468 676 Cysteine-rich receptor-li no no 0.856 0.474 0.325 3e-34
Q9T0J1 665 Cysteine-rich receptor-li no no 0.874 0.493 0.317 5e-34
Q9LRJ9252 Cysteine-rich repeat secr no no 0.552 0.821 0.372 5e-34
O65479 666 Putative cysteine-rich re no no 0.914 0.515 0.304 5e-33
>sp|Q9M0X5|CRK25_ARATH Cysteine-rich receptor-like protein kinase 25 OS=Arabidopsis thaliana GN=CRK25 PE=2 SV=1 Back     alignment and function desciption
 Score =  205 bits (521), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 136/388 (35%), Positives = 193/388 (49%), Gaps = 50/388 (12%)

Query: 12  LFLITIFAIAFSINCQPTYNTHICLGPENDTAPAEYIASLNSLFDSLSS-KASSESFYNG 70
           LF + +F I  ++   PTY  HIC      +  + Y+ +L ++  SLSS  A+  S ++ 
Sbjct: 11  LFSVFLFMILKTVTSDPTYLYHICPNTTTYSRNSSYLTNLRTVLSSLSSPNAAYASLFDN 70

Query: 71  S-------SNGIYSLYLCRGDVSTSTCRICVNNATQQLRQRCPSDKRAIIWYDECMLRYS 123
           +       SN +Y ++LCRGDVS   CR CV  A  +  QRCP +K A+IWYDECM+RYS
Sbjct: 71  AAAGEENDSNRVYGVFLCRGDVSAEICRDCVAFAANETLQRCPREKVAVIWYDECMVRYS 130

Query: 124 NMNFFGREQTLPRLLMWNSQNNTSPEQQNYGALGLIFSLVDSVPRTDL---MFDTKDGIV 180
           N +  G+ +  P + + N QN T  +   +    L   L+D   +  L    F T+    
Sbjct: 131 NQSIVGQMRIRPGVFLTNKQNITENQVSRFNE-SLPALLIDVAVKAALSSRKFATEKANF 189

Query: 181 DNVQRGYALLQCTRDINSSSCRSCLATLTNESQNCCQIRRGWRILSPSCSLRYEEYGFYE 240
              Q  Y+L+QCT D+ +  C SCL  + N    CC    G R+++PSCS RYE Y FY 
Sbjct: 190 TVFQTIYSLVQCTPDLTNQDCESCLRQVINYLPRCCDRSVGGRVIAPSCSFRYELYPFYN 249

Query: 241 QP--------------SAPAPQSTP--DGGGKNTKTIVIATVSSVAAVVAALLGLWYYLF 284
           +               +AP P + P   G GKN  T+++  ++   +V   LLG   +L 
Sbjct: 250 ETIAAAPMAPPPSSTVTAP-PLNIPSEKGKGKNL-TVIVTAIAVPVSVCVLLLGAMCWLL 307

Query: 285 RCRRKSRRGEGITEEILLRNFKGSNRPELMEGGILVTEGEDSGEMHYIGLTTILAATNNF 344
             RR++ +    TE             +L E GI  TE            + I AATN F
Sbjct: 308 -ARRRNNKLSAETE-------------DLDEDGITSTETLQ------FQFSAIEAATNKF 347

Query: 345 SNENKLGEGGFGPVYKGKLPNGKEVAVK 372
           S  NKLG GGFG VYKG+L  G+ VA+K
Sbjct: 348 SESNKLGHGGFGEVYKGQLITGETVAIK 375





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: -
>sp|O65482|CRK23_ARATH Putative cysteine-rich receptor-like protein kinase 23 OS=Arabidopsis thaliana GN=CRK23 PE=2 SV=1 Back     alignment and function description
>sp|Q8GYA4|CRK10_ARATH Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana GN=CRK10 PE=1 SV=3 Back     alignment and function description
>sp|Q8S9L6|CRK29_ARATH Cysteine-rich receptor-like protein kinase 29 OS=Arabidopsis thaliana GN=CRK29 PE=2 SV=1 Back     alignment and function description
>sp|Q9C5S8|CRK5_ARATH Cysteine-rich receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=1 SV=1 Back     alignment and function description
>sp|O49564|CRK27_ARATH Cysteine-rich receptor-like protein kinase 27 OS=Arabidopsis thaliana GN=CRK27 PE=3 SV=2 Back     alignment and function description
>sp|O65468|CRK8_ARATH Cysteine-rich receptor-like protein kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=2 Back     alignment and function description
>sp|Q9T0J1|CRK26_ARATH Cysteine-rich receptor-like protein kinase 26 OS=Arabidopsis thaliana GN=CRK26 PE=2 SV=1 Back     alignment and function description
>sp|Q9LRJ9|CRR38_ARATH Cysteine-rich repeat secretory protein 38 OS=Arabidopsis thaliana GN=CRRSP38 PE=2 SV=1 Back     alignment and function description
>sp|O65479|CRK20_ARATH Putative cysteine-rich receptor-like protein kinase 20 OS=Arabidopsis thaliana GN=CRK20 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query375
255555051 1390 serine-threonine protein kinase, plant-t 0.930 0.251 0.546 1e-109
359496705 1453 PREDICTED: uncharacterized protein LOC10 0.992 0.256 0.481 6e-91
359496137 704 PREDICTED: cysteine-rich receptor-like p 0.824 0.438 0.489 6e-78
449479654 1230 PREDICTED: cysteine-rich receptor-like p 0.888 0.270 0.424 6e-71
449434362 579 PREDICTED: cysteine-rich receptor-like p 0.762 0.493 0.422 1e-63
224109230268 predicted protein [Populus trichocarpa] 0.586 0.820 0.582 8e-62
449434360 2802 PREDICTED: uncharacterized protein LOC10 0.744 0.099 0.387 1e-57
356510387 647 PREDICTED: cysteine-rich receptor-like p 0.781 0.452 0.407 1e-55
359474717 663 PREDICTED: cysteine-rich receptor-like p 0.861 0.487 0.385 2e-51
147811956 839 hypothetical protein VITISV_019620 [Viti 0.906 0.405 0.368 6e-51
>gi|255555051|ref|XP_002518563.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223542408|gb|EEF43950.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 210/384 (54%), Positives = 264/384 (68%), Gaps = 35/384 (9%)

Query: 1    MFVQQISGAFHLFLITIFAIAFSINCQPTYNTHICLGPENDTAPAEYIASLNSLFDSLSS 60
            MF+   S A    LI I A+A SI+CQ TYN HICLG  NDTA A + ++L +L +SLSS
Sbjct: 742  MFLHHKSNALIFLLIIISALASSIDCQATYNAHICLGAANDTASANFKSNLTALLNSLSS 801

Query: 61   KAS-SESFYNGSSNGIYSLYLCRGDVSTSTCRICVNNATQQLRQRCPSDKRAIIWYDECM 119
            KA+ + SFYN SSNG+YSLYLCRGDVS+ TC++CV  A Q+++++CPS+K AIIWYD+CM
Sbjct: 802  KATLNNSFYNDSSNGVYSLYLCRGDVSSGTCQLCVETAIQEIQRQCPSNKSAIIWYDQCM 861

Query: 120  LRYSNMNFFGREQTLPRLLMWNSQNNTSPEQQNYGALGLIFSLVDSVPRTDLMFDTKDGI 179
            LRYSN  FFG  QT PR+LMWN QNNTSP++ +YGALGLI++L  SVP   +MF T++  
Sbjct: 862  LRYSNTKFFGLAQTSPRVLMWNIQNNTSPDEPDYGALGLIYTLTGSVPYKAMMFGTEESE 921

Query: 180  VDN-VQRGYALLQCTRDINSSSCRSCLATLTNESQNCCQIRRGWRILSPSCSLRYEEYGF 238
             +N  Q+ YAL+QCTRDI+SS+C SCL  L +   +CCQ ++GWRIL+PSC+LRYEE  F
Sbjct: 922  TNNGSQKRYALVQCTRDIDSSACSSCLGELIDSITDCCQGKKGWRILAPSCNLRYEETLF 981

Query: 239  YEQPSAPAPQSTP----------DGGGKNTKTIVIATVSSVAAVVAALLGLWYYLFRCRR 288
            +E PSAP P S P          +GGG NT TI IA  +S   V+ ALLG WYY   C  
Sbjct: 982  FEWPSAP-PVSEPEPENDYYVVNEGGGSNTATIAIAVAASSTVVIGALLGFWYY--SCYY 1038

Query: 289  KSRRGEGITEEILLRNFKGSNRPELMEGGILVTEGEDSGEMHYIGLTTILAATNNFSNEN 348
            K RR                      +G +  +  +++G MHY  LTTI +ATNNFS  N
Sbjct: 1039 KRRRP--------------------TDGEMHASNDDNNGGMHYFNLTTIRSATNNFSTAN 1078

Query: 349  KLGEGGFGPVYKGKLPNGKEVAVK 372
            KLGEGGFGPVYKGKLPNG+E+AVK
Sbjct: 1079 KLGEGGFGPVYKGKLPNGQEIAVK 1102




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359496705|ref|XP_003635307.1| PREDICTED: uncharacterized protein LOC100265431, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496137|ref|XP_003635161.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449479654|ref|XP_004155665.1| PREDICTED: cysteine-rich receptor-like protein kinase 8-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449434362|ref|XP_004134965.1| PREDICTED: cysteine-rich receptor-like protein kinase 8-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224109230|ref|XP_002333290.1| predicted protein [Populus trichocarpa] gi|224116350|ref|XP_002317276.1| predicted protein [Populus trichocarpa] gi|222835846|gb|EEE74281.1| predicted protein [Populus trichocarpa] gi|222860341|gb|EEE97888.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449434360|ref|XP_004134964.1| PREDICTED: uncharacterized protein LOC101207147 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356510387|ref|XP_003523920.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Glycine max] Back     alignment and taxonomy information
>gi|359474717|ref|XP_002267916.2| PREDICTED: cysteine-rich receptor-like protein kinase 25-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147811956|emb|CAN74851.1| hypothetical protein VITISV_019620 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query375
TAIR|locus:2115728 675 CRK25 "cysteine-rich RLK (RECE 0.906 0.503 0.336 3.4e-45
TAIR|locus:2121676 669 CRK10 "cysteine-rich RLK (RECE 0.912 0.511 0.319 4.1e-37
TAIR|locus:2121626 830 CRK23 "cysteine-rich RLK (RECE 0.576 0.260 0.311 2.2e-36
TAIR|locus:2141201 679 CRK29 "cysteine-rich RLK (RECE 0.912 0.503 0.294 2.5e-34
TAIR|locus:2141762 665 CRK26 "cysteine-rich RLK (RECE 0.626 0.353 0.300 2.2e-33
TAIR|locus:2121651 676 CRK8 "cysteine-rich RLK (RECEP 0.92 0.510 0.302 2.3e-32
TAIR|locus:2127323 642 CRK27 "cysteine-rich RLK (RECE 0.912 0.532 0.304 6.6e-32
TAIR|locus:2121686 645 CRK19 "cysteine-rich RLK (RECE 0.552 0.320 0.296 8.2e-32
TAIR|locus:2095662252 AT3G22060 "AT3G22060" [Arabido 0.44 0.654 0.386 3.3e-31
TAIR|locus:2121636 659 CRK7 "cysteine-rich RLK (RECEP 0.898 0.511 0.292 1.5e-30
TAIR|locus:2115728 CRK25 "cysteine-rich RLK (RECEPTOR-like protein kinase) 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 475 (172.3 bits), Expect = 3.4e-45, P = 3.4e-45
 Identities = 130/386 (33%), Positives = 177/386 (45%)

Query:    12 LFLITIFAIAFSINCQPTYNTHICLGPENDTAPAEYIASLNXXXXXXXXXXXXXXXY--N 69
             LF + +F I  ++   PTY  HIC      +  + Y+ +L                   N
Sbjct:    11 LFSVFLFMILKTVTSDPTYLYHICPNTTTYSRNSSYLTNLRTVLSSLSSPNAAYASLFDN 70

Query:    70 GS------SNGIYSLYLCRGDVSTSTCRICVNNATQQLRQRCPSDKRAIIWYDECMLRYS 123
              +      SN +Y ++LCRGDVS   CR CV  A  +  QRCP +K A+IWYDECM+RYS
Sbjct:    71 AAAGEENDSNRVYGVFLCRGDVSAEICRDCVAFAANETLQRCPREKVAVIWYDECMVRYS 130

Query:   124 NMNFFGREQTLPRLLMWNSQNNTSPEQQNYGALGLIFSLVDSVPRTDLM---FDTKDGIV 180
             N +  G+ +  P + + N QN T  +   +    L   L+D   +  L    F T+    
Sbjct:   131 NQSIVGQMRIRPGVFLTNKQNITENQVSRFNE-SLPALLIDVAVKAALSSRKFATEKANF 189

Query:   181 DNVQRGYALLQCTRDINSSSCRSCLATLTNESQNCCQIRRGWRILSPSCSLRYEEYGFYE 240
                Q  Y+L+QCT D+ +  C SCL  + N    CC    G R+++PSCS RYE Y FY 
Sbjct:   190 TVFQTIYSLVQCTPDLTNQDCESCLRQVINYLPRCCDRSVGGRVIAPSCSFRYELYPFYN 249

Query:   241 Q-----PSAPAPQST--------PDGGGKNTKXXXXXXXXXXXXXX-XXLLGLWYYLFRC 286
             +     P AP P ST        P   GK                    LLG   +L   
Sbjct:   250 ETIAAAPMAPPPSSTVTAPPLNIPSEKGKGKNLTVIVTAIAVPVSVCVLLLGAMCWLL-A 308

Query:   287 RRKSRRGEGITEEILLRNFKGSNRPELMEGGILVTEGEDSGEMHYIGLTTILAATNNFSN 346
             RR++ +    TE+             L E GI  TE   + +  +   + I AATN FS 
Sbjct:   309 RRRNNKLSAETED-------------LDEDGITSTE---TLQFQF---SAIEAATNKFSE 349

Query:   347 ENKLGEGGFGPVYKGKLPNGKEVAVK 372
              NKLG GGFG VYKG+L  G+ VA+K
Sbjct:   350 SNKLGHGGFGEVYKGQLITGETVAIK 375




GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0000041 "transition metal ion transport" evidence=RCA
GO:0006826 "iron ion transport" evidence=RCA
GO:0010106 "cellular response to iron ion starvation" evidence=RCA
GO:0010167 "response to nitrate" evidence=RCA
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
TAIR|locus:2121676 CRK10 "cysteine-rich RLK (RECEPTOR-like protein kinase) 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121626 CRK23 "cysteine-rich RLK (RECEPTOR-like protein kinase) 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141201 CRK29 "cysteine-rich RLK (RECEPTOR-like protein kinase) 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141762 CRK26 "cysteine-rich RLK (RECEPTOR-like protein kinase) 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121651 CRK8 "cysteine-rich RLK (RECEPTOR-like protein kinase) 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127323 CRK27 "cysteine-rich RLK (RECEPTOR-like protein kinase) 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121686 CRK19 "cysteine-rich RLK (RECEPTOR-like protein kinase) 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095662 AT3G22060 "AT3G22060" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121636 CRK7 "cysteine-rich RLK (RECEPTOR-like protein kinase) 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00008003001
SubName- Full=Chromosome undetermined scaffold_1177, whole genome shotgun sequence; (666 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query375
pfam01657106 pfam01657, Stress-antifung, Salt stress response/a 1e-25
pfam01657106 pfam01657, Stress-antifung, Salt stress response/a 2e-14
cd05122 253 cd05122, PKc_STE, Catalytic domain of STE family P 4e-04
cd00192 262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 0.002
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 0.003
>gnl|CDD|216632 pfam01657, Stress-antifung, Salt stress response/antifungal Back     alignment and domain information
 Score = 99.1 bits (247), Expect = 1e-25
 Identities = 42/105 (40%), Positives = 59/105 (56%), Gaps = 10/105 (9%)

Query: 33  HICLGPEND---TAPAEYIASLNSLFDSLSSKASSES---FYNGS----SNGIYSLYLCR 82
           H+C    +    TA + + ++LN+L  SLSS A+S S   F  G+     + +Y L  CR
Sbjct: 2   HLCSSNTSGNYTTANSTFESNLNALLSSLSSNAASSSGKGFAAGTSGAAPDTVYGLAQCR 61

Query: 83  GDVSTSTCRICVNNATQQLRQRCPSDKRAIIWYDECMLRYSNMNF 127
           GD+S S CR C+  A  +LR+ CP+ K   IWYD C LRY +  F
Sbjct: 62  GDLSASDCRSCLATAVSELRRCCPNKKGGRIWYDSCFLRYESYPF 106


This domain is often found in association with the kinase domains pfam00069 or pfam07714. In many proteins it is duplicated. It contains six conserved cysteines which are involved in disulphide bridges. It has a role in salt stress response and has antifungal activity. Length = 106

>gnl|CDD|216632 pfam01657, Stress-antifung, Salt stress response/antifungal Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 375
PF01657106 Stress-antifung: Salt stress response/antifungal; 99.89
PF01657106 Stress-antifung: Salt stress response/antifungal; 99.8
KOG1187 361 consensus Serine/threonine protein kinase [Signal 98.97
KOG3653 534 consensus Transforming growth factor beta/activin 98.48
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.9
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 97.5
KOG2052 513 consensus Activin A type IB receptor, serine/threo 97.32
PLN03224 507 probable serine/threonine protein kinase; Provisio 96.98
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 96.75
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 96.54
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 95.92
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 95.85
PTZ00284 467 protein kinase; Provisional 95.31
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 94.78
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 94.47
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 94.44
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 94.26
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 94.15
PTZ00283 496 serine/threonine protein kinase; Provisional 94.13
KOG0192 362 consensus Tyrosine kinase specific for activated ( 94.06
PTZ00036 440 glycogen synthase kinase; Provisional 93.67
smart00090 237 RIO RIO-like kinase. 93.51
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 93.41
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 93.37
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 93.29
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 92.97
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 92.71
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 92.61
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 92.55
PLN00034 353 mitogen-activated protein kinase kinase; Provision 92.53
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 92.33
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 92.33
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 91.92
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 91.86
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 91.46
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 91.15
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 90.69
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 90.62
KOG1027 903 consensus Serine/threonine protein kinase and endo 90.57
KOG0605 550 consensus NDR and related serine/threonine kinases 90.46
KOG0694 694 consensus Serine/threonine protein kinase [Signal 90.17
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 90.12
PF15102146 TMEM154: TMEM154 protein family 89.25
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 88.97
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 88.09
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 87.66
PHA03209 357 serine/threonine kinase US3; Provisional 87.64
KOG1024 563 consensus Receptor-like protein tyrosine kinase RY 86.73
PHA03211 461 serine/threonine kinase US3; Provisional 86.72
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 86.52
KOG1166 974 consensus Mitotic checkpoint serine/threonine prot 86.28
PHA03212 391 serine/threonine kinase US3; Provisional 86.28
PRK09605 535 bifunctional UGMP family protein/serine/threonine 85.82
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 85.41
KOG1167 418 consensus Serine/threonine protein kinase of the C 84.13
KOG0197 468 consensus Tyrosine kinases [Signal transduction me 82.87
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 81.91
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 81.15
KOG1151 775 consensus Tousled-like protein kinase [Signal tran 81.12
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 80.3
COG0661 517 AarF Predicted unusual protein kinase [General fun 80.23
>PF01657 Stress-antifung: Salt stress response/antifungal; InterPro: IPR002902 This domain is found in plants and has no known function Back     alignment and domain information
Probab=99.89  E-value=2.4e-23  Score=165.08  Aligned_cols=96  Identities=41%  Similarity=0.815  Sum_probs=74.9

Q ss_pred             cccCC-C-CCcc-CCCcHHHHHHHHHHHHhHhhcc-C--CCccccccc----eEEEEEeecCCCChhhHHHHHHHHHHHH
Q 017211           32 THICL-G-PEND-TAPAEYIASLNSLFDSLSSKAS-S--ESFYNGSSN----GIYSLYLCRGDVSTSTCRICVNNATQQL  101 (375)
Q Consensus        32 ~~~C~-~-~~~~-~~~~~~~~~l~~ll~~l~~~~~-~--~~f~~~~~g----~vygl~qC~~dl~~~~C~~Cl~~a~~~~  101 (375)
                      ++.|+ + .+++ +.+++|+.+++.||..|...++ .  .+|++++.+    ++|||+||++|+++++|+.||+.|+.++
T Consensus         1 ~~~Cs~~~~~~~~~~~~~f~~~l~~ll~~l~~~a~~~~~~~f~~~~~~~~~~~vYgl~qC~~Dls~~dC~~Cl~~a~~~~   80 (106)
T PF01657_consen    1 WHFCSSNTNNNYTTDNSTFEQNLNSLLSSLVSNAASSSSKGFATGSAGSGPDTVYGLAQCRGDLSPSDCRACLADAVANI   80 (106)
T ss_dssp             ---E---SSB----TT-THHHHHHHHHHHHHHHGGGTT-TEEEEEE--ST---EEEEEEE-TTS-HHHHHHHHHHHHCCH
T ss_pred             CCcCCCCCCCCcCCCCchHHHHHHHHHHHHHHHHhhccccCcEEeecCCCCCeEEEEEEcCCCCChhhhHHHHHHHHHHH
Confidence            36788 3 3566 5677899999999999999987 3  479988654    9999999999999999999999999999


Q ss_pred             HHhCCCCcceEEEccceEEEEccccc
Q 017211          102 RQRCPSDKRAIIWYDECMLRYSNMNF  127 (375)
Q Consensus       102 ~~~c~~~~~a~i~~~~C~lRy~~~~f  127 (375)
                      +++|+.++||+||+++|+|||++++|
T Consensus        81 ~~~C~~~~g~~v~~~~C~lRY~~~~F  106 (106)
T PF01657_consen   81 SSCCPGSRGGRVWYDSCFLRYENYPF  106 (106)
T ss_dssp             HHHTTSBSSEEEEESSEEEEEESS--
T ss_pred             HHhCCCCceEEEECCCEEEEEECCCC
Confidence            99999999999999999999999998



The structure of this domain is known and it is thought to be involved in antifungal responses in plants []. Two copies of this domain are also found together in cysteine-rich protein kinases and cysteine-rich repeat secretory proteins. The domain contains four conserved cysteines.; PDB: 3A2E_D.

>PF01657 Stress-antifung: Salt stress response/antifungal; InterPro: IPR002902 This domain is found in plants and has no known function Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query375
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 4e-07
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 1e-06
2qkw_B 321 Structural Basis For Activation Of Plant Immunity B 8e-04
3hgk_A 327 Crystal Structure Of Effect Protein Avrptob Complex 8e-04
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure

Iteration: 1

Score = 52.4 bits (124), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 24/48 (50%), Positives = 32/48 (66%) Query: 327 GEMHYIGLTTILAATNNFSNENKLGEGGFGPVYKGKLPNGKEVAVKSF 374 G++ L + A++NFSN+N LG GGFG VYKG+L +G VAVK Sbjct: 23 GQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRL 70
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query375
2e79_A108 Ginkbilobin-2; DUF26 fold, C-X8-C-X2-C motif, lect 3e-27
2e79_A108 Ginkbilobin-2; DUF26 fold, C-X8-C-X2-C motif, lect 1e-17
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 5e-18
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 3e-16
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 2e-13
3soc_A 322 Activin receptor type-2A; structural genomics cons 1e-07
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 1e-07
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 2e-05
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 5e-05
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 6e-05
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 6e-05
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 9e-05
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-04
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 2e-04
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 2e-04
3q4u_A 301 Activin receptor type-1; structural genomics conso 2e-04
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 3e-04
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 3e-04
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 4e-04
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 4e-04
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 4e-04
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 6e-04
3niz_A 311 Rhodanese family protein; structural genomics, str 6e-04
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query375
3a2e_A108 Ginkbilobin-2; domain 26 unknown function (DUF26), 99.93
2e79_A108 Ginkbilobin-2; DUF26 fold, C-X8-C-X2-C motif, lect 99.93
3a2e_A108 Ginkbilobin-2; domain 26 unknown function (DUF26), 99.85
2e79_A108 Ginkbilobin-2; DUF26 fold, C-X8-C-X2-C motif, lect 99.84
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 97.56
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 97.17
4aoj_A 329 High affinity nerve growth factor receptor; transf 97.08
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 96.9
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 96.74
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 96.62
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 96.33
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 96.31
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 96.27
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 96.1
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 96.07
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 96.0
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 95.94
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 95.9
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 95.62
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 95.61
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 95.52
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 95.49
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 95.47
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 95.39
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 95.35
1zar_A 282 RIO2 kinase; serine kinase, winged-helix, RIO doma 95.22
3an0_A 340 Dual specificity mitogen-activated protein kinase; 95.16
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 95.13
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 95.12
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 95.12
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 95.07
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 95.04
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 94.88
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 94.87
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 94.82
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 94.79
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 94.72
3uqc_A 286 Probable conserved transmembrane protein; structur 94.71
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 94.65
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 94.62
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 94.59
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 94.58
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 94.56
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 94.53
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 94.52
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 94.51
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 94.51
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 94.5
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 94.5
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 94.48
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 94.36
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 94.35
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 94.3
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 94.3
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 94.3
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 94.28
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 94.22
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 94.2
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 94.2
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 94.19
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 94.18
1zth_A 258 RIO1 serine protein kinase; ribosome biogenesis, r 94.14
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 94.11
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 94.06
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 93.96
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 93.93
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 93.91
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 93.88
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 93.87
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 93.77
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 93.71
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 93.68
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 93.65
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 93.65
3rp9_A 458 Mitogen-activated protein kinase; structural genom 93.65
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 93.63
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 93.48
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 93.47
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 93.43
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 93.4
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 93.4
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 93.4
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 93.39
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 93.35
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 93.29
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 93.28
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 93.28
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 93.26
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 93.2
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 93.05
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 93.02
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 93.01
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 92.91
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 92.85
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 92.85
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 92.75
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 92.63
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 92.5
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 92.44
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 92.32
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 92.18
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 91.93
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 91.92
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 91.86
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 91.6
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 91.43
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 91.14
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 91.02
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 90.84
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 89.84
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 89.42
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 86.98
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 81.29
>3a2e_A Ginkbilobin-2; domain 26 unknown function (DUF26), C-X8-C-X2-C motif, antifungal protein, embryo-abundant protein (EAP), plant protein; 2.38A {Ginkgo biloba} Back     alignment and structure
Probab=99.93  E-value=1.2e-26  Score=182.96  Aligned_cols=100  Identities=15%  Similarity=0.412  Sum_probs=90.5

Q ss_pred             CCCCCcccCCCCCccCCCcHHHHHHHHHHHHhHhhcc--CCCccccccc-----eEEEEEeecCCCChhhHHHHHHHHHH
Q 017211           27 QPTYNTHICLGPENDTAPAEYIASLNSLFDSLSSKAS--SESFYNGSSN-----GIYSLYLCRGDVSTSTCRICVNNATQ   99 (375)
Q Consensus        27 ~~~~~~~~C~~~~~~~~~~~~~~~l~~ll~~l~~~~~--~~~f~~~~~g-----~vygl~qC~~dl~~~~C~~Cl~~a~~   99 (375)
                      ++.++++.|+. ++++++++|+.||+.||..|+++++  ..+|++...+     +||||+|||||+++++|+.||+.|+.
T Consensus         2 ~t~~v~~~Cn~-~~~t~~s~f~~nl~~ll~~L~~~a~~s~~~~~t~~~~~~~~~~vygl~qC~~Dls~~~C~~Cl~~a~~   80 (108)
T 3a2e_A            2 NTAFVSSACNT-QKIPSGSPFNRNLRAMLADLRQNTAFSGYDYKTSRAGSGGAPTAYGRATCKQSISQSDCTACLSNLVN   80 (108)
T ss_dssp             CCCEEEEEECS-SBCCTTCTHHHHHHHHHHHHHHHGGGTTSEEEEEECCSTTCCCEEEEEEECTTSCHHHHHHHHHHHHT
T ss_pred             CcceeeeecCC-CccCCCChHHHHHHHHHHHHHhhCccccCCceEeeccCCCCceEEEEEEEcCCCCHHHHHHHHHHHHH
Confidence            46788899964 7999999999999999999999987  3356665543     89999999999999999999999999


Q ss_pred             HHHHhCCCCcceEEEccceEEEEccccc
Q 017211          100 QLRQRCPSDKRAIIWYDECMLRYSNMNF  127 (375)
Q Consensus       100 ~~~~~c~~~~~a~i~~~~C~lRy~~~~f  127 (375)
                      +++++||+++||+||+++|+||||+++|
T Consensus        81 ~~~~~C~~~~g~~i~~~~C~lRY~~~~F  108 (108)
T 3a2e_A           81 RIFSICNNAIGARVQLVDCFIQYEQRSF  108 (108)
T ss_dssp             THHHHTTSBSSEEEEETTEEEEEESSCC
T ss_pred             HHHHHCCCCceEEEECCCEEEEEeCCcC
Confidence            9999999999999999999999999998



>3a2e_A Ginkbilobin-2; domain 26 unknown function (DUF26), C-X8-C-X2-C motif, antifungal protein, embryo-abundant protein (EAP), plant protein; 2.38A {Ginkgo biloba} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 375
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 3e-08
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 5e-08
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-07
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-07
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 6e-07
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 6e-07
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 9e-07
d1zara2 191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 1e-06
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 1e-06
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 3e-06
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 4e-06
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 5e-06
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 7e-06
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 7e-06
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-05
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 1e-05
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 1e-05
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 2e-05
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-05
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-05
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-05
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 3e-05
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 3e-05
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-05
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 3e-05
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 5e-05
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 5e-05
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 5e-05
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 5e-05
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 5e-05
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 6e-05
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 6e-05
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 7e-05
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 7e-05
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 7e-05
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 8e-05
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 9e-05
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 1e-04
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 1e-04
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 1e-04
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-04
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 1e-04
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 1e-04
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-04
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 1e-04
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-04
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-04
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 2e-04
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-04
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-04
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-04
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 2e-04
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 3e-04
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 4e-04
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 4e-04
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 5e-04
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 5e-04
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 5e-04
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 7e-04
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 8e-04
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 9e-04
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 0.002
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 0.002
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: c-src tyrosine kinase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 52.0 bits (124), Expect = 3e-08
 Identities = 12/34 (35%), Positives = 17/34 (50%)

Query: 342 NNFSNENKLGEGGFGPVYKGKLPNGKEVAVKSFH 375
            +   E KLG+G FG V+ G       VA+K+  
Sbjct: 17  ESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLK 50


>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query375
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 96.82
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 96.34
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 95.99
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 95.95
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 95.55
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Hepatocyte growth factor receptor, c-MET
species: Human (Homo sapiens) [TaxId: 9606]
Probab=96.82  E-value=0.00023  Score=63.75  Aligned_cols=32  Identities=41%  Similarity=0.699  Sum_probs=24.9

Q ss_pred             ccccccceeccCCCcceEEEEcCCC----CEEEEEecC
Q 017211          342 NNFSNENKLGEGGFGPVYKGKLPNG----KEVAVKSFH  375 (375)
Q Consensus       342 ~~Fs~~n~iG~G~fG~VYKg~L~~G----~~VAVKrL~  375 (375)
                      -+|+  ++||+|+||+||||.+.+.    ..||||+++
T Consensus        29 ~~~~--~~iG~G~fg~Vyk~~~~~~~~~~~~vAvK~~~   64 (311)
T d1r0pa_          29 VHFN--EVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLN   64 (311)
T ss_dssp             EEEE--EEEEEETTEEEEEEEECC----CEEEEEEEEC
T ss_pred             eccc--eEEeecCCeEEEEEEEECCCCEEEEEEEEEEC
Confidence            3453  7899999999999998543    268999874



>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure