Citrus Sinensis ID: 017218
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 375 | 2.2.26 [Sep-21-2011] | |||||||
| Q9M0X5 | 675 | Cysteine-rich receptor-li | yes | no | 0.901 | 0.500 | 0.350 | 5e-52 | |
| O65482 | 830 | Putative cysteine-rich re | no | no | 0.890 | 0.402 | 0.308 | 3e-37 | |
| Q8GYA4 | 669 | Cysteine-rich receptor-li | no | no | 0.842 | 0.472 | 0.341 | 7e-37 | |
| Q8S9L6 | 679 | Cysteine-rich receptor-li | no | no | 0.904 | 0.499 | 0.313 | 2e-36 | |
| Q9C5S8 | 659 | Cysteine-rich receptor-li | no | no | 0.842 | 0.479 | 0.333 | 6e-35 | |
| O49564 | 642 | Cysteine-rich receptor-li | no | no | 0.808 | 0.471 | 0.323 | 2e-34 | |
| O65468 | 676 | Cysteine-rich receptor-li | no | no | 0.856 | 0.474 | 0.325 | 3e-34 | |
| Q9T0J1 | 665 | Cysteine-rich receptor-li | no | no | 0.874 | 0.493 | 0.317 | 5e-34 | |
| Q9LRJ9 | 252 | Cysteine-rich repeat secr | no | no | 0.552 | 0.821 | 0.372 | 5e-34 | |
| O65479 | 666 | Putative cysteine-rich re | no | no | 0.914 | 0.515 | 0.304 | 5e-33 |
| >sp|Q9M0X5|CRK25_ARATH Cysteine-rich receptor-like protein kinase 25 OS=Arabidopsis thaliana GN=CRK25 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 205 bits (521), Expect = 5e-52, Method: Compositional matrix adjust.
Identities = 136/388 (35%), Positives = 193/388 (49%), Gaps = 50/388 (12%)
Query: 12 LFLITIFAIAFSINCQPTYNTHICLGPENDTAPAEYIASLNSLFDSLSS-KASSESFYNG 70
LF + +F I ++ PTY HIC + + Y+ +L ++ SLSS A+ S ++
Sbjct: 11 LFSVFLFMILKTVTSDPTYLYHICPNTTTYSRNSSYLTNLRTVLSSLSSPNAAYASLFDN 70
Query: 71 S-------SNGIYSLYLCRGDVSTSTCRICVNNATQQLRQRCPSDKRAIIWYDECMLRYS 123
+ SN +Y ++LCRGDVS CR CV A + QRCP +K A+IWYDECM+RYS
Sbjct: 71 AAAGEENDSNRVYGVFLCRGDVSAEICRDCVAFAANETLQRCPREKVAVIWYDECMVRYS 130
Query: 124 NMNFFGREQTLPRLLMWNSQNNTSPEQQNYGALGLIFSLVDSVPRTDL---MFDTKDGIV 180
N + G+ + P + + N QN T + + L L+D + L F T+
Sbjct: 131 NQSIVGQMRIRPGVFLTNKQNITENQVSRFNE-SLPALLIDVAVKAALSSRKFATEKANF 189
Query: 181 DNVQRGYALLQCTRDINSSSCRSCLATLTNESQNCCQIRRGWRILSPSCSLRYEEYGFYE 240
Q Y+L+QCT D+ + C SCL + N CC G R+++PSCS RYE Y FY
Sbjct: 190 TVFQTIYSLVQCTPDLTNQDCESCLRQVINYLPRCCDRSVGGRVIAPSCSFRYELYPFYN 249
Query: 241 QP--------------SAPAPQSTP--DGGGKNTKTIVIATVSSVAAVVAALLGLWYYLF 284
+ +AP P + P G GKN T+++ ++ +V LLG +L
Sbjct: 250 ETIAAAPMAPPPSSTVTAP-PLNIPSEKGKGKNL-TVIVTAIAVPVSVCVLLLGAMCWLL 307
Query: 285 RCRRKSRRGEGITEEILLRNFKGSNRPELMEGGILVTEGEDSGEMHYIGLTTILAATNNF 344
RR++ + TE +L E GI TE + I AATN F
Sbjct: 308 -ARRRNNKLSAETE-------------DLDEDGITSTETLQ------FQFSAIEAATNKF 347
Query: 345 SNENKLGEGGFGPVYKGKLPNGKEVAVK 372
S NKLG GGFG VYKG+L G+ VA+K
Sbjct: 348 SESNKLGHGGFGEVYKGQLITGETVAIK 375
|
Arabidopsis thaliana (taxid: 3702) EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: - |
| >sp|O65482|CRK23_ARATH Putative cysteine-rich receptor-like protein kinase 23 OS=Arabidopsis thaliana GN=CRK23 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8GYA4|CRK10_ARATH Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana GN=CRK10 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q8S9L6|CRK29_ARATH Cysteine-rich receptor-like protein kinase 29 OS=Arabidopsis thaliana GN=CRK29 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9C5S8|CRK5_ARATH Cysteine-rich receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O49564|CRK27_ARATH Cysteine-rich receptor-like protein kinase 27 OS=Arabidopsis thaliana GN=CRK27 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|O65468|CRK8_ARATH Cysteine-rich receptor-like protein kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9T0J1|CRK26_ARATH Cysteine-rich receptor-like protein kinase 26 OS=Arabidopsis thaliana GN=CRK26 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LRJ9|CRR38_ARATH Cysteine-rich repeat secretory protein 38 OS=Arabidopsis thaliana GN=CRRSP38 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O65479|CRK20_ARATH Putative cysteine-rich receptor-like protein kinase 20 OS=Arabidopsis thaliana GN=CRK20 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 375 | ||||||
| 255555051 | 1390 | serine-threonine protein kinase, plant-t | 0.930 | 0.251 | 0.546 | 1e-109 | |
| 359496705 | 1453 | PREDICTED: uncharacterized protein LOC10 | 0.992 | 0.256 | 0.481 | 6e-91 | |
| 359496137 | 704 | PREDICTED: cysteine-rich receptor-like p | 0.824 | 0.438 | 0.489 | 6e-78 | |
| 449479654 | 1230 | PREDICTED: cysteine-rich receptor-like p | 0.888 | 0.270 | 0.424 | 6e-71 | |
| 449434362 | 579 | PREDICTED: cysteine-rich receptor-like p | 0.762 | 0.493 | 0.422 | 1e-63 | |
| 224109230 | 268 | predicted protein [Populus trichocarpa] | 0.586 | 0.820 | 0.582 | 8e-62 | |
| 449434360 | 2802 | PREDICTED: uncharacterized protein LOC10 | 0.744 | 0.099 | 0.387 | 1e-57 | |
| 356510387 | 647 | PREDICTED: cysteine-rich receptor-like p | 0.781 | 0.452 | 0.407 | 1e-55 | |
| 359474717 | 663 | PREDICTED: cysteine-rich receptor-like p | 0.861 | 0.487 | 0.385 | 2e-51 | |
| 147811956 | 839 | hypothetical protein VITISV_019620 [Viti | 0.906 | 0.405 | 0.368 | 6e-51 |
| >gi|255555051|ref|XP_002518563.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223542408|gb|EEF43950.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 401 bits (1031), Expect = e-109, Method: Compositional matrix adjust.
Identities = 210/384 (54%), Positives = 264/384 (68%), Gaps = 35/384 (9%)
Query: 1 MFVQQISGAFHLFLITIFAIAFSINCQPTYNTHICLGPENDTAPAEYIASLNSLFDSLSS 60
MF+ S A LI I A+A SI+CQ TYN HICLG NDTA A + ++L +L +SLSS
Sbjct: 742 MFLHHKSNALIFLLIIISALASSIDCQATYNAHICLGAANDTASANFKSNLTALLNSLSS 801
Query: 61 KAS-SESFYNGSSNGIYSLYLCRGDVSTSTCRICVNNATQQLRQRCPSDKRAIIWYDECM 119
KA+ + SFYN SSNG+YSLYLCRGDVS+ TC++CV A Q+++++CPS+K AIIWYD+CM
Sbjct: 802 KATLNNSFYNDSSNGVYSLYLCRGDVSSGTCQLCVETAIQEIQRQCPSNKSAIIWYDQCM 861
Query: 120 LRYSNMNFFGREQTLPRLLMWNSQNNTSPEQQNYGALGLIFSLVDSVPRTDLMFDTKDGI 179
LRYSN FFG QT PR+LMWN QNNTSP++ +YGALGLI++L SVP +MF T++
Sbjct: 862 LRYSNTKFFGLAQTSPRVLMWNIQNNTSPDEPDYGALGLIYTLTGSVPYKAMMFGTEESE 921
Query: 180 VDN-VQRGYALLQCTRDINSSSCRSCLATLTNESQNCCQIRRGWRILSPSCSLRYEEYGF 238
+N Q+ YAL+QCTRDI+SS+C SCL L + +CCQ ++GWRIL+PSC+LRYEE F
Sbjct: 922 TNNGSQKRYALVQCTRDIDSSACSSCLGELIDSITDCCQGKKGWRILAPSCNLRYEETLF 981
Query: 239 YEQPSAPAPQSTP----------DGGGKNTKTIVIATVSSVAAVVAALLGLWYYLFRCRR 288
+E PSAP P S P +GGG NT TI IA +S V+ ALLG WYY C
Sbjct: 982 FEWPSAP-PVSEPEPENDYYVVNEGGGSNTATIAIAVAASSTVVIGALLGFWYY--SCYY 1038
Query: 289 KSRRGEGITEEILLRNFKGSNRPELMEGGILVTEGEDSGEMHYIGLTTILAATNNFSNEN 348
K RR +G + + +++G MHY LTTI +ATNNFS N
Sbjct: 1039 KRRRP--------------------TDGEMHASNDDNNGGMHYFNLTTIRSATNNFSTAN 1078
Query: 349 KLGEGGFGPVYKGKLPNGKEVAVK 372
KLGEGGFGPVYKGKLPNG+E+AVK
Sbjct: 1079 KLGEGGFGPVYKGKLPNGQEIAVK 1102
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359496705|ref|XP_003635307.1| PREDICTED: uncharacterized protein LOC100265431, partial [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359496137|ref|XP_003635161.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449479654|ref|XP_004155665.1| PREDICTED: cysteine-rich receptor-like protein kinase 8-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449434362|ref|XP_004134965.1| PREDICTED: cysteine-rich receptor-like protein kinase 8-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224109230|ref|XP_002333290.1| predicted protein [Populus trichocarpa] gi|224116350|ref|XP_002317276.1| predicted protein [Populus trichocarpa] gi|222835846|gb|EEE74281.1| predicted protein [Populus trichocarpa] gi|222860341|gb|EEE97888.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449434360|ref|XP_004134964.1| PREDICTED: uncharacterized protein LOC101207147 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356510387|ref|XP_003523920.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359474717|ref|XP_002267916.2| PREDICTED: cysteine-rich receptor-like protein kinase 25-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147811956|emb|CAN74851.1| hypothetical protein VITISV_019620 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 375 | ||||||
| TAIR|locus:2115728 | 675 | CRK25 "cysteine-rich RLK (RECE | 0.906 | 0.503 | 0.336 | 3.4e-45 | |
| TAIR|locus:2121676 | 669 | CRK10 "cysteine-rich RLK (RECE | 0.912 | 0.511 | 0.319 | 4.1e-37 | |
| TAIR|locus:2121626 | 830 | CRK23 "cysteine-rich RLK (RECE | 0.576 | 0.260 | 0.311 | 2.2e-36 | |
| TAIR|locus:2141201 | 679 | CRK29 "cysteine-rich RLK (RECE | 0.912 | 0.503 | 0.294 | 2.5e-34 | |
| TAIR|locus:2141762 | 665 | CRK26 "cysteine-rich RLK (RECE | 0.626 | 0.353 | 0.300 | 2.2e-33 | |
| TAIR|locus:2121651 | 676 | CRK8 "cysteine-rich RLK (RECEP | 0.92 | 0.510 | 0.302 | 2.3e-32 | |
| TAIR|locus:2127323 | 642 | CRK27 "cysteine-rich RLK (RECE | 0.912 | 0.532 | 0.304 | 6.6e-32 | |
| TAIR|locus:2121686 | 645 | CRK19 "cysteine-rich RLK (RECE | 0.552 | 0.320 | 0.296 | 8.2e-32 | |
| TAIR|locus:2095662 | 252 | AT3G22060 "AT3G22060" [Arabido | 0.44 | 0.654 | 0.386 | 3.3e-31 | |
| TAIR|locus:2121636 | 659 | CRK7 "cysteine-rich RLK (RECEP | 0.898 | 0.511 | 0.292 | 1.5e-30 |
| TAIR|locus:2115728 CRK25 "cysteine-rich RLK (RECEPTOR-like protein kinase) 25" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 475 (172.3 bits), Expect = 3.4e-45, P = 3.4e-45
Identities = 130/386 (33%), Positives = 177/386 (45%)
Query: 12 LFLITIFAIAFSINCQPTYNTHICLGPENDTAPAEYIASLNXXXXXXXXXXXXXXXY--N 69
LF + +F I ++ PTY HIC + + Y+ +L N
Sbjct: 11 LFSVFLFMILKTVTSDPTYLYHICPNTTTYSRNSSYLTNLRTVLSSLSSPNAAYASLFDN 70
Query: 70 GS------SNGIYSLYLCRGDVSTSTCRICVNNATQQLRQRCPSDKRAIIWYDECMLRYS 123
+ SN +Y ++LCRGDVS CR CV A + QRCP +K A+IWYDECM+RYS
Sbjct: 71 AAAGEENDSNRVYGVFLCRGDVSAEICRDCVAFAANETLQRCPREKVAVIWYDECMVRYS 130
Query: 124 NMNFFGREQTLPRLLMWNSQNNTSPEQQNYGALGLIFSLVDSVPRTDLM---FDTKDGIV 180
N + G+ + P + + N QN T + + L L+D + L F T+
Sbjct: 131 NQSIVGQMRIRPGVFLTNKQNITENQVSRFNE-SLPALLIDVAVKAALSSRKFATEKANF 189
Query: 181 DNVQRGYALLQCTRDINSSSCRSCLATLTNESQNCCQIRRGWRILSPSCSLRYEEYGFYE 240
Q Y+L+QCT D+ + C SCL + N CC G R+++PSCS RYE Y FY
Sbjct: 190 TVFQTIYSLVQCTPDLTNQDCESCLRQVINYLPRCCDRSVGGRVIAPSCSFRYELYPFYN 249
Query: 241 Q-----PSAPAPQST--------PDGGGKNTKXXXXXXXXXXXXXX-XXLLGLWYYLFRC 286
+ P AP P ST P GK LLG +L
Sbjct: 250 ETIAAAPMAPPPSSTVTAPPLNIPSEKGKGKNLTVIVTAIAVPVSVCVLLLGAMCWLL-A 308
Query: 287 RRKSRRGEGITEEILLRNFKGSNRPELMEGGILVTEGEDSGEMHYIGLTTILAATNNFSN 346
RR++ + TE+ L E GI TE + + + + I AATN FS
Sbjct: 309 RRRNNKLSAETED-------------LDEDGITSTE---TLQFQF---SAIEAATNKFSE 349
Query: 347 ENKLGEGGFGPVYKGKLPNGKEVAVK 372
NKLG GGFG VYKG+L G+ VA+K
Sbjct: 350 SNKLGHGGFGEVYKGQLITGETVAIK 375
|
|
| TAIR|locus:2121676 CRK10 "cysteine-rich RLK (RECEPTOR-like protein kinase) 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2121626 CRK23 "cysteine-rich RLK (RECEPTOR-like protein kinase) 23" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2141201 CRK29 "cysteine-rich RLK (RECEPTOR-like protein kinase) 29" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2141762 CRK26 "cysteine-rich RLK (RECEPTOR-like protein kinase) 26" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2121651 CRK8 "cysteine-rich RLK (RECEPTOR-like protein kinase) 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2127323 CRK27 "cysteine-rich RLK (RECEPTOR-like protein kinase) 27" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2121686 CRK19 "cysteine-rich RLK (RECEPTOR-like protein kinase) 19" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2095662 AT3G22060 "AT3G22060" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2121636 CRK7 "cysteine-rich RLK (RECEPTOR-like protein kinase) 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00008003001 | SubName- Full=Chromosome undetermined scaffold_1177, whole genome shotgun sequence; (666 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 375 | |||
| pfam01657 | 106 | pfam01657, Stress-antifung, Salt stress response/a | 1e-25 | |
| pfam01657 | 106 | pfam01657, Stress-antifung, Salt stress response/a | 2e-14 | |
| cd05122 | 253 | cd05122, PKc_STE, Catalytic domain of STE family P | 4e-04 | |
| cd00192 | 262 | cd00192, PTKc, Catalytic domain of Protein Tyrosin | 0.002 | |
| pfam00069 | 260 | pfam00069, Pkinase, Protein kinase domain | 0.003 |
| >gnl|CDD|216632 pfam01657, Stress-antifung, Salt stress response/antifungal | Back alignment and domain information |
|---|
Score = 99.1 bits (247), Expect = 1e-25
Identities = 42/105 (40%), Positives = 59/105 (56%), Gaps = 10/105 (9%)
Query: 33 HICLGPEND---TAPAEYIASLNSLFDSLSSKASSES---FYNGS----SNGIYSLYLCR 82
H+C + TA + + ++LN+L SLSS A+S S F G+ + +Y L CR
Sbjct: 2 HLCSSNTSGNYTTANSTFESNLNALLSSLSSNAASSSGKGFAAGTSGAAPDTVYGLAQCR 61
Query: 83 GDVSTSTCRICVNNATQQLRQRCPSDKRAIIWYDECMLRYSNMNF 127
GD+S S CR C+ A +LR+ CP+ K IWYD C LRY + F
Sbjct: 62 GDLSASDCRSCLATAVSELRRCCPNKKGGRIWYDSCFLRYESYPF 106
|
This domain is often found in association with the kinase domains pfam00069 or pfam07714. In many proteins it is duplicated. It contains six conserved cysteines which are involved in disulphide bridges. It has a role in salt stress response and has antifungal activity. Length = 106 |
| >gnl|CDD|216632 pfam01657, Stress-antifung, Salt stress response/antifungal | Back alignment and domain information |
|---|
| >gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 375 | |||
| PF01657 | 106 | Stress-antifung: Salt stress response/antifungal; | 99.89 | |
| PF01657 | 106 | Stress-antifung: Salt stress response/antifungal; | 99.8 | |
| KOG1187 | 361 | consensus Serine/threonine protein kinase [Signal | 98.97 | |
| KOG3653 | 534 | consensus Transforming growth factor beta/activin | 98.48 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.9 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 97.5 | |
| KOG2052 | 513 | consensus Activin A type IB receptor, serine/threo | 97.32 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 96.98 | |
| KOG1025 | 1177 | consensus Epidermal growth factor receptor EGFR an | 96.75 | |
| KOG1026 | 774 | consensus Nerve growth factor receptor TRKA and re | 96.54 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 95.92 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 95.85 | |
| PTZ00284 | 467 | protein kinase; Provisional | 95.31 | |
| KOG0600 | 560 | consensus Cdc2-related protein kinase [Cell cycle | 94.78 | |
| PF08693 | 40 | SKG6: Transmembrane alpha-helix domain; InterPro: | 94.47 | |
| KOG0663 | 419 | consensus Protein kinase PITSLRE and related kinas | 94.44 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 94.26 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 94.15 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 94.13 | |
| KOG0192 | 362 | consensus Tyrosine kinase specific for activated ( | 94.06 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 93.67 | |
| smart00090 | 237 | RIO RIO-like kinase. | 93.51 | |
| TIGR01982 | 437 | UbiB 2-polyprenylphenol 6-hydroxylase. This model | 93.41 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 93.37 | |
| PF04478 | 154 | Mid2: Mid2 like cell wall stress sensor; InterPro: | 93.29 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 92.97 | |
| KOG1094 | 807 | consensus Discoidin domain receptor DDR1 [Signal t | 92.71 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 92.61 | |
| PF03109 | 119 | ABC1: ABC1 family; InterPro: IPR004147 This entry | 92.55 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 92.53 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 92.33 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 92.33 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 91.92 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 91.86 | |
| KOG1006 | 361 | consensus Mitogen-activated protein kinase (MAPK) | 91.46 | |
| KOG0194 | 474 | consensus Protein tyrosine kinase [Signal transduc | 91.15 | |
| KOG0574 | 502 | consensus STE20-like serine/threonine kinase MST [ | 90.69 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 90.62 | |
| KOG1027 | 903 | consensus Serine/threonine protein kinase and endo | 90.57 | |
| KOG0605 | 550 | consensus NDR and related serine/threonine kinases | 90.46 | |
| KOG0694 | 694 | consensus Serine/threonine protein kinase [Signal | 90.17 | |
| PRK04750 | 537 | ubiB putative ubiquinone biosynthesis protein UbiB | 90.12 | |
| PF15102 | 146 | TMEM154: TMEM154 protein family | 89.25 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 88.97 | |
| PF01102 | 122 | Glycophorin_A: Glycophorin A; InterPro: IPR001195 | 88.09 | |
| KOG1095 | 1025 | consensus Protein tyrosine kinase [Signal transduc | 87.66 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 87.64 | |
| KOG1024 | 563 | consensus Receptor-like protein tyrosine kinase RY | 86.73 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 86.72 | |
| PTZ00382 | 96 | Variant-specific surface protein (VSP); Provisiona | 86.52 | |
| KOG1166 | 974 | consensus Mitotic checkpoint serine/threonine prot | 86.28 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 86.28 | |
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 85.82 | |
| KOG0667 | 586 | consensus Dual-specificity tyrosine-phosphorylatio | 85.41 | |
| KOG1167 | 418 | consensus Serine/threonine protein kinase of the C | 84.13 | |
| KOG0197 | 468 | consensus Tyrosine kinases [Signal transduction me | 82.87 | |
| KOG0032 | 382 | consensus Ca2+/calmodulin-dependent protein kinase | 81.91 | |
| KOG0199 | 1039 | consensus ACK and related non-receptor tyrosine ki | 81.15 | |
| KOG1151 | 775 | consensus Tousled-like protein kinase [Signal tran | 81.12 | |
| KOG1165 | 449 | consensus Casein kinase (serine/threonine/tyrosine | 80.3 | |
| COG0661 | 517 | AarF Predicted unusual protein kinase [General fun | 80.23 |
| >PF01657 Stress-antifung: Salt stress response/antifungal; InterPro: IPR002902 This domain is found in plants and has no known function | Back alignment and domain information |
|---|
Probab=99.89 E-value=2.4e-23 Score=165.08 Aligned_cols=96 Identities=41% Similarity=0.815 Sum_probs=74.9
Q ss_pred cccCC-C-CCcc-CCCcHHHHHHHHHHHHhHhhcc-C--CCccccccc----eEEEEEeecCCCChhhHHHHHHHHHHHH
Q 017218 32 THICL-G-PEND-TAPAEYIASLNSLFDSLSSKAS-S--ESFYNGSSN----GIYSLYLCRGDVSTSTCRICVNNATQQL 101 (375)
Q Consensus 32 ~~~C~-~-~~~~-~~~~~~~~~l~~ll~~l~~~~~-~--~~f~~~~~g----~vygl~qC~~dl~~~~C~~Cl~~a~~~~ 101 (375)
++.|+ + .+++ +.+++|+.+++.||..|...++ . .+|++++.+ ++|||+||++|+++++|+.||+.|+.++
T Consensus 1 ~~~Cs~~~~~~~~~~~~~f~~~l~~ll~~l~~~a~~~~~~~f~~~~~~~~~~~vYgl~qC~~Dls~~dC~~Cl~~a~~~~ 80 (106)
T PF01657_consen 1 WHFCSSNTNNNYTTDNSTFEQNLNSLLSSLVSNAASSSSKGFATGSAGSGPDTVYGLAQCRGDLSPSDCRACLADAVANI 80 (106)
T ss_dssp ---E---SSB----TT-THHHHHHHHHHHHHHHGGGTT-TEEEEEE--ST---EEEEEEE-TTS-HHHHHHHHHHHHCCH
T ss_pred CCcCCCCCCCCcCCCCchHHHHHHHHHHHHHHHHhhccccCcEEeecCCCCCeEEEEEEcCCCCChhhhHHHHHHHHHHH
Confidence 36788 3 3566 5677899999999999999987 3 479988654 9999999999999999999999999999
Q ss_pred HHhCCCCcceEEEccceEEEEccccc
Q 017218 102 RQRCPSDKRAIIWYDECMLRYSNMNF 127 (375)
Q Consensus 102 ~~~c~~~~~a~i~~~~C~lRy~~~~f 127 (375)
+++|+.++||+||+++|+|||++++|
T Consensus 81 ~~~C~~~~g~~v~~~~C~lRY~~~~F 106 (106)
T PF01657_consen 81 SSCCPGSRGGRVWYDSCFLRYENYPF 106 (106)
T ss_dssp HHHTTSBSSEEEEESSEEEEEESS--
T ss_pred HHhCCCCceEEEECCCEEEEEECCCC
Confidence 99999999999999999999999998
|
The structure of this domain is known and it is thought to be involved in antifungal responses in plants []. Two copies of this domain are also found together in cysteine-rich protein kinases and cysteine-rich repeat secretory proteins. The domain contains four conserved cysteines.; PDB: 3A2E_D. |
| >PF01657 Stress-antifung: Salt stress response/antifungal; InterPro: IPR002902 This domain is found in plants and has no known function | Back alignment and domain information |
|---|
| >KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] | Back alignment and domain information |
|---|
| >KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >smart00090 RIO RIO-like kinase | Back alignment and domain information |
|---|
| >TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed | Back alignment and domain information |
|---|
| >PF15102 TMEM154: TMEM154 protein family | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane | Back alignment and domain information |
|---|
| >KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PTZ00382 Variant-specific surface protein (VSP); Provisional | Back alignment and domain information |
|---|
| >KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0661 AarF Predicted unusual protein kinase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 375 | ||||
| 3tl8_A | 349 | The Avrptob-Bak1 Complex Reveals Two Structurally S | 4e-07 | ||
| 3uim_A | 326 | Structural Basis For The Impact Of Phosphorylation | 1e-06 | ||
| 2qkw_B | 321 | Structural Basis For Activation Of Plant Immunity B | 8e-04 | ||
| 3hgk_A | 327 | Crystal Structure Of Effect Protein Avrptob Complex | 8e-04 |
| >pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 | Back alignment and structure |
|
| >pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 | Back alignment and structure |
| >pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 | Back alignment and structure |
| >pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 375 | |||
| 3a2e_A | 108 | Ginkbilobin-2; domain 26 unknown function (DUF26), | 99.93 | |
| 2e79_A | 108 | Ginkbilobin-2; DUF26 fold, C-X8-C-X2-C motif, lect | 99.93 | |
| 3a2e_A | 108 | Ginkbilobin-2; domain 26 unknown function (DUF26), | 99.85 | |
| 2e79_A | 108 | Ginkbilobin-2; DUF26 fold, C-X8-C-X2-C motif, lect | 99.84 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 97.56 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 97.17 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 97.08 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 96.9 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 96.74 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 96.62 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 96.33 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 96.31 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 96.27 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 96.1 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 96.07 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 96.0 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 95.94 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 95.9 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 95.62 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 95.61 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 95.52 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 95.49 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 95.47 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 95.39 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 95.35 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 95.22 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 95.16 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 95.13 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 95.12 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 95.12 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 95.07 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 95.04 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 94.88 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 94.87 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 94.82 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 94.79 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 94.72 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 94.71 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 94.65 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 94.62 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 94.59 | |
| 4gyi_A | 397 | RIO2 kinase; protein kinase, ADP complex, phosphoa | 94.58 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 94.56 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 94.53 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 94.52 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 94.51 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 94.51 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 94.5 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 94.5 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 94.48 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 94.36 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 94.35 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 94.3 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 94.3 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 94.3 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 94.28 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 94.22 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 94.2 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 94.2 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 94.19 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 94.18 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 94.14 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 94.11 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 94.06 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 93.96 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 93.93 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 93.91 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 93.88 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 93.87 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 93.77 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 93.71 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 93.68 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 93.65 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 93.65 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 93.65 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 93.63 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 93.48 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 93.47 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 93.43 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 93.4 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 93.4 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 93.4 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 93.39 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 93.35 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 93.29 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 93.28 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 93.28 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 93.26 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 93.2 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 93.05 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 93.02 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 93.01 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 92.91 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 92.85 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 92.85 | |
| 2jwa_A | 44 | Receptor tyrosine-protein kinase ERBB-2; transmemb | 92.75 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 92.63 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 92.5 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 92.44 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 92.32 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 92.18 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 91.93 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 91.92 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 91.86 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 91.6 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 91.43 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 91.14 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 91.02 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 90.84 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 89.84 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 89.42 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 86.98 | |
| 2k1k_A | 38 | Ephrin type-A receptor 1; EPHA1, receptor tyrosine | 81.29 |
| >3a2e_A Ginkbilobin-2; domain 26 unknown function (DUF26), C-X8-C-X2-C motif, antifungal protein, embryo-abundant protein (EAP), plant protein; 2.38A {Ginkgo biloba} | Back alignment and structure |
|---|
Probab=99.93 E-value=1.2e-26 Score=182.96 Aligned_cols=100 Identities=15% Similarity=0.412 Sum_probs=90.5
Q ss_pred CCCCCcccCCCCCccCCCcHHHHHHHHHHHHhHhhcc--CCCccccccc-----eEEEEEeecCCCChhhHHHHHHHHHH
Q 017218 27 QPTYNTHICLGPENDTAPAEYIASLNSLFDSLSSKAS--SESFYNGSSN-----GIYSLYLCRGDVSTSTCRICVNNATQ 99 (375)
Q Consensus 27 ~~~~~~~~C~~~~~~~~~~~~~~~l~~ll~~l~~~~~--~~~f~~~~~g-----~vygl~qC~~dl~~~~C~~Cl~~a~~ 99 (375)
++.++++.|+. ++++++++|+.||+.||..|+++++ ..+|++...+ +||||+|||||+++++|+.||+.|+.
T Consensus 2 ~t~~v~~~Cn~-~~~t~~s~f~~nl~~ll~~L~~~a~~s~~~~~t~~~~~~~~~~vygl~qC~~Dls~~~C~~Cl~~a~~ 80 (108)
T 3a2e_A 2 NTAFVSSACNT-QKIPSGSPFNRNLRAMLADLRQNTAFSGYDYKTSRAGSGGAPTAYGRATCKQSISQSDCTACLSNLVN 80 (108)
T ss_dssp CCCEEEEEECS-SBCCTTCTHHHHHHHHHHHHHHHGGGTTSEEEEEECCSTTCCCEEEEEEECTTSCHHHHHHHHHHHHT
T ss_pred CcceeeeecCC-CccCCCChHHHHHHHHHHHHHhhCccccCCceEeeccCCCCceEEEEEEEcCCCCHHHHHHHHHHHHH
Confidence 46788899964 7999999999999999999999987 3356665543 89999999999999999999999999
Q ss_pred HHHHhCCCCcceEEEccceEEEEccccc
Q 017218 100 QLRQRCPSDKRAIIWYDECMLRYSNMNF 127 (375)
Q Consensus 100 ~~~~~c~~~~~a~i~~~~C~lRy~~~~f 127 (375)
+++++||+++||+||+++|+||||+++|
T Consensus 81 ~~~~~C~~~~g~~i~~~~C~lRY~~~~F 108 (108)
T 3a2e_A 81 RIFSICNNAIGARVQLVDCFIQYEQRSF 108 (108)
T ss_dssp THHHHTTSBSSEEEEETTEEEEEESSCC
T ss_pred HHHHHCCCCceEEEECCCEEEEEeCCcC
Confidence 9999999999999999999999999998
|
| >3a2e_A Ginkbilobin-2; domain 26 unknown function (DUF26), C-X8-C-X2-C motif, antifungal protein, embryo-abundant protein (EAP), plant protein; 2.38A {Ginkgo biloba} | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
| >2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 375 | ||||
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 3e-08 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 5e-08 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 1e-07 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 1e-07 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 6e-07 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 6e-07 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 9e-07 | |
| d1zara2 | 191 | d.144.1.9 (A:91-281) Rio2 serine protein kinase C- | 1e-06 | |
| d1ob3a_ | 286 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod | 1e-06 | |
| d1u5ra_ | 309 | d.144.1.7 (A:) Serine/threonine protein kinase TAO | 3e-06 | |
| d1vjya_ | 303 | d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human | 4e-06 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 5e-06 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 7e-06 | |
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 7e-06 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 1e-05 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 1e-05 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 1e-05 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 2e-05 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 2e-05 | |
| d1pmea_ | 345 | d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien | 2e-05 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 2e-05 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 3e-05 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 3e-05 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 3e-05 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 3e-05 | |
| d1csna_ | 293 | d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast | 5e-05 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 5e-05 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 5e-05 | |
| d1o6ya_ | 277 | d.144.1.7 (A:) Mycobacterial protein kinase PknB, | 5e-05 | |
| d1nvra_ | 271 | d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { | 5e-05 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 6e-05 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 6e-05 | |
| d3blha1 | 318 | d.144.1.7 (A:8-325) Cell division protein kinase 9 | 7e-05 | |
| d1ckia_ | 299 | d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n | 7e-05 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 7e-05 | |
| d2gfsa1 | 348 | d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa | 8e-05 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 9e-05 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 1e-04 | |
| d1unla_ | 292 | d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H | 1e-04 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 1e-04 | |
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 1e-04 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 1e-04 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 1e-04 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 1e-04 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 1e-04 | |
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 1e-04 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 2e-04 | |
| d1cm8a_ | 346 | d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s | 2e-04 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 2e-04 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 2e-04 | |
| d1ua2a_ | 299 | d.144.1.7 (A:) Cell division protein kinase 7, CDK | 2e-04 | |
| d1q8ya_ | 362 | d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces | 2e-04 | |
| d2b1pa1 | 355 | d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 | 3e-04 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 4e-04 | |
| d1xwsa_ | 273 | d.144.1.7 (A:) Proto-oncogene serine/threonine-pro | 4e-04 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 5e-04 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 5e-04 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 5e-04 | |
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 7e-04 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 8e-04 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 9e-04 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 0.002 | |
| d2ozaa1 | 335 | d.144.1.7 (A:51-385) MAP kinase activated protein | 0.002 |
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: c-src tyrosine kinase species: Human (Homo sapiens) [TaxId: 9606]
Score = 52.0 bits (124), Expect = 3e-08
Identities = 12/34 (35%), Positives = 17/34 (50%)
Query: 342 NNFSNENKLGEGGFGPVYKGKLPNGKEVAVKSFH 375
+ E KLG+G FG V+ G VA+K+
Sbjct: 17 ESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLK 50
|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 375 | |||
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 96.82 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 96.34 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 95.99 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 95.95 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 95.55 |
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Hepatocyte growth factor receptor, c-MET species: Human (Homo sapiens) [TaxId: 9606]
Probab=96.82 E-value=0.00023 Score=63.75 Aligned_cols=32 Identities=41% Similarity=0.699 Sum_probs=24.9
Q ss_pred ccccccceeccCCCcceEEEEcCCC----CEEEEEecC
Q 017218 342 NNFSNENKLGEGGFGPVYKGKLPNG----KEVAVKSFH 375 (375)
Q Consensus 342 ~~Fs~~n~iG~G~fG~VYKg~L~~G----~~VAVKrL~ 375 (375)
-+|+ ++||+|+||+||||.+.+. ..||||+++
T Consensus 29 ~~~~--~~iG~G~fg~Vyk~~~~~~~~~~~~vAvK~~~ 64 (311)
T d1r0pa_ 29 VHFN--EVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLN 64 (311)
T ss_dssp EEEE--EEEEEETTEEEEEEEECC----CEEEEEEEEC
T ss_pred eccc--eEEeecCCeEEEEEEEECCCCEEEEEEEEEEC
Confidence 3453 7899999999999998543 268999874
|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|