Citrus Sinensis ID: 017229


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-----
MASRYWVVSLPVQNSAASVWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDDLVKSNSFVESVSHKIRRQIEELERVSGIESSSLSVDGVPVDTYLTRFVWDEAKYPTMSPLREIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIITSEHLVTLLAVVPKYSQKDWLASYETLTSYVVPRSSKLLYEDNEYALYTVTLFGRVADNFRIAAREKGFQIRDFEYSSEAQESRNQELEKLVHDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSILEELCGNANSTFWKSEDDGGMMAGLGGDADSHPYVSFTINLV
ccccEEEEECcccccHHHHHHHHHHHHHccccccccCCccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEECccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEEEccccHHHHHHHHccccccccccccccccccccEEEEEEEEEcccHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEECcccccHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEEc
MASRYWVVSLPVQNSAASVWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDDLVKSNSFVESVSHKIRRQIEEL*********SLSVDGVPVDTYLTRFVWDEAKYPTMSPLREIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIITSEHLVTLLAVVPKYSQKDWLASYETLTSYVVPRSSKLLYEDNEYALYTVTLFGRVADNFRIAAREKGFQIRDFE***********************RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSILEELCGNANSTFW************GGDADSHPYVSFTINLV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASRYWVVSLPVQNSAASVWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDDLVKSNSFVESVSHKIRRQIEELERVSGIESSSLSVDGVPVDTYLTRFVWDEAKYPTMSPLREIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIITSEHLVTLLAVVPKYSQKDWLASYETLTSYVVPRSSKLLYEDNEYALYTVTLFGRVADNFRIAAREKGFQIRDFEYSxxxxxxxxxxxxxxxxxxxxxRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSILEELCGNANSTFWKSEDDGGMMAGLGGDADSHPYVSFTINLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
V-type proton ATPase subunit C Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.confidentQ9SDS7
V-type proton ATPase subunit C Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.probableQ9SCB9
V-type proton ATPase subunit C 1 Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.probableP21283

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U7L, chain A
Confidence level:very confident
Coverage over the Query: 2-347,364-374
View the alignment between query and template
View the model in PyMOL