Citrus Sinensis ID: 017229

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-----

MASRYWVVSLPVQNSAASVWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDDLVKSNSFVESVSHKIRRQIEELERVSGIESSSLSVDGVPVDTYLTRFVWDEAKYPTMSPLREIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIITSEHLVTLLAVVPKYSQKDWLASYETLTSYVVPRSSKLLYEDNEYALYTVTLFGRVADNFRIAAREKGFQIRDFEYSSEAQESRNQELEKLVHDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSILEELCGNANSTFWKSEDDGGMMAGLGGDADSHPYVSFTINLV

ccccEEEEECcccccHHHHHHHHHHHHHccccccccCCccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEECccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEEEccccHHHHHHHHccccccccccccccccccccEEEEEEEEEcccHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEECcccccHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEEc

MASRYWVVSLPVQNSAASVWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDDLVKSNSFVESVSHKIRRQIEEL*********SLSVDGVPVDTYLTRFVWDEAKYPTMSPLREIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIITSEHLVTLLAVVPKYSQKDWLASYETLTSYVVPRSSKLLYEDNEYALYTVTLFGRVADNFRIAAREKGFQIRDFE***********************RSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSILEELCGNANSTFW************GGDADSHPYVSFTINLV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASRYWVVSLPVQNSAASVWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDDLVKSNSFVESVSHKIRRQIEELERVSGIESSSLSVDGVPVDTYLTRFVWDEAKYPTMSPLREIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVKPEDIITSEHLVTLLAVVPKYSQKDWLASYETLTSYVVPRSSKLLYEDNEYALYTVTLFGRVADNFRIAAREKGFQIRDFEYSxxxxxxxxxxxxxxxxxxxxxRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSILEELCGNANSTFWKSEDDGGMMAGLGGDADSHPYVSFTINLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
V-type proton ATPase subunit C	Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.	confident	Q9SDS7
V-type proton ATPase subunit C	Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.	probable	Q9SCB9
V-type proton ATPase subunit C 1	Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.	probable	P21283

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U7L, chain A
Confidence level:very confident
Coverage over the Query: 2-347,364-374
View the alignment between query and template
View the model in PyMOL